Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C06292g8.852ON25625611591e-162
SAKL0D01122g8.852ON3111772178e-20
AFR449W8.852ON2991621543e-11
TPHA0I003408.852ON3951511431e-09
ZYRO0C14916g8.852ON3282261421e-09
KNAG0G034908.852ON317691304e-08
Kwal_27.102108.852ON2781821295e-08
KAFR0A028808.852ON4301771298e-08
Smik_13.158.852ON357311262e-07
Suva_13.248.852ON360291262e-07
Skud_13.228.852ON356301262e-07
YML119W8.852ON357291252e-07
CAGL0B02409g8.852ON361521234e-07
Kpol_237.38.852ON351301225e-07
KLTH0C03652g8.852ON276891207e-07
TDEL0B002108.852ON333301209e-07
NCAS0B002508.852ON316631172e-06
NDAI0E002408.852ON519291173e-06
TBLA0D033108.852ON502281093e-05
TBLA0G010406.18ON97253683.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06292g
         (256 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {O...   451   e-162
SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved...    88   8e-20
AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic h...    64   3e-11
TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}...    60   1e-09
ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa] ...    59   1e-09
KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON...    55   4e-08
Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {O...    54   5e-08
KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {O...    54   8e-08
Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W (...    53   2e-07
Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W (...    53   2e-07
Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W (...    53   2e-07
YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative pro...    53   2e-07
CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {...    52   4e-07
Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON} co...    52   5e-07
KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {O...    51   7e-07
TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}...    51   9e-07
NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852 ...    50   2e-06
NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852...    50   3e-06
TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {O...    47   3e-05
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...    31   3.6  

>KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 256

 Score =  451 bits (1159), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 225/256 (87%), Positives = 225/256 (87%)

Query: 1   MTEGRRLSNRSSIRNTTHIFNDXXXXXXXXXXXXXXXXXXRQSPNKQHISSSPPILEVQN 60
           MTEGRRLSNRSSIRNTTHIFND                  RQSPNKQHISSSPPILEVQN
Sbjct: 1   MTEGRRLSNRSSIRNTTHIFNDTSSKTKGTKFKFKNGSGTRQSPNKQHISSSPPILEVQN 60

Query: 61  IADVDTSNTFGQFNRISQPPSKNLNYDTPKINVKLEYHTMQSSKIIYKIDVPISSKSDME 120
           IADVDTSNTFGQFNRISQPPSKNLNYDTPKINVKLEYHTMQSSKIIYKIDVPISSKSDME
Sbjct: 61  IADVDTSNTFGQFNRISQPPSKNLNYDTPKINVKLEYHTMQSSKIIYKIDVPISSKSDME 120

Query: 121 ISPVITKLINETHESAEAFKLCNDNRFGYTTLDALPAVLSKYISQNMSVQRLPQRPKTKH 180
           ISPVITKLINETHESAEAFKLCNDNRFGYTTLDALPAVLSKYISQNMSVQRLPQRPKTKH
Sbjct: 121 ISPVITKLINETHESAEAFKLCNDNRFGYTTLDALPAVLSKYISQNMSVQRLPQRPKTKH 180

Query: 181 LYNRVDQLLAQENQFFSANDSIELSFDGKAMNKNDIFRIVDSFSVAFXXXXXXXXXXXXX 240
           LYNRVDQLLAQENQFFSANDSIELSFDGKAMNKNDIFRIVDSFSVAF             
Sbjct: 181 LYNRVDQLLAQENQFFSANDSIELSFDGKAMNKNDIFRIVDSFSVAFDDDEYGEDGDDEY 240

Query: 241 VKQPRNILTREVTGVF 256
           VKQPRNILTREVTGVF
Sbjct: 241 VKQPRNILTREVTGVF 256

>SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved
           hypothetical protein
          Length = 311

 Score = 88.2 bits (217), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 94/177 (53%), Gaps = 7/177 (3%)

Query: 84  LNYDTPKINVKLEYHTMQSSKIIYKIDVPISSKSDMEISPVITKLINE---THESAEAFK 140
           ++Y+  + NV +     + S   YK+  P+ S++     P+I K+I+    ++   +  K
Sbjct: 138 IDYEACRTNVVVNETQKRKSIAYYKLCEPMLSEASRR-KPMIAKIIDAKRNSYNERQPIK 196

Query: 141 LCNDNRFGYTTLDALPAVLSKYISQNMSVQRLPQRPKTKHLYNRVDQLLAQENQFFSAND 200
           L  +  +   +L+  P  +SKYI+      R      T+   N++DQL+AQE+     ND
Sbjct: 197 LGANTEYQVVSLEQFPDTVSKYINDLKKPNRRTLASSTRVANNKIDQLIAQESYSTCQND 256

Query: 201 SIELSFDGKAMNKNDIFRIVDSFSVAFXXXXXXXXXXXXXVKQPRNILTREVT-GVF 256
           SI+LSFDGKA++K+DI RIVDSFSV F             +    NIL RE+T GVF
Sbjct: 257 SIDLSFDGKALDKSDILRIVDSFSVGF--DDDDDDEGEPNIFSTTNILPREMTSGVF 311

>AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML119W
          Length = 299

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 22/162 (13%)

Query: 107 YKIDVPI------SSKSDMEISPVITKLINE---THESAEAFKLCNDNRFGYTTLDALPA 157
           YKI  P+      SSKS+ +    + KLI +    +   +  +L + + +  T+LD L  
Sbjct: 148 YKIAEPLLNVAHDSSKSNTQ---RLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGE 204

Query: 158 VLSKYISQNMSVQR--LPQRPKTKHLYNRVDQLLAQENQFFSANDSIELSFDGKAMNKND 215
           ++ +Y  +   V+R  L     +    +RVD L+   N    ANDSI+LSFDGKA+NK+D
Sbjct: 205 IIERYQVEKPVVKRRSLASSNYSTVFQDRVDYLIVPTN----ANDSIDLSFDGKAINKSD 260

Query: 216 IFRIVDSFSVAFXXXXXXXXXXXXXVKQPRNILTREVT-GVF 256
             R++DSFS+A                  RNIL R++T GV+
Sbjct: 261 FLRMMDSFSLALDEEDDNNKHYDF---HSRNILPRDITSGVY 299

>TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}
           Anc_8.852 YML119W
          Length = 395

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 80/151 (52%), Gaps = 13/151 (8%)

Query: 89  PKINVKLEYHTMQSSKIIYKIDVPISSKSDM--EISPVITKLINETHESAEAFKLCN-DN 145
           P IN+ +   T QS K +YK+ VPI+ K      +S +I       +   ++FK  N D+
Sbjct: 199 PVINL-VSKKTQQSIKKVYKLSVPINYKDTTYSGVSSLIETEYRPLYSKDQSFKFYNKDS 257

Query: 146 RFGYTTLDALPAVL-------SKYISQNMSVQRLPQRPKTKHLYNRVDQLLAQEN--QFF 196
              + TLDA+   +       +K    N +++++     ++ L +  ++        +  
Sbjct: 258 VLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTGLKLT 317

Query: 197 SANDSIELSFDGKAMNKNDIFRIVDSFSVAF 227
           S NDS ELSFDGKA++++DI R+VDSFSVAF
Sbjct: 318 SNNDSFELSFDGKALDRSDILRMVDSFSVAF 348

>ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa]
           {ON} some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 328

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 94/226 (41%), Gaps = 33/226 (14%)

Query: 41  RQSPNKQHISSSPPILEVQNIADVDTSNTFGQFNRISQPPSKNLNYDT---------PKI 91
           R  P  + ISS   I E++ +  V   N F   NR    P   ++ D+         P I
Sbjct: 123 RGPPKYKEISS---IYELEKVDPVKQENNF--TNRYFSDP---VDLDSARSDDGRLKPII 174

Query: 92  NVKLEYHTMQSSKIIYKIDVPISSKSDME--ISPVITKLINETHESAEAFKLCNDNRFGY 149
           N   +         IYK+ +P+    D    +   I ++    + S +   L  D    Y
Sbjct: 175 NTASKNGKSYPGNKIYKLSIPLLVCQDTHRALKNQIERVYRSKYHSYQPLSLFGDMSIRY 234

Query: 150 TTLDALPAVLSKYISQNMSVQRLPQRPKTKHLYNRVDQLLAQENQFFSANDSIELSFDGK 209
             L+ L +   +++ +     R PQ P          Q+    N   + NDS ELSFDGK
Sbjct: 235 YRLEDLQSRFIEFLQK----PRKPQPPL---------QVARSLNGTGALNDSFELSFDGK 281

Query: 210 AMNKNDIFRIVDSFSVAFXXXXXXXXXXXXXVKQPRNILTREVTGV 255
           A++++DIFR+VDSFSVA                  RNIL  E+TG 
Sbjct: 282 ALDRSDIFRMVDSFSVALSDDDAEDESSFVNSSG-RNILPAEMTGT 326

>KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON}
           Anc_8.852 YML119W
          Length = 317

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 41/69 (59%), Gaps = 5/69 (7%)

Query: 185 VDQLLAQENQFFSANDSIELSFDGKAMNKNDIFRIVDSFSVAFXXXXXXXXXXXXXVKQP 244
           VDQ+ +        NDS +LSFDGKAM+++DIFR+VDSFS+A               + P
Sbjct: 250 VDQVASGGGH----NDSFDLSFDGKAMDRSDIFRMVDSFSIAPDEDDDEDPSPTGR-QVP 304

Query: 245 RNILTREVT 253
           RNIL  E+T
Sbjct: 305 RNILPAEIT 313

>Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {ON}
           YML119W - Hypothetical ORF [contig 39] FULL
          Length = 278

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 89/182 (48%), Gaps = 17/182 (9%)

Query: 48  HISSSPPILEVQNIADVDTSNTFGQFNRISQPPSKNLNYDTPKINVKLEYHTMQSSKIIY 107
            ++S P  +E + I+DV+         R    P K ++Y   K +   E+  +    + Y
Sbjct: 77  QLNSRPRWIEAKTISDVEKPVAKAGNQRYLASPCK-IDYKRGKSSSVAEF--VPQKVVHY 133

Query: 108 KID-VPISSKSDMEISPVITKLI---NETHESAEAFKLCNDNRFGYTTLDALPAVLSKYI 163
           K++ +P  SKS    + +I  +I    E +   +      D ++    L  L   + K+ 
Sbjct: 134 KLEELPFKSKSGR--TQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQALGELSGAVKKFT 191

Query: 164 SQNMSVQRLPQRPKTKHLYNRVDQLLAQENQFFSANDSIELSFDGKAMNKNDIFRIVDSF 223
            +  S +R+ +  K     N + +L  Q+     AND+ +LSFDGKAMN++DIF+IVDSF
Sbjct: 192 ER--STRRIIRASKA----NPLTRLTMQDPG--DANDTADLSFDGKAMNRSDIFKIVDSF 243

Query: 224 SV 225
           S+
Sbjct: 244 SL 245

>KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {ON}
           Anc_8.852 YML119W
          Length = 430

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 81/177 (45%), Gaps = 40/177 (22%)

Query: 70  FGQFNRISQPPSKNLNYDTPKINVKLEYHTMQSSKI-IYKIDVPISS--KSDMEISPVIT 126
           FG+FN  ++  SK +      IN         S+KI  YK+  PI S  K    +S  I 
Sbjct: 220 FGEFNHSNEMKSKAI-----IINTASRSWYKNSNKIQTYKLSTPILSSIKYGSTLSKKID 274

Query: 127 KLINETHESAEAFKLCNDNRFGYTTL-DALPAVLSKYISQ----------------NMSV 169
              N+ + SA+   +  +  F    L +A   ++ KY+SQ                N S 
Sbjct: 275 SHYNDQNISAQPLFIAGNKNFKIDELNEASVELIDKYLSQLDKSSTGRTLIKNSSLNSSK 334

Query: 170 QRLPQRPKTKHLYNRVDQLLAQENQFFSANDSIELSFDGKAMNKNDIFRIVDSFSVA 226
            +  +RP           L+   N     NDS +LSFDGKA+++NDIFR+VDSFS+A
Sbjct: 335 MQRQRRP-----------LINVSN----YNDSFDLSFDGKALDRNDIFRMVDSFSIA 376

>Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W
           (REAL)
          Length = 357

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/31 (70%), Positives = 29/31 (93%)

Query: 196 FSANDSIELSFDGKAMNKNDIFRIVDSFSVA 226
            +AN+S ELSFDGKAM+++DIFR+VDSFS+A
Sbjct: 291 LAANESFELSFDGKAMDRSDIFRMVDSFSIA 321

>Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W
           (REAL)
          Length = 360

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 28/29 (96%)

Query: 198 ANDSIELSFDGKAMNKNDIFRIVDSFSVA 226
           AN+S ELSFDGKAM+++DIFR+VDSFS+A
Sbjct: 297 ANESFELSFDGKAMDRSDIFRMVDSFSIA 325

>Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W
           (REAL)
          Length = 356

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 29/30 (96%)

Query: 197 SANDSIELSFDGKAMNKNDIFRIVDSFSVA 226
           +AN+S ELSFDGKAM+++DIFR+VDSFS+A
Sbjct: 293 TANESFELSFDGKAMDRSDIFRMVDSFSIA 322

>YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative
           protein of unknown function; YML119W is not an essential
           gene; potential Cdc28p substrate
          Length = 357

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 28/29 (96%)

Query: 198 ANDSIELSFDGKAMNKNDIFRIVDSFSVA 226
           AN+S ELSFDGKAM+++DIFR+VDSFS+A
Sbjct: 294 ANESFELSFDGKAMDRSDIFRMVDSFSIA 322

>CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119w
          Length = 361

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 36/52 (69%), Gaps = 6/52 (11%)

Query: 176 PKTKHLYNRVDQLLAQENQFFSANDSIELSFDGKAMNKNDIFRIVDSFSVAF 227
           PK K   +RV    A      + NDS +LSFDGKA++++DIFR+VDSFS+AF
Sbjct: 287 PKKKSHISRVQPPPA------ATNDSFDLSFDGKALDRSDIFRMVDSFSIAF 332

>Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON}
           complement(3052..4107) [1056 nt, 352 aa]
          Length = 351

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%)

Query: 198 ANDSIELSFDGKAMNKNDIFRIVDSFSVAF 227
            NDS ELSFDGKA++++DI R+VDSFSVAF
Sbjct: 292 GNDSFELSFDGKALDRSDILRMVDSFSVAF 321

>KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {ON}
           conserved hypothetical protein
          Length = 276

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 8/89 (8%)

Query: 137 EAFKLCNDNRFGYTTLDALPAVLSKYISQNMSVQRLPQRPKTKHLYNRVDQLLAQENQFF 196
           +   + +D ++  +TL  LP  + +Y        R+          N + +L  QE+   
Sbjct: 164 QPIGVSDDPKYLVSTLKELPNAVHEY------ADRVSGFTLKNSKANPLARLALQESA-- 215

Query: 197 SANDSIELSFDGKAMNKNDIFRIVDSFSV 225
             N+S++LSFDGKAMNK+DIF++VDSFS+
Sbjct: 216 EVNESVDLSFDGKAMNKSDIFKMVDSFSL 244

>TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}
           Anc_8.852 YML119W
          Length = 333

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%)

Query: 197 SANDSIELSFDGKAMNKNDIFRIVDSFSVA 226
           S NDS +LSFDGKA++++DIFR+VDSFSVA
Sbjct: 273 SLNDSFDLSFDGKALDRSDIFRMVDSFSVA 302

>NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852
           YML119W
          Length = 316

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 7/63 (11%)

Query: 165 QNMSVQRLPQRPKTKHLYNRVDQLLAQENQFFSANDSIELSFDGKAMNKNDIFRIVDSFS 224
           +++ +Q   Q+   + L N   Q    EN F       ELSFDGKA++K+DI RIVDSF+
Sbjct: 234 ESLKLQSPSQKKSHRSLMNLTHQPATMENSF-------ELSFDGKALDKSDILRIVDSFT 286

Query: 225 VAF 227
           +AF
Sbjct: 287 MAF 289

>NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852
           YML119W
          Length = 519

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/29 (68%), Positives = 27/29 (93%)

Query: 199 NDSIELSFDGKAMNKNDIFRIVDSFSVAF 227
           NDS +LSFDGKAM+++DIFR+VDSF++A 
Sbjct: 431 NDSFDLSFDGKAMDRSDIFRMVDSFTMAL 459

>TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {ON}
           Anc_8.852 YML119W
          Length = 502

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/28 (67%), Positives = 26/28 (92%)

Query: 200 DSIELSFDGKAMNKNDIFRIVDSFSVAF 227
           +S +LSFDGKA++++DI R+VDSFSVAF
Sbjct: 421 NSFDLSFDGKALDRSDILRMVDSFSVAF 448

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 55  ILEVQNIADVDTSNTFGQFNRISQPPSKNLNYDTPKINVKLEYHTMQSSKIIY 107
           ++    IA+  + N   + NRI++   KN N +TP I+V LE+ T +  + IY
Sbjct: 558 VISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDV-LEFGTKKPVEWIY 609

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,428,885
Number of extensions: 1019599
Number of successful extensions: 3518
Number of sequences better than 10.0: 37
Number of HSP's gapped: 3636
Number of HSP's successfully gapped: 37
Length of query: 256
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 149
Effective length of database: 41,212,137
Effective search space: 6140608413
Effective search space used: 6140608413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)