Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C06248g8.850ON51651624970.0
TBLA0B029008.850ON52046315590.0
ZYRO0C14872g8.850ON49643615530.0
SAKL0D01166g8.850ON50545815440.0
KLTH0C03608g8.850ON49545915260.0
KAFR0L019608.850ON51143615040.0
TDEL0B001908.850ON49246115010.0
Suva_13.4758.850ON51546314940.0
CAGL0I02684g8.850ON49343714910.0
NCAS0C003108.850ON55643814910.0
KNAG0K006508.850ON48244014810.0
TPHA0I003208.850ON52943714810.0
YMR285C (NGL2)8.850ON51546314780.0
Kwal_27.102048.850ON49443314740.0
Skud_13.4588.850ON51446114720.0
Smik_13.5018.850ON51546314620.0
Kpol_237.18.850ON50343714560.0
NDAI0K003708.850ON56843114260.0
ABL118W8.850ON50442614140.0
Ecym_46198.850ON48743613500.0
NDAI0E002608.850ON49845310981e-145
TBLA0D033008.850ON48044410701e-141
NCAS0B002708.850ON47646510371e-136
Smik_13.168.850ON5024509261e-119
CAGL0B02387g8.850ON4714469111e-117
KAFR0A028608.850ON4784368961e-115
Suva_13.258.850ON5024438961e-114
Skud_13.238.850ON4984468951e-114
YML118W (NGL3)8.850ON5054488861e-113
KNAG0G034708.850ON4664398471e-108
Suva_1.457.78ON8312901723e-12
ZYRO0D05302g7.78ON8572391681e-11
KLTH0D02310g7.78ON7392501653e-11
Kwal_26.71127.78ON7422621582e-10
Ecym_73547.78ON7852301573e-10
Skud_1.407.78ON8692571563e-10
Smik_1.457.78ON8392771554e-10
KLLA0F15884g7.78ON7902241554e-10
ACR288W7.78ON7362241545e-10
TDEL0H037307.78ON7972391537e-10
KAFR0K006707.78ON7952701537e-10
YAL021C (CCR4)7.78ON8372801529e-10
KNAG0D048407.78ON7792411511e-09
TBLA0A046607.78ON8962391473e-09
CAGL0H06149g7.78ON8732471456e-09
SAKL0B10032g7.78ON7312391449e-09
Kpol_1040.147.78ON7842391449e-09
TPHA0H026807.78ON8722391376e-08
ACR277C7.90ON3782681357e-08
NDAI0H025207.78ON8982231323e-07
NCAS0F016407.78ON8552561251e-06
Ecym_26367.90ON3672381213e-06
TBLA0E022607.90ON3882591142e-05
KAFR0D012507.90ON3562601081e-04
KLTH0D02574g7.90ON3682621044e-04
Kwal_26.71707.90ON3722671000.001
TDEL0H036007.90ON366267980.002
KNAG0L005507.90ON381239970.002
KLLA0F07733g7.90ON371237970.003
TPHA0L005307.90ON391248970.003
SAKL0B09768g7.90ON368239940.006
ZYRO0D05588g7.90ON356254920.009
Kpol_1044.67.90ON372267920.010
Suva_15.1277.90ON36387910.015
Smik_15.1257.90ON36391890.023
YOL042W (NGL1)7.90ON36390890.026
Skud_15.1157.90ON36390890.028
CAGL0F01001g7.90ON359238880.035
NDAI0A085307.90ON365236860.065
KAFR0J029303.576ON685148780.59
NCAS0I005007.90ON389104770.73
Suva_9.189na 1ON10763682.2
SAKL0E13926g2.26ON550118723.0
Smik_14.1252.44ON420107713.7
Kpol_1073.122.631ON43276704.6
KLTH0G08096g2.191ON1613117706.9
KNAG0C061905.616ON49644698.2
Kwal_23.29492.191ON161797689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06248g
         (516 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   966   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   605   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   602   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   599   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   592   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   583   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   582   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   580   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   578   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      578   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   575   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   575   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   573   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   572   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   571   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   567   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   565   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   553   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   549   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   524   0.0  
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   427   e-145
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   416   e-141
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      404   e-136
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   361   e-119
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   355   e-117
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   349   e-115
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   349   e-114
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   349   e-114
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   345   e-113
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   330   e-108
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    71   3e-12
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    69   1e-11
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    68   3e-11
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    65   2e-10
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    65   3e-10
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    65   3e-10
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    64   4e-10
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    64   4e-10
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    64   5e-10
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    64   7e-10
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    64   7e-10
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    63   9e-10
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    63   1e-09
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    61   3e-09
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    60   6e-09
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    60   9e-09
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    60   9e-09
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    57   6e-08
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    57   7e-08
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      55   3e-07
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      53   1e-06
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    51   3e-06
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    49   2e-05
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    46   1e-04
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    45   4e-04
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    43   0.001
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    42   0.002
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    42   0.002
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    42   0.003
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    42   0.003
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    41   0.006
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    40   0.009
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    40   0.010
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    40   0.015
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    39   0.023
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    39   0.026
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    39   0.028
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    39   0.035
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    38   0.065
KAFR0J02930 Chr10 complement(556241..558298) [2058 bp, 685 aa] {...    35   0.59 
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    34   0.73 
Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}...    31   2.2  
SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]...    32   3.0  
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    32   3.7  
Kpol_1073.12 s1073 complement(19854..21152) [1299 bp, 432 aa] {O...    32   4.6  
KLTH0G08096g Chr7 (653942..658783) [4842 bp, 1613 aa] {ON} simil...    32   6.9  
KNAG0C06190 Chr3 complement(1200399..1201889) [1491 bp, 496 aa] ...    31   8.2  
Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C ...    31   9.9  

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/516 (90%), Positives = 466/516 (90%)

Query: 1   MAGSTQDTGVKDVPKELVEQAKKLSITDGMDQLXXXXXXXXXXXXXXXXXXALNEITPEY 60
           MAGSTQDTGVKDVPKELVEQAKKLSITDGMDQL                  ALNEITPEY
Sbjct: 1   MAGSTQDTGVKDVPKELVEQAKKLSITDGMDQLKVEGKNKVKDKKSKKKGKALNEITPEY 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIM 120
                                QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIM
Sbjct: 61  IAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIM 120

Query: 121 TYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKME 180
           TYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKME
Sbjct: 121 TYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKME 180

Query: 181 FTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLL 240
           FTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLL
Sbjct: 181 FTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLL 240

Query: 241 SLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQN 300
           SLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQN
Sbjct: 241 SLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQN 300

Query: 301 EKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXX 360
           EKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLR    
Sbjct: 301 EKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRDGDE 360

Query: 361 XXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKV 420
                  NIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKV
Sbjct: 361 GEGEEGGNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKV 420

Query: 421 HPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLE 480
           HPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLE
Sbjct: 421 HPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLE 480

Query: 481 LLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGIIM 516
           LLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGIIM
Sbjct: 481 LLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGIIM 516

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/463 (60%), Positives = 348/463 (75%), Gaps = 5/463 (1%)

Query: 55  EITPEYXXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREV 114
           +I+PE+                     QGIDP  P +L+FIKRP+L +  +   +  +  
Sbjct: 62  DISPEHIAQVRAKREAARKAKRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKGFK-- 119

Query: 115 CPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYK 174
              S+MTYNCLAQALIRR LFP  G+A+KW +RS+VLLNEFK+YN D++CLQEID VQY+
Sbjct: 120 --FSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQ 177

Query: 175 SFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTK 234
           SFWK EF+KLGY CQF+  P+KNHGV + WK++LF+MTD+ML+DYDKE +G IEPRTTT 
Sbjct: 178 SFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTN 237

Query: 235 NVGMLLSLKFKKKVLEKYP-DTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQN 293
           N+ +LLSLKF KKV E++P +   +GI+IGTTHLFWHPFGTYERTRQCYI+L K+KEF +
Sbjct: 238 NIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFID 297

Query: 294 RINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFS 353
           R+N+LQN  D D SHW  FFCGDFNSQPFD+PYLS+TSKP++Y+GR+KTVIECSTSF FS
Sbjct: 298 RVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFS 357

Query: 354 KLRXXXXXXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLY 413
           K R           NIEKFGK QP+ PVP+ +  N+EQK L   M+ LHN +DMRAISLY
Sbjct: 358 KKRDGEEGDDEEGGNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLY 417

Query: 414 SIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQN 473
           S  YSKVHPENSG+DN+RNEPEISNWAH WRGLLDYL+Y+ SWD     +ID L  FE+ 
Sbjct: 418 SAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERE 477

Query: 474 YGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGIIM 516
             +++   LR+PPAKE+  HGQP EGEYPSDHLCM+ ++ + +
Sbjct: 478 NDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/436 (62%), Positives = 343/436 (78%), Gaps = 7/436 (1%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
           QGIDP  P +L+FIKRP+L + +  + +  +      +MTYNCLAQALIRR LFPTSG+A
Sbjct: 65  QGIDPDFPPELQFIKRPILPLHKGENVEGFK----FKLMTYNCLAQALIRRKLFPTSGDA 120

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201
           +KW++RS+VLLNEFKYYN DV+CLQEID +QY+SFWK E  KLGY  QFH   +KNHGV 
Sbjct: 121 LKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVA 180

Query: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGII 261
           I WK + F MTDKMLID+D+E++G I PRTTT N G++LSLKF  KV +++ + K +GII
Sbjct: 181 IVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH-NLKKTGII 239

Query: 262 IGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQP 321
           +GTTHLFWHPFGT+ERTRQCY+VL KVKEF +R+NVLQN  DGD+SHW  FFCGDFNSQP
Sbjct: 240 VGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQP 299

Query: 322 FDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXX--NIEKFGKGQPET 379
           FD+PYLS+T KP+EY+ RAKTVIECSTS+TFSK+R             NIEKFG  QP+ 
Sbjct: 300 FDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGNIEKFGTDQPDH 359

Query: 380 PVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNW 439
           PVP+ +   + +++L E M++LHN +DMRA+SLYS+AY KVHPEN+GLDN+R EPEISNW
Sbjct: 360 PVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNW 419

Query: 440 AHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEG 499
           AH WRGLLDYL+++  WD  DC +ID L +FE+   +++  LLR+PP KEMTEHGQPH G
Sbjct: 420 AHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTG 479

Query: 500 EYPSDHLCMIVKLGII 515
           EYPSDHLCM+ +L ++
Sbjct: 480 EYPSDHLCMLCELELV 495

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/458 (60%), Positives = 338/458 (73%), Gaps = 4/458 (0%)

Query: 55  EITPEYXXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREV 114
           EI+PE+                      G+DP +P DL+FIKRP+L +  +   +  +  
Sbjct: 48  EISPEHIAEKRAQREAARAAKREAMLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFK-- 105

Query: 115 CPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYK 174
               IMTYN LAQALIRR LFP+SGNAVKWFKRS+VLLNEFK+Y+ DV CLQEID +QY+
Sbjct: 106 --FKIMTYNALAQALIRRKLFPSSGNAVKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQ 163

Query: 175 SFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTK 234
           +FWK EF KLGY  QFH   TKNHGV I W+  LF M D ML+DYDKE +G I PRTTTK
Sbjct: 164 AFWKEEFQKLGYASQFHRIGTKNHGVAIVWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTK 223

Query: 235 NVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNR 294
           N G++L+LKF  KVL ++P TK SGI+IGTTHLFWHPFGT+ERTRQCY+VL K+KE  +R
Sbjct: 224 NAGLILALKFTDKVLNQFPGTKKSGILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHR 283

Query: 295 INVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSK 354
           +NVLQN +D D SHW  F CGDFNSQPFD PYLS+TSKPV Y GRAKTVIECSTSFTFSK
Sbjct: 284 VNVLQNNQDRDYSHWYPFICGDFNSQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSK 343

Query: 355 LRXXXXXXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYS 414
           LR           NIEKFGKGQPE PVP+ F   EEQ  L + M++LHN +DMRAISLY+
Sbjct: 344 LRDGEEGEDEEGGNIEKFGKGQPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYA 403

Query: 415 IAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNY 474
           + Y  VHPEN+GLDN   EPEISNWA  WRGLLDY+++V +W+G D + +D++  FE+  
Sbjct: 404 VGYKHVHPENAGLDNDSGEPEISNWAETWRGLLDYIFFVKNWNGTDRSSVDKIDVFEREN 463

Query: 475 GVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKL 512
           G+++  LLR+PP +EMT+HGQPHEGEYPSDHL M+ ++
Sbjct: 464 GIKIRGLLRMPPGEEMTKHGQPHEGEYPSDHLSMMCEI 501

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/459 (60%), Positives = 334/459 (72%), Gaps = 6/459 (1%)

Query: 55  EITPEYXXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAV-PRDSSGQSTRE 113
           +++PE+                     +G+DP  P DL+FI RPML++ P +++      
Sbjct: 38  KVSPEHIAEVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFV-- 95

Query: 114 VCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQY 173
                +MTYNCLAQALIRR LFPTSGNA+KWFKRS+VLLNEF +YN DVLCLQE+D +QY
Sbjct: 96  ---FKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQY 152

Query: 174 KSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTT 233
           +SFWK EF KLGY  QFH + TKNHG+ I WK D+F M DKMLIDYDKE +GA+EPRTTT
Sbjct: 153 QSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTT 212

Query: 234 KNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQN 293
           KNVG+ ++L F KKVL KYP +   GII+GTTHLFWHPFGT+ERTRQCY++L K+KEF +
Sbjct: 213 KNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMH 272

Query: 294 RINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFS 353
           RINVLQ++     + W  FFCGDFNSQPFD PYLS++SKPV Y GRAKTVIECSTS+TFS
Sbjct: 273 RINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFS 332

Query: 354 KLRXXXXXXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLY 413
           K R           NIEKFG GQPE PVPE FS  EEQK L E+M +LHN +DMR IS+Y
Sbjct: 333 KARDGEECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIY 392

Query: 414 SIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQN 473
           S+ Y  VH EN+GLDN  NEPEISNWA  WRGLLDY++++  WD  D    +EL  F+  
Sbjct: 393 SVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDE 452

Query: 474 YGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKL 512
            G+++  LLR+PPAKEM  HGQPHEGEY SDHL M+ +L
Sbjct: 453 NGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCEL 491

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/436 (63%), Positives = 325/436 (74%), Gaps = 7/436 (1%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
           QG+DP LP +L+FI+RP+LA+ +  S           IMTYNCLAQALIRR LFP SG A
Sbjct: 78  QGLDPDLPPELQFIRRPLLALSKAESTAGFE----FKIMTYNCLAQALIRRKLFPDSGEA 133

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201
           VKWF+RS+VLLNEFKYY+ DV+CLQE+D +Q+++FWK EF KLGY  QFH  P+KNHG+ 
Sbjct: 134 VKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEFDKLGYDSQFHAKPSKNHGIS 193

Query: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGII 261
           I WK  LF MTDKMLIDYDKE +G I PRTTT NVG++L+LKF  KVLE++P+T+ SGII
Sbjct: 194 ILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLALKFSPKVLERFPNTRKSGII 253

Query: 262 IGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQP 321
           +GTTHLFWHPFGTYERTRQCYIVL K KEF +R+NVLQN  D    HW  FF GDFNSQP
Sbjct: 254 VGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQNNNDEIKDHWYTFFGGDFNSQP 313

Query: 322 FDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLR-XXXXXXXXXXXNIEKFGKGQPETP 380
           FD PYLS+TSKPV+Y+ RAKTVIECSTS+TFSK R            NIEKFGK QP TP
Sbjct: 314 FDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRDGEEDAEDEEGGNIEKFGKDQPATP 373

Query: 381 VPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWA 440
           VP  F  + EQ+ L  NM+ LHN +DMRAISLYS+ Y  VH EN+GLDN R EPEISNWA
Sbjct: 374 VPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYGTVHIENAGLDNTRGEPEISNWA 433

Query: 441 HAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTE--HGQPHE 498
           HAW GLLDYL+ + SWD  D  ++D L  FE    ++V   L++P   EM +  HGQPH 
Sbjct: 434 HAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELKVKAFLKMPTKAEMGKFGHGQPHV 493

Query: 499 GEYPSDHLCMIVKLGI 514
           GEYPSDHL MI KL +
Sbjct: 494 GEYPSDHLSMICKLEL 509

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/461 (58%), Positives = 333/461 (72%), Gaps = 5/461 (1%)

Query: 55  EITPEYXXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREV 114
           E++PE+                     +G+DP  P +L+FIKRP+L +  D       E 
Sbjct: 34  EMSPEHVAKVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTLHEDEP----IEG 89

Query: 115 CPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYK 174
               ++TYNCLAQALIRR LFP SG+++KWF+RS+VL  EFK+YN DVLCLQEID +QY+
Sbjct: 90  LSFKLLTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQ 149

Query: 175 SFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTK 234
            FWK E  KLGY  QF+  P KNHGV IAWK  LF +TD+MLIDYDKE++G IE RT T 
Sbjct: 150 QFWKDELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTH 209

Query: 235 NVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNR 294
           N G++L+LKF     +  P  + SGI++GT+HLFWHPFGTYERTRQCY+VLKK+KEF  R
Sbjct: 210 NSGLILALKFTDAAKQSCPHIRKSGILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKR 269

Query: 295 INVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSK 354
           +NVLQN  DG+ SHW  FFCGDFNSQPFD PYLS+TSKPVEYTGRAKTV+ECSTS+TFSK
Sbjct: 270 VNVLQNNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSK 329

Query: 355 LRX-XXXXXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLY 413
           LR            NIEKFGK QP+TPVPE+F    EQ++L E M+ LHN IDMRAISLY
Sbjct: 330 LRNGEEDAEDEEGGNIEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLY 389

Query: 414 SIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQN 473
           ++ Y +VHPENSG+DN R EPE+SNWA+ WRGLLDY+  +T WD  D  K+D L TFE+ 
Sbjct: 390 AVGYGEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWDSSDRKKVDSLETFEKE 449

Query: 474 YGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGI 514
             +++  LLR+PPA EM+ HGQPHEGEY SDHL M+  + +
Sbjct: 450 NSLKLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIEL 490

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/463 (58%), Positives = 333/463 (71%), Gaps = 8/463 (1%)

Query: 56  ITPEYXXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVC 115
           +TPE+                     QGIDP  P +L FIKRP L++  +      R   
Sbjct: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFR--- 111

Query: 116 PISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
              +MTYNCLAQALIRR LFP SG+A+KW++RS+VLLNEF++YN DV+CLQEID +Q++S
Sbjct: 112 -FKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQS 170

Query: 176 FWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKN 235
           FWK EF+KLGY  Q+H N TKNHGV I W+ D+F   DKMLID+DKE +G I  RTTT N
Sbjct: 171 FWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNN 230

Query: 236 VGMLLSLKFKKKVLEKY--PDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQN 293
           VG++L+LKF +KVL       +K SGI+IGT+HLFWHPFGTYERTRQCYIVLKK++EF +
Sbjct: 231 VGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMH 290

Query: 294 RINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFS 353
           R+NVLQNE DGD SHW  FFCGDFNSQPFD PYLS+T KPV Y  RAKTVIECSTSF FS
Sbjct: 291 RVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFS 350

Query: 354 KLR-XXXXXXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISL 412
           K+R            NIEKFGK QPE+PVP+ F  NEEQ +L + M  LHN +DMRA+SL
Sbjct: 351 KVRDGEEGADEEEGGNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSL 410

Query: 413 YSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWD-GCDCTKIDELSTFE 471
           YS+AY  VHPEN+GLDN R EPEISNWA+ WRGLLDYL+Y+  WD   +C ++D L  FE
Sbjct: 411 YSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFE 470

Query: 472 QNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGI 514
           ++  ++    LR+PP  EMT+HGQPH GEY SDHL M+  + +
Sbjct: 471 KDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/437 (61%), Positives = 334/437 (76%), Gaps = 9/437 (2%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
           +G+DP  P +L+FI+R ML +  +   +  +    I IM+YNCLAQALIRR LFP SG A
Sbjct: 61  RGVDPDCPPELQFIRRNMLKLHEEEPVEGLK----IKIMSYNCLAQALIRRKLFPDSGEA 116

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201
           +KW++RS+VLLNEFK+Y+ DVLCLQEID +QY+SFWK EF KLGY  QFH  P+KNHGV 
Sbjct: 117 LKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVC 176

Query: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVL---EKYPDTKVS 258
           I WK + F+M+D+MLID+D E +G IEPRTTT N  ++L+LKF +KV    +K  D K S
Sbjct: 177 IIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDK-S 235

Query: 259 GIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFN 318
           GI++GTTHLFWHPFGTYERTRQCY+VL K+KEF +R+NVLQN  DGD SHW  FFCGDFN
Sbjct: 236 GILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFN 295

Query: 319 SQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXX-NIEKFGKGQP 377
           SQPFD+PYLS+T KP++Y  RAKTVIECSTSF FSK R            NIEKFGK QP
Sbjct: 296 SQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRESGEDAEDEEGGNIEKFGKDQP 355

Query: 378 ETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEIS 437
           +TPVPE F  N+EQ +L   M+ LHN +DMRA+SLYS+AY KVHPENSGLDN+R EPEIS
Sbjct: 356 QTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEIS 415

Query: 438 NWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPH 497
           NWAH WRGLLDY++ + +W+  D T+ID L  FE +  +++  LLR+PP  EM+ HGQPH
Sbjct: 416 NWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPH 475

Query: 498 EGEYPSDHLCMIVKLGI 514
            GEYPSDHLC++ ++ +
Sbjct: 476 VGEYPSDHLCLLSEVEL 492

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/438 (62%), Positives = 329/438 (75%), Gaps = 8/438 (1%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
           QG+DP    DL+FI+RP+L +  +      +    ISIMTYNCLAQALIRR LFP SG+A
Sbjct: 123 QGLDPNALPDLQFIQRPILHLHEEEPVTGFK----ISIMTYNCLAQALIRRKLFPDSGDA 178

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201
           +KWFKRS+VL NEFK+YN DV+CLQEID +QY+SFWK EF K+GY  QFH   +KNHGV 
Sbjct: 179 LKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVA 238

Query: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPD-TKVSGI 260
           I W+++LF +TDKMLID+DKE +G I PRTTT N G+ LSLKF +K L K+ + T   GI
Sbjct: 239 IIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGI 298

Query: 261 IIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQ 320
           I+GTTHLFWHPFGTYERTRQCY+VL K+KEF +RINVLQN  DGD SHW  FFCGDFNSQ
Sbjct: 299 IVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQ 358

Query: 321 PFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLR-XXXXXXXXXXXNIEKFGKGQPET 379
           PFD PYLS+TSKP+ Y GRAKTVIECSTS+ FSK R            NIEKFGK QP+T
Sbjct: 359 PFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEEDADEEEGGNIEKFGKDQPQT 418

Query: 380 PVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNW 439
           PVP+ F  NEEQK+L +NM+ LHN +DMRAISLY + Y KVHPEN+GLDN   EPEISNW
Sbjct: 419 PVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNW 478

Query: 440 AHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTE--HGQPH 497
           AH W GLLDY+ ++  W   DC  +D L  FE+   ++V   LR+PP+ EM++  HGQPH
Sbjct: 479 AHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPH 538

Query: 498 EGEYPSDHLCMIVKLGII 515
            GEYPSDHL MI +L +I
Sbjct: 539 TGEYPSDHLSMICELELI 556

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/440 (61%), Positives = 326/440 (74%), Gaps = 5/440 (1%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
           QG    +PA+LRFI+RPML+V  D +  +     P+++MTYNCLAQALIRR LFP SG A
Sbjct: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201
           +KW++RSQVLLN+FK+Y  DVLCLQE+D VQ+ SFW+ EF KLGY  QFH   TKNHGV 
Sbjct: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162

Query: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGII 261
           + W+  LF M DKMLID+DKE +G + PRTTT N G++++LKF ++ L  + DT  SGI+
Sbjct: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGIL 222

Query: 262 IGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQP 321
           +GTTHLFWHPFGT+ERTRQCY+VL K+KEF +R+NVLQNE DG+N HW  FFCGDFNSQP
Sbjct: 223 VGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQP 282

Query: 322 FDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLR---XXXXXXXXXXXNIEKFGKGQPE 378
           +DAPYLS+TSKPV Y+GRA+TVIECSTS+TFSK R              NIE FGK QP 
Sbjct: 283 YDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFGKDQPH 342

Query: 379 TPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISN 438
            PVP +F  N EQ  L   M+TLHN +DMRA+SLYS+ Y  VHPEN+G DN R EPEISN
Sbjct: 343 HPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISN 402

Query: 439 WAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTE--HGQP 496
           WAH W GLLDYL+YV  WD  D T +D L  FEQ+ GV V  LLR+P  +EM +  HGQP
Sbjct: 403 WAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQP 462

Query: 497 HEGEYPSDHLCMIVKLGIIM 516
           H GEYPSDHL M+  L + +
Sbjct: 463 HTGEYPSDHLAMVCDLELAL 482

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/437 (60%), Positives = 333/437 (76%), Gaps = 9/437 (2%)

Query: 83  GIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAV 142
           G+DP  P +L+FI+RP+L +  D   +S       ++MTYNCLAQALIRR LFP SG AV
Sbjct: 95  GLDPDCPPELQFIRRPLLTLHDDEPEKS----FTFTLMTYNCLAQALIRRKLFPDSGEAV 150

Query: 143 KWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLI 202
           KW++RS+VLLNEFKYYN D++CLQEID +Q++SFW+ EF K+GY  QFH   +KNHGV I
Sbjct: 151 KWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAI 210

Query: 203 AWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPD---TKVSG 259
            WK +LF +TD+MLID+DKE +G I PRT T N G++LSLK+   VL KYP+      SG
Sbjct: 211 VWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG 270

Query: 260 IIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNS 319
           IIIGTTHLFWHPFGTYERTRQC+++L KVKEF+ R+NVLQN  DG+  HW AFFCGDFNS
Sbjct: 271 IIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330

Query: 320 QPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXX--NIEKFGKGQP 377
           QPFD PYLSITSKPVEY  RAK VIECSTS+T+SKLR             NIEKFGK QP
Sbjct: 331 QPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFGKDQP 390

Query: 378 ETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEIS 437
           +TPVP+S++   EQ  L   M++LHN ++M+A SLY++ Y KVHPENSGLDNK+ EPEIS
Sbjct: 391 QTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEIS 450

Query: 438 NWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPH 497
           NWAH+WRGLLDY++YV  WD  DC ++++   FE+   +++   LR+PPA EM+++GQPH
Sbjct: 451 NWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQPH 510

Query: 498 EGEYPSDHLCMIVKLGI 514
           +GEYPSDHL M+ K+ +
Sbjct: 511 QGEYPSDHLSMMCKIEL 527

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/463 (59%), Positives = 330/463 (71%), Gaps = 8/463 (1%)

Query: 56  ITPEYXXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVC 115
           +TPE+                     QG+DP  P +L FI+RP L++         R   
Sbjct: 55  VTPEHIAKVRAEREVMRKAKRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFR--- 111

Query: 116 PISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
              +MTYNCLAQALIRR LFP SG+A+KW++RS+VLLNEFKYYN DV+CLQEID +Q++S
Sbjct: 112 -FKLMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQS 170

Query: 176 FWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKN 235
           FWK EF+KLGY  Q++ N TKNHGV I W+ +LF   DKMLIDYDKE++ +I  RTTT N
Sbjct: 171 FWKDEFSKLGYDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNN 230

Query: 236 VGMLLSLKFKKKVLEKY--PDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQN 293
           VG++L+LKF +KVL       +K  GI+IGTTHLFWHPFGTYERTRQCYIVLKK+KEF +
Sbjct: 231 VGLVLALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMH 290

Query: 294 RINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFS 353
           R+NVLQNE DGD SHW  FFCGDFNSQPFD PYLS+TSKPV Y  RAKTVI CSTS+ FS
Sbjct: 291 RVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFS 350

Query: 354 KLRX-XXXXXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISL 412
           K+R            NIEK+GK QPE+PVPE F  NEEQ +L + M  LHN +DMRAISL
Sbjct: 351 KVRDGEEGADDEEGGNIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISL 410

Query: 413 YSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWD-GCDCTKIDELSTFE 471
           YS+ Y  VHPEN+GLDN R EPEISNWA+ WRGLLDYL+YV  WD   +C +++ L  FE
Sbjct: 411 YSVGYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFE 470

Query: 472 QNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGI 514
           +   V+    LR+PP  EMT+HGQPH GEY SDHL M+  L +
Sbjct: 471 KENKVKCRGFLRMPPGNEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/433 (61%), Positives = 331/433 (76%), Gaps = 5/433 (1%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
           +G+DP+ P DL+FI RPML  P DS+   + E     IMTYNCLAQALIRR LFPTSGNA
Sbjct: 65  RGLDPEFPPDLQFISRPML--PLDSN--YSPEGFVFKIMTYNCLAQALIRRKLFPTSGNA 120

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201
           +KWFKRS+VLLNEF +Y  DV CLQEID +QY+SFWK EF KLGY  QFH + TKNHG+ 
Sbjct: 121 LKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIA 180

Query: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGII 261
           I WK DLF M DKML+DYDKE +G+++PRTTTKNVG++L+L F KKVL+KYP T   GI+
Sbjct: 181 IVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGIL 240

Query: 262 IGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQP 321
           +GTTHLFWHPFGT+ERTRQCY++L K+K+F +R+NVLQ+    +   W  FFCGDFN+QP
Sbjct: 241 VGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKK-WYPFFCGDFNAQP 299

Query: 322 FDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEKFGKGQPETPV 381
           FD PYLS++SKPV Y  RAKTVIECSTS+TFSK R           NIEKFG GQPE PV
Sbjct: 300 FDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGDGQPEHPV 359

Query: 382 PESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWAH 441
           P+++    EQK+L + M  LHN +DMRAIS+YS+AY  VHPEN+G DN  NEPEISNWA 
Sbjct: 360 PDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAE 419

Query: 442 AWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEGEY 501
            WRGLLDY++++  W+  D  + +EL TFE+   V++L LLR+PP++EM  HGQPHEGEY
Sbjct: 420 TWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEY 479

Query: 502 PSDHLCMIVKLGI 514
            SDHL ++ ++ +
Sbjct: 480 GSDHLSLMCEIEL 492

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/461 (58%), Positives = 332/461 (72%), Gaps = 8/461 (1%)

Query: 56  ITPEYXXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVC 115
           +TPE+                      G+DP  P +L FI+RP+L++         R   
Sbjct: 54  VTPEHIAKVRAEREAMRKAKRDAMLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFR--- 110

Query: 116 PISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
              +MTYNCLAQALIRR LFP SG+A+KWF+RS+VLLNEFKYYN DV+CLQE+D +Q++S
Sbjct: 111 -FKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169

Query: 176 FWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKN 235
           FWK +F K+GY  Q+H NPTKNHGV I W+  +F   DKMLIDYDKE +G+I  RTTT N
Sbjct: 170 FWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNN 229

Query: 236 VGMLLSLKFKKKVLEKYPDTKVS--GIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQN 293
           VG++L+LKF K+VL K         GI+IGTTHLFWHPFGTYERTRQCY+VL+K+KEF +
Sbjct: 230 VGLVLALKFSKEVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMH 289

Query: 294 RINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFS 353
           R+NVLQN+ DGD SHW  FFCGDFNSQPFD PYLS+TSKPV Y  RAKTVIECSTSF FS
Sbjct: 290 RVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFS 349

Query: 354 KLRX-XXXXXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISL 412
           K+R            NIEKFGK QPE+PVPE+F  N+EQ ++ ++M  LHN +DMRAISL
Sbjct: 350 KVRDGEEGADDEEGGNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISL 409

Query: 413 YSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWD-GCDCTKIDELSTFE 471
           YS+ Y  VHPEN+GLDN R EPEISNWA+ WRGLLDYL+Y+  WD   +  +++ LS FE
Sbjct: 410 YSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFE 469

Query: 472 QNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKL 512
           +   ++    LR+PPA EMT+HGQPH GEYPSDHL M+  L
Sbjct: 470 KKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDL 510

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/463 (58%), Positives = 327/463 (70%), Gaps = 8/463 (1%)

Query: 56  ITPEYXXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVC 115
           +TPE+                     QG+DP  P +L FIKRP L +         R   
Sbjct: 55  VTPEHIAKIRAERDAMRKAKRDAMLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFR--- 111

Query: 116 PISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
              +MTYNCLAQALIRR LFP SG+A+KW++RS+VLLNEFKYY  DV+CLQEID +Q++S
Sbjct: 112 -FKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQS 170

Query: 176 FWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKN 235
           FWK EF KLGY  Q++ N TKNHGV I W+ ++F   DKMLIDYDKET+  I  RTTT N
Sbjct: 171 FWKDEFNKLGYDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNN 230

Query: 236 VGMLLSLKFKKKVLEKYPDTKVS--GIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQN 293
           VG++L+LKF +KVL     +     GI+IGTTHLFWHPFGTYERTRQCY+VLKK+KEF +
Sbjct: 231 VGLVLALKFSEKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMH 290

Query: 294 RINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFS 353
           R+NVLQNE DGD SHW  FFCGDFNSQPFD PYLS+TSKPV Y  RAKTVIECSTSF FS
Sbjct: 291 RVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFS 350

Query: 354 KLRX-XXXXXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISL 412
           K R            NIEK+GK QPE+PVPE++  NEEQ +L + M  LHN +DMRAISL
Sbjct: 351 KARDGDESADDEEGGNIEKYGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISL 410

Query: 413 YSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWD-GCDCTKIDELSTFE 471
           YS+ Y  VHPEN+GLDN R EPEISNWA+ WRGLLDYL+YV  WD   +C +++ L  FE
Sbjct: 411 YSVGYRNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFE 470

Query: 472 QNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGI 514
           +   ++    LR+PP KEMT+HGQPH GEY SDHL M+  L +
Sbjct: 471 KVNEMKCRGFLRMPPGKEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/437 (60%), Positives = 326/437 (74%), Gaps = 6/437 (1%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
           +G+DP  P +L+FIKRPML + +D            ++MTYNCLAQALIRR LFP SG A
Sbjct: 71  KGLDPDYPPELQFIKRPMLHLHQDEPVTGFN----FTLMTYNCLAQALIRRKLFPDSGEA 126

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201
           VKWF+RS+VLL EF++YN DV+CLQEID +QY++FWK+EF KLGY  QFH   +KNHGV 
Sbjct: 127 VKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVA 186

Query: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYP-DTKVSGI 260
           I WK ++F MTD+MLID+DKET+  I PRT T N G++LSLKF  K+L   P +TK +GI
Sbjct: 187 IVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNTKTTGI 246

Query: 261 IIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQ 320
           IIGTTHLFWHPFGTYERTRQCY++L K+KEF +R+NVLQN  DGD SHW  FFCGDFNSQ
Sbjct: 247 IIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306

Query: 321 PFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRX-XXXXXXXXXXNIEKFGKGQPET 379
           PFD+PYLS+TSKP+EYT RAKTVI+CSTS+ FSKLR            NIEKFGK QP+T
Sbjct: 307 PFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNGEEDVDDEEGGNIEKFGKDQPQT 366

Query: 380 PVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNW 439
           PVPE+F  NEEQ  L E M  +HN++ MRA SLYS+ Y  VH EN+G+DN R EP ISNW
Sbjct: 367 PVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNW 426

Query: 440 AHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEG 499
           A+ WRGLLDY+++V +WD  +   +D L  FE    +++   LR+P   EM +HGQPHEG
Sbjct: 427 ANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEG 486

Query: 500 EYPSDHLCMIVKLGIIM 516
           EY SDHL MI  + +++
Sbjct: 487 EYASDHLSMICNIELLL 503

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/431 (60%), Positives = 321/431 (74%), Gaps = 7/431 (1%)

Query: 88  LPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKR 147
           +P +L+FIKRP+L +  +   Q  +     S+MTYNCLAQALIRR LFP SG+A+KW++R
Sbjct: 142 IPPELQFIKRPILYLHEEEPVQGFK----FSMMTYNCLAQALIRRKLFPDSGDALKWYRR 197

Query: 148 SQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKED 207
           S+VLLNEF YY+ D++CLQE+D +QY+SFWK EF KLGY  Q+H    KNHGV I W+  
Sbjct: 198 SKVLLNEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRS 257

Query: 208 LFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKF--KKKVLEKYPDTKVSGIIIGTT 265
           LF MTDKMLI++DKE++G + PRTTT NVG++LSLKF  + K   K  +T  +GIIIGTT
Sbjct: 258 LFTMTDKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQFKNVETTKTGIIIGTT 317

Query: 266 HLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAP 325
           HLFWHPFGTYERTRQCY+VL K+KEF +R+NVLQN  D D SHW  FFCGDFNSQPFD+P
Sbjct: 318 HLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSP 377

Query: 326 YLSITSKPVEYTGRAKTVIECSTSFTFSKLR-XXXXXXXXXXXNIEKFGKGQPETPVPES 384
           YLS+  KPVEY+GRAKTVIECSTS+ FSK R            NIEKFG  QP+TPVPE 
Sbjct: 378 YLSMVRKPVEYSGRAKTVIECSTSYKFSKKRDGEEDVDDEEGGNIEKFGIDQPQTPVPEE 437

Query: 385 FSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWR 444
           F  N EQ  L ++M+ LHN ++MRAISLY + Y  VHPEN+ +DN+  EPEISNWAH W 
Sbjct: 438 FIANGEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWN 497

Query: 445 GLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSD 504
           GLLDYL +V  W   DCTK + L  FE++  +++   LR+PPA EMT+HGQPH GEYPSD
Sbjct: 498 GLLDYLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSD 557

Query: 505 HLCMIVKLGII 515
           HL M+  + ++
Sbjct: 558 HLSMLCSIELL 568

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/426 (58%), Positives = 313/426 (73%), Gaps = 5/426 (1%)

Query: 91  DLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQV 150
           D+ FIKRP+L    D +           +MTYNCLAQALIRR LFPTSGNA+KWFKRS+V
Sbjct: 84  DVGFIKRPLLVCNGDEAKGFV-----FRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKV 138

Query: 151 LLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFD 210
           LL+E +YYN DV+CLQEID  QYKSFW       GY  +FH +  KNHG+ I W+  LF+
Sbjct: 139 LLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFN 198

Query: 211 MTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWH 270
             D+ LID+D+E +G IE RTTTKNVG++++L++  ++  +YP +  SGI++GT+HLFWH
Sbjct: 199 KVDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWH 258

Query: 271 PFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSIT 330
           PFGTYER RQCYI+L ++K F  R+ +L+    G  S W  FFCGDFNSQPFDAPYLS+ 
Sbjct: 259 PFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMC 318

Query: 331 SKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEKFGKGQPETPVPESFSGNEE 390
           SKP+ Y GRA+TVIECSTS+ FS LR           NIEKFG GQPETPVP+SF G  E
Sbjct: 319 SKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPE 378

Query: 391 QKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYL 450
           Q+ L + M++LHN +DMRAISLYS+AY  VHPEN+G+DN R EPEISNWAHAWRGLLDY+
Sbjct: 379 QRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYI 438

Query: 451 YYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIV 510
            YV  WD  D T++D++  F++N  V V  LLR+PPA EM  HGQPHEGEYPSDHL ++ 
Sbjct: 439 MYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMC 498

Query: 511 KLGIIM 516
           +L ++M
Sbjct: 499 ELELLM 504

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/436 (56%), Positives = 311/436 (71%), Gaps = 7/436 (1%)

Query: 82  QGIDPKLPA-DLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGN 140
           Q + P + + +L FI RPML +      Q+  +    S+MTYNCLAQ+LIRR+LFPTSG 
Sbjct: 58  QQMAPNITSLNLEFIARPMLPL---KVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGR 114

Query: 141 AVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGV 200
           A+KW KRS VLL EFK+YN DVLCLQEID  QY SFW    + LGY  +FH    K+HGV
Sbjct: 115 ALKWTKRSMVLLKEFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGV 174

Query: 201 LIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGI 260
            I WK+DLF   D+MLI++D E +G IEPR TT NVGM+L+L F  KV + +P T  SGI
Sbjct: 175 AIFWKKDLFIWMDQMLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFPGTVKSGI 234

Query: 261 IIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQ 320
           I+GT+HLFWHPFGTYERTRQCY++L K+KEF +R+++ QNE   D + W  FFCGDFNSQ
Sbjct: 235 IVGTSHLFWHPFGTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQ 294

Query: 321 PFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEKFGKGQPETP 380
           PFDAPYLSITSKPV Y+GRAKTVIECS ++ F  L             +   G+ +P  P
Sbjct: 295 PFDAPYLSITSKPVLYSGRAKTVIECSAAYKFPDLGAGARGANEDGGTV---GEDRPVDP 351

Query: 381 VPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWA 440
           VPESF    E   L + M+ LHN +DMRAISLY++AY  VHP+N+GLDN+R EPEISNWA
Sbjct: 352 VPESFQPTAEVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWA 411

Query: 441 HAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEGE 500
           + WRGLLDY+ Y+T W   +  ++D L +FE+   + V E+LR+PPAKEM+ HGQPH+GE
Sbjct: 412 YTWRGLLDYIMYITPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGE 471

Query: 501 YPSDHLCMIVKLGIIM 516
           YPSDHL M+ KL + M
Sbjct: 472 YPSDHLAMMCKLEVEM 487

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  427 bits (1098), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 209/453 (46%), Positives = 287/453 (63%), Gaps = 34/453 (7%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
            G +P +P++L+FIKRP+L +  D   + T     + IMTYNCLAQ+LI+R LFP SG A
Sbjct: 60  HGFEPDIPSELQFIKRPLLTLHDDDPVKGTM----LKIMTYNCLAQSLIQRDLFPGSGQA 115

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201
           +KW +RS+VLLNE KYY+ D+L LQEID VQ+K +WK+   KLGY C+F+    K HGVL
Sbjct: 116 LKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVL 175

Query: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGII 261
           IAWK +LF     + ID+D+  +G I+PRT TKNVG++++L+F  K        K  G+I
Sbjct: 176 IAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK---DKSAIKKKGVI 232

Query: 262 IGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQP 321
           IGTTHLFWH FGT+ERTRQCY+++ ++ +F  ++        G    W  FF GDFNSQP
Sbjct: 233 IGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQP 284

Query: 322 FDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLR------------------XXXXXXX 363
            DAPY+SITSKPV +    K VIECS ++ +SK R                         
Sbjct: 285 KDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSDA 344

Query: 364 XXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPE 423
                 E+    QP    P  F+   EQ +L   +  LHN +++RAISLYS+ Y KV PE
Sbjct: 345 ETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPE 404

Query: 424 NSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDG-CDCTKIDELSTFEQNYGVQVLELL 482
           N+ ++N R EPE+S WA  W GLLDY++++  WDG  +  K+D L TFE+   V++  LL
Sbjct: 405 NAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLL 464

Query: 483 RIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGII 515
           ++P +KEM EH  P++GEYPSDHLCM+++L ++
Sbjct: 465 KMPQSKEMCEHAIPYKGEYPSDHLCMMIQLELL 497

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  416 bits (1070), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 290/444 (65%), Gaps = 18/444 (4%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
           QG DP  P +L FIKRP+L +P    G S R+    S+MTYNCLAQA+IRR +F  SG A
Sbjct: 40  QGEDPDHPIELSFIKRPILYLPH--HGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPA 97

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHF-NPTKNHGV 200
           +KWF+RS+VL+NE  YYN D+LCLQEID  QY++FWK +      M  F++    K+HGV
Sbjct: 98  LKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGV 157

Query: 201 LIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEK-YP------ 253
           LIAWK+ +F   D M++D+D   T  I  RT T+N+ M ++LKF  + + K +P      
Sbjct: 158 LIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSF 217

Query: 254 DTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFF 313
           D    G II TTHLFWHPFGT+ERTRQCYI+L+K+K+F + +NV    KD   +HW  F 
Sbjct: 218 DQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTHWYPFI 273

Query: 314 CGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEKFG 373
           CGDFNS P DAPYLS+TSKP+EYTGR K VIECST++ FSK R             EK  
Sbjct: 274 CGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE--EKKL 331

Query: 374 KGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNE 433
             QP+  VP+SF+   EQ +L   +++LHN + +RA SLY +AY  V P N  ++N R E
Sbjct: 332 INQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGE 391

Query: 434 PEISNWAHAWRGLLDYLYYVTSWDGCD-CTKIDE-LSTFEQNYGVQVLELLRIPPAKEMT 491
           PE ++WA +W G+LDY+ YV +WD  +  ++I E L  FE+N  + +  LL++P  K+M 
Sbjct: 392 PEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMP 451

Query: 492 EHGQPHEGEYPSDHLCMIVKLGII 515
            H QP E EYPSDH+ ++ ++ I+
Sbjct: 452 FHTQPFEREYPSDHISILCEMEIL 475

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  404 bits (1037), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 204/465 (43%), Positives = 288/465 (61%), Gaps = 16/465 (3%)

Query: 57  TPEYXXXXXXXXXXXXXXXXXXXXXQGIDPKLPADLRFIKRPMLAVPRDS--SGQSTREV 114
           +PEY                     QG+DP +P +L+F +RP L +  +   +G+S  E 
Sbjct: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHE- 77

Query: 115 CPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYK 174
              SI+TYNCLAQ LI R +FP SGNA+KW +RS+ ++NE KYYN D++CLQEID    K
Sbjct: 78  --FSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVK 135

Query: 175 SFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTK 234
            FW ++F  LGY  +F     K HGV+IAW++ +F   D+  +D+D+   G I PRT T+
Sbjct: 136 EFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTR 195

Query: 235 NVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNR 294
           N+G++++L+F        P  +  GI++ TTHLFWHPFGT+ERTRQCY++L ++ +F + 
Sbjct: 196 NIGLIVALQFLDNN-NNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSF 254

Query: 295 INVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSK 354
           +    NE  G  ++W  F  GDFNSQP DAPY+S+T+KP++Y    +TVIECSTS+T+SK
Sbjct: 255 L----NEHSGI-TNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSK 309

Query: 355 LRX----XXXXXXXXXXNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAI 410
            R                 E+F K QP  P P  F   +EQ  L   ++ LHN +  RAI
Sbjct: 310 KRNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAI 369

Query: 411 SLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCT-KIDELST 469
           SLYS+ Y  VHPENS ++N R EPE S+W   W GLLDY++Y+ +W+  D    ++ L T
Sbjct: 370 SLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLET 429

Query: 470 FEQNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGI 514
           FE+   +++L  L++P  KEM  H QP+EGEYPSDHL ++ KL +
Sbjct: 430 FEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  361 bits (926), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 184/450 (40%), Positives = 271/450 (60%), Gaps = 35/450 (7%)

Query: 82  QGIDPKLPA-DLRFIKRPMLAVPRDSSG--------QSTREVCPISIMTYNCLAQALIRR 132
           QG DP  P  DL+FI+RP+L +  + +         Q+T     I IMTYN LAQ LIRR
Sbjct: 66  QGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRR 125

Query: 133 TLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHF 192
             FP SG+A+KW KRS+VL++E K Y  D++ LQE+D  + K FW+  F KLG+   F  
Sbjct: 126 DFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSFRR 184

Query: 193 NPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTG-AIEPRTTTKNVGMLLSLKFKKKVLEK 251
           N  K HG+L+AW  + F + ++ ++DYD+   G  I  RT TKN+ +++SL+FK      
Sbjct: 185 NGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDTR--- 241

Query: 252 YPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSH-WP 310
             +   +GI++  THLFWHPFG +ER RQ Y+VL+K++E           KD    H W 
Sbjct: 242 --NASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI----------KDFPKYHGWH 289

Query: 311 AFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIE 370
           +   GDFN++P + PYL+ITSKP+  TG  + ++ECS ++ +SK R           + +
Sbjct: 290 SLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDE-DYD 348

Query: 371 KFGKG-----QPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENS 425
           +  +G     QP+ P P+ F+  +E+K L   + TLHN + ++ ISLY + Y KVHPEN+
Sbjct: 349 ENSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA 408

Query: 426 GLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIP 485
             +    EPE+SNWA+ W GLLDY++Y+ S D     +   L+ FE+N GV V+  LR+P
Sbjct: 409 --NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMP 466

Query: 486 PAKEMTEHGQPHEGEYPSDHLCMIVKLGII 515
             +EM +H QP EGEY SDH+ ++ ++ + 
Sbjct: 467 CKQEMPKHSQPFEGEYASDHISLMCQIRLF 496

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  355 bits (911), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 190/446 (42%), Positives = 255/446 (57%), Gaps = 36/446 (8%)

Query: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141
           +G+DP  PA+ +FI+RP+L VP    G +     P+SIMTYNCLAQ LIRR +FP SG A
Sbjct: 48  RGLDPDFPAECQFIERPILLVPH---GDNYERGLPLSIMTYNCLAQTLIRREMFPESGPA 104

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201
           +KWF RS+VLL+E K+YN D+ CLQEID VQY  FW  E  K GY   +    +K+HGV+
Sbjct: 105 LKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVM 164

Query: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKK--KVLEKYPDTKVSG 259
           IAWKE+LF +   M I++DKE    I+PRT T NVG+L++L F    +       T  SG
Sbjct: 165 IAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSG 224

Query: 260 IIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNS 319
           +IIGT HLFWHPFGTY+RTRQC ++ KK+ EF   +        GD   +   F GDFNS
Sbjct: 225 VIIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVK-------GD---YCKMFTGDFNS 274

Query: 320 QPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEKF------- 372
           QP   PYL +T    +   + +T IE ST++ +S+ R             E+        
Sbjct: 275 QPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREY 334

Query: 373 ----GKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLD 428
               G     TP P+ F   EEQ+QL  N+    ND+ + A SLYSI Y  V P +    
Sbjct: 335 EYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIA-- 392

Query: 429 NKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAK 488
              +EPE+S+W+  W GLLDY++YV         +    +TFE    + +   L++P   
Sbjct: 393 -DHHEPELSSWSTKWAGLLDYIFYVNQ-------RPSTPATFETANNIAIAGYLQMPTHA 444

Query: 489 EMTEHGQPHEGEYPSDHLCMIVKLGI 514
           +M  H QP+ GEYPSDH+ M+  L I
Sbjct: 445 QMHNHSQPYTGEYPSDHISMMCALEI 470

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  349 bits (896), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 187/436 (42%), Positives = 265/436 (60%), Gaps = 27/436 (6%)

Query: 94  FIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLN 153
           FIKR +L +P   + +       + IMTYN L+Q+LIRR ++P + +A+KW  RS+V+LN
Sbjct: 53  FIKRAILQLP---NVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILN 109

Query: 154 EFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFH--FNPTKNHGVLIAWKEDLFDM 211
           E KYYN D++C QE+D +Q+  FW  E +KLGY  +F+  F   K HGV I W+ +LF+ 
Sbjct: 110 EIKYYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQ 169

Query: 212 TDKMLIDYDKETTG-AIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKV-SGIIIGTTHLFW 269
            D + I++D    G AI   T T NVG++++LKFK        + K  SGI+IGTTHLFW
Sbjct: 170 FDVIKINFDDIVAGNAISKTTRTWNVGLIVALKFKSS------NAKFRSGIVIGTTHLFW 223

Query: 270 HPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSI 329
           HPFGT+ERTRQ  I+LKK ++  + +N      +  ++ W     GDFNSQP D PYLSI
Sbjct: 224 HPFGTFERTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSI 283

Query: 330 TSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEK-----------FGKGQPE 378
           TSKPV  +G AKTVIECST++ FS+ R           + E+             +  P 
Sbjct: 284 TSKPVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPI 343

Query: 379 TPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISN 438
            P P  F    EQK L   ++ +HN I+++A SL+ IAY KVH  + GL N +NEPE+S+
Sbjct: 344 DPRPSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVH--SIGL-NCKNEPELSH 400

Query: 439 WAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHE 498
            +  W GLLDY++ +  W+  + T    L  FE+   ++V  LL++P  KE+ ++ QPH+
Sbjct: 401 TSIFWTGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQ 460

Query: 499 GEYPSDHLCMIVKLGI 514
           G+YPSDHL MI  L +
Sbjct: 461 GQYPSDHLSMICDLNV 476

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  349 bits (896), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/443 (41%), Positives = 260/443 (58%), Gaps = 26/443 (5%)

Query: 82  QGIDPKLPA-DLRFIKRPMLAVPRD---SSGQSTREVCPISIMTYNCLAQALIRRTLFPT 137
           QG DP  P  DL+FIKRP L +  +    S +ST     + IMTYN LAQ LIRR  FP 
Sbjct: 68  QGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNFFPQ 127

Query: 138 SGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKN 197
           SG+A+KW KRS+VL++E K Y  D++ LQE+D  + K FW+  F KLG+   F  +  K 
Sbjct: 128 SGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTFKRHDGKT 186

Query: 198 HGVLIAWKEDLFDMTDKMLIDYDKETTG-AIEPRTTTKNVGMLLSLKFKKKVLEKYPDTK 256
           HG+LIAW    F + ++ ++DYD    G AI  RT TKN+ ++ SL+ K        D  
Sbjct: 187 HGLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLRLKN-----ISDPS 241

Query: 257 VSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGD 316
             G+I+  THLFWHPFG +ER RQ Y+VL K++E +              + W +   GD
Sbjct: 242 TDGVIVANTHLFWHPFGVFERLRQSYLVLAKIQEIKACPKY---------NGWHSVLMGD 292

Query: 317 FNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEKF-GKG 375
           FN++P + PYL+IT KPV  TG A+ + ECS ++ +SK R             E+  G+G
Sbjct: 293 FNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYSKKRNGEEGGQDDEECDEQSRGEG 352

Query: 376 ---QPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRN 432
              QP+ P P+SF+   EQK L + +  LHN + +R +SLY + Y KV PENS   N   
Sbjct: 353 RFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQPENSHESN--G 410

Query: 433 EPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTE 492
           EPE+SNWA++W GLLDY++Y+   D       + +  FE    ++V+  L++P AKEM +
Sbjct: 411 EPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVMGYLKMPRAKEMPK 470

Query: 493 HGQPHEGEYPSDHLCMIVKLGII 515
           H QP EGEY SDH+ ++ +L  +
Sbjct: 471 HSQPFEGEYASDHVSLMCQLRFL 493

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  349 bits (895), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/446 (40%), Positives = 262/446 (58%), Gaps = 29/446 (6%)

Query: 82  QGIDPKLPA-DLRFIKRPMLAVPRD---SSGQSTREVCP----ISIMTYNCLAQALIRRT 133
           QG DP  P  DL+FI+RP L V R+    S  S  +V P    + IMTYN LAQ LIRR 
Sbjct: 68  QGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLAQTLIRRD 127

Query: 134 LFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFN 193
            FP SG+A+KW KRS+VL++E K Y  D++ LQE+D  +   FW   F KLG+   F  +
Sbjct: 128 FFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNEL-GFWHENFHKLGFGSTFRRH 186

Query: 194 PTKNHGVLIAWKEDLFDMTDKMLIDYDKETTG-AIEPRTTTKNVGMLLSLKFKKKVLEKY 252
             K HG+++AW  + F   ++ ++DYD    G AI  RT TKN+ +++SL  K       
Sbjct: 187 EGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSLSVKNMT---- 242

Query: 253 PDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAF 312
            +   SG+I+  THLFWHPFG +ER RQ ++VLKK++E +                W + 
Sbjct: 243 -NLSTSGVIVANTHLFWHPFGVFERLRQSFLVLKKIEEIKTCPKYYG---------WHSL 292

Query: 313 FCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEKF 372
             GDFN++P + PY++IT +P+  TG A+ + ECS ++ +SK+R           + E  
Sbjct: 293 LMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSLAYRYSKMRNGEESDQDEECDEEST 352

Query: 373 GKGQ---PETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDN 429
           G+GQ   P+ P P+ F   +EQK L   +  LHN + ++ ISLY ++Y KVHP+NS    
Sbjct: 353 GEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKVHPDNS--KE 410

Query: 430 KRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKE 489
              EPE+SNWA+ W GLLDY++Y+   D    +K + +  FE    V+++  LR+P A+E
Sbjct: 411 NHGEPELSNWANTWCGLLDYIFYIERNDNVSSSKDEPVKNFEDQNNVKIIGYLRMPRAEE 470

Query: 490 MTEHGQPHEGEYPSDHLCMIVKLGII 515
           M +H QP EGEY SDH+ ++ +L + 
Sbjct: 471 MPKHSQPFEGEYASDHISLMCQLRLF 496

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  345 bits (886), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 182/448 (40%), Positives = 266/448 (59%), Gaps = 30/448 (6%)

Query: 82  QGIDPKLPA-DLRFIKRPMLAVPRDSSG-------QSTREVCPISIMTYNCLAQALIRRT 133
           QG DP  P  DL+FI+RP L +  D+S        Q T++   + IMTYN LAQ LIRR 
Sbjct: 66  QGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRD 125

Query: 134 LFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFN 193
            FP SG A+KW KRS+VL++E K Y  DV+ LQE+D  +  +FW+  F KLG+   F  +
Sbjct: 126 FFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFKRH 184

Query: 194 PTKNHGVLIAWKEDLFDMTDKMLIDYDKETTG-AIEPRTTTKNVGMLLSLKFKKKVLEKY 252
             K HG+L+AW    F + +  ++DYD    G  I  RT TKN+ +++SL FK       
Sbjct: 185 EGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKG-----I 239

Query: 253 PDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAF 312
            D+   GII+  THLFWHPFG +ER RQ Y+VL+K++E +       ++ +G    W + 
Sbjct: 240 TDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIK-----ACSKYNG----WHSL 290

Query: 313 FCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEKF 372
             GDFN++P + PYL+IT +P+   G  + ++ECS ++ +SK R             EK 
Sbjct: 291 LMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEECDEKS 350

Query: 373 -GKG---QPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLD 428
            G+G   QP+ P PESF+  +E+K L   +  LHN + ++ +SLY I Y KVHPEN+  +
Sbjct: 351 RGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENA--N 408

Query: 429 NKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAK 488
               EP +SNWA+ W GLLDY++Y+      D  + + L+ FE N  V+++  LR+P A+
Sbjct: 409 GSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQ 468

Query: 489 EMTEHGQPHEGEYPSDHLCMIVKLGIIM 516
           EM +H QP EGEY SDH+ ++ ++ +  
Sbjct: 469 EMPKHSQPFEGEYASDHISLMCQIRLFF 496

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  330 bits (847), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 178/439 (40%), Positives = 251/439 (57%), Gaps = 35/439 (7%)

Query: 94  FIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLN 153
           FIKRP+L VP             + IMTYN LAQ LIRRT FP + +A+KW +RSQVL+ 
Sbjct: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102

Query: 154 EFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMT- 212
           E +YY+ DV+CLQE D +Q+  FW  EF +LGY   F   P K HGV I WK  +F+ T 
Sbjct: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162

Query: 213 -DKMLIDYDKETTG-AIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWH 270
            DK+ +  D    G  I   T T+ V + ++L+ K     +        II  TTHLFWH
Sbjct: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR-------PIIFSTTHLFWH 215

Query: 271 PFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWP------AFFCGDFNSQPFDA 324
            FGT+ERTRQ +++L ++ +F  ++          ++H P       FF GDFNSQP DA
Sbjct: 216 LFGTFERTRQLFVILSELNKFIKKVT---------DAHCPRGQRCYTFFTGDFNSQPCDA 266

Query: 325 PYLSITSKPVEYTGRAKTVIECSTSFTFSKLRXXXXXXXXXXXNIEKFGK-------GQP 377
           PYLS+T KPV+  GRAK++IECS S+ +SK R             E   +        +P
Sbjct: 267 PYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRP 326

Query: 378 ETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSG--LDNKRNEPE 435
           + P P ++    EQ +  ++++ LHN I ++ +SLY I Y  VHPENS     +   EP+
Sbjct: 327 QDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQ 386

Query: 436 ISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQ 495
           +S+ A  W GLLDY++ +T W   + TKI +L   E+  G+++   LR+P  +EM +H +
Sbjct: 387 LSHRALHWSGLLDYIFLITEWSE-NATKISDLQALERQTGIKINGYLRMPLKEEMCDHTE 445

Query: 496 PHEGEYPSDHLCMIVKLGI 514
           PHE EYPSDHL M+  + +
Sbjct: 446 PHENEYPSDHLAMMCDISL 464

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 116/290 (40%), Gaps = 46/290 (15%)

Query: 88  LPADLRFIKRPMLAVPR---DSSGQSTREVCP------ISIMTYNCLAQALIRRTLFP-T 137
           LP + RFI+      P+   DS  QST  +         ++++YN L Q      ++  T
Sbjct: 461 LPHERRFIEINTDGEPQREYDSLQQSTEHLTADLAKRSFTVLSYNTLCQHYATPKMYRYT 520

Query: 138 SGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHF----- 192
              A+ W  R   L  +   Y+ DVLCLQE+++  ++ +W     K GY   FH      
Sbjct: 521 PSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFEDYWVPLLEKHGYTGVFHAKARAK 580

Query: 193 -----NPTKNHGVLIAWKEDLFDMTDKMLIDYD---------KETTGAIEPRTTTKNVGM 238
                +  K  G  I +K D F M ++  +D+          + T   +       NV +
Sbjct: 581 TMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMKHKKFQRTEDYLNRAMNKDNVAL 640

Query: 239 LLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVL 298
            L L+          DT    I + TTHL W P     +T Q  ++L  ++         
Sbjct: 641 FLKLQHVSS-----GDT----IWVVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEDTTH 691

Query: 299 QNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECST 348
            + +D   S  P   CGDFNS    A Y  I+      TGR +   E S+
Sbjct: 692 NSRQDIKKS--PVLICGDFNSYINSAVYELIS------TGRVQAHQEGSS 733

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 94/239 (39%), Gaps = 31/239 (12%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            +IM+YN L Q      ++  T   A+ W  R Q L  E   Y  D++CLQE++   Y+ 
Sbjct: 524 FTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEE 583

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
            W     K GY   FH           +  K  G  + +KE  F +  K  +D+      
Sbjct: 584 HWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMK 643

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE 276
               + T   +       NV + + L   K             + I TTHL W P     
Sbjct: 644 HKKFQRTEDYLNRAMNKDNVVIYIKLNHLK---------SGESVWIATTHLHWDPQFNDV 694

Query: 277 RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVE 335
           +T Q  I++  ++E         + +D   S  P   CGDFNSQ   A Y  +++  V+
Sbjct: 695 KTFQVGILMDHLEELIKEHGSPSSRQDPKKS--PVIICGDFNSQKDSAVYELLSTGHVQ 751

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 101/250 (40%), Gaps = 43/250 (17%)

Query: 104 RDSSGQSTREVC--PISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNV 160
           ++S    +RE      +I++YN L Q      ++  T   A+ W  R + L  +   YN 
Sbjct: 393 QESDAHQSRETLKKSFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNT 452

Query: 161 DVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFD 210
           D++CLQE++   Y+ FW     + GY   FH           +  K  G    +K+  F 
Sbjct: 453 DIVCLQEVECKTYEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFK 512

Query: 211 MTDKMLIDYD---------KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSG-- 259
           +  K  +D+          + T   +       NV +++ L+  K           SG  
Sbjct: 513 LMFKEAVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALVVKLQHIK-----------SGEH 561

Query: 260 IIIGTTHLFWHPFGTYERTRQCYIVL---KKVKEFQNRINVLQNEKDGDNSHWPAFFCGD 316
           +   TTHL W P     +T Q  ++L   +KV + QN  N  Q  K       P   CGD
Sbjct: 562 VWAATTHLHWDPQFNDVKTFQVGVLLDYMEKVIKEQNNCNNTQELKK-----VPVVICGD 616

Query: 317 FNSQPFDAPY 326
           FNSQ   A Y
Sbjct: 617 FNSQTNSAVY 626

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 107/262 (40%), Gaps = 45/262 (17%)

Query: 101 AVPRDSSGQSTREVC--PISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKY 157
           A  ++S     RE      ++++YN L Q      ++  T   A+ W  R + L  +  Y
Sbjct: 392 ASLQESDSHLNRETAKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILY 451

Query: 158 YNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKED 207
           Y+ D++CLQE++   Y+ FW     + GY   FH           +  K  G  + +++ 
Sbjct: 452 YSTDIICLQEVECKTYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDS 511

Query: 208 LFDMTDKMLIDYD---------KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVS 258
            F +  K  +D+          + T   +       NV +L+ L+  K           S
Sbjct: 512 EFKLIFKDTVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALLVKLQHLK-----------S 560

Query: 259 G--IIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSH----WPAF 312
           G  +   TTHL W P     +T Q  ++L  +++      V++     +NS      P  
Sbjct: 561 GEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEK------VIKEHSGYNNSQELKKVPVI 614

Query: 313 FCGDFNSQPFDAPYLSITSKPV 334
            CGDFNSQ   A Y  +++  V
Sbjct: 615 ICGDFNSQVDSAVYELLSTGSV 636

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 94/230 (40%), Gaps = 35/230 (15%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L Q      ++      A+ W  R + L  E   Y  DV+CLQE+++  Y+ 
Sbjct: 445 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEE 504

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           FW     K GY   FH           +  K  G  I +K   F    K  ID+      
Sbjct: 505 FWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMK 564

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSG--IIIGTTHLFWHPFGT 274
               + T   +       N+ +++ LK            ++SG  + + TTHL W P   
Sbjct: 565 HKKFQRTEDYLNRAMNKDNIALIVKLKH-----------ELSGEHVWVVTTHLHWDPHFN 613

Query: 275 YERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDA 324
             +T Q  ++L  +++   + + + N ++      P   CGDFNSQ   A
Sbjct: 614 DVKTFQVGVLLDYIEKLLKQQSNIGNPQEKKKV--PLIICGDFNSQSHSA 661

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 101/257 (39%), Gaps = 37/257 (14%)

Query: 105 DSSGQSTREVCP------ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKY 157
           DS  QST  +         S+++YN L Q      ++  T   A+ W  R   L  +   
Sbjct: 519 DSLQQSTEHLSADLAKKTFSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSKLKEQILS 578

Query: 158 YNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKED 207
           Y+ DVLCLQE+++  ++ +W     K GY   F+           +  K  G  I +K D
Sbjct: 579 YDSDVLCLQEVESKTFEDYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRD 638

Query: 208 LFDMTDKMLIDYD---------KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVS 258
            F +  K  +D+          + T   +       NV + L L+           +   
Sbjct: 639 QFKLVTKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHV---------SSGD 689

Query: 259 GIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFN 318
            I + TTHL W P     +T Q  ++L  ++          + +D   S  P   CGDFN
Sbjct: 690 TIWVVTTHLHWDPKFNDVKTFQVGVLLDHLESLLKEDTTHNSRQDIKKS--PVLICGDFN 747

Query: 319 SQPFDAPYLSITSKPVE 335
           S    A Y  I++  V+
Sbjct: 748 SYINSAVYELISTGRVQ 764

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 109/277 (39%), Gaps = 40/277 (14%)

Query: 88  LPADLRFIKRPMLAVPR---DSSGQSTREVC------PISIMTYNCLAQALIRRTLFP-T 137
           LP + RFI+      P+   DS  QST  +         ++++YN L Q      ++  T
Sbjct: 469 LPHERRFIEINTDGEPQREYDSLQQSTEHLSVDLAKRTFTVLSYNTLCQHYATPKMYRYT 528

Query: 138 SGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHF----- 192
              A+ W  R   L  +   Y+ D+LCLQE+++  ++ +W     K GY   FH      
Sbjct: 529 PSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEDYWVPLLDKHGYTGIFHAKARAK 588

Query: 193 -----NPTKNHGVLIAWKEDLFDMTDKMLIDYD---------KETTGAIEPRTTTKNVGM 238
                +  K  G  I +K+D F +  K  +D+          + T   +       NV +
Sbjct: 589 TMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVAL 648

Query: 239 LLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVL 298
            L        L+  P      I   TTHL W P     +T Q  ++L  ++         
Sbjct: 649 FLK-------LQHIPSGDT--IWAVTTHLHWDPKFNDVKTFQVGVLLDHLETLLREETTH 699

Query: 299 QNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVE 335
              +D   S  P   CGDFNS    A Y  I++  V+
Sbjct: 700 NFRQDIKKS--PVLICGDFNSYINSAVYELISTGRVQ 734

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 94/224 (41%), Gaps = 31/224 (13%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L        ++  T   A+ W  R + L  +   ++ DV+CLQE++T+ Y+ 
Sbjct: 454 FTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEE 513

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYDK---- 221
           +W     K  Y C FH           +  K  G  I +K+D F +  +  ID+      
Sbjct: 514 YWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRS 573

Query: 222 -----ETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE 276
                 T   +       NV ++  L        K+ +T    + + TTHL W P     
Sbjct: 574 HKKFHRTEDYLNRAMNKDNVALIAEL--------KHLNTN-ENVWVVTTHLHWDPQFNDV 624

Query: 277 RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQ 320
           +T Q  ++L  ++    + + + N  + D    P   CGDFNSQ
Sbjct: 625 KTFQVGVMLDYLETLIKQHHHVNN--NNDIKKIPMVICGDFNSQ 666

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 91/224 (40%), Gaps = 31/224 (13%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L Q      ++      A+ W  R + L +E   Y  D++CLQE+++  Y+ 
Sbjct: 398 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEE 457

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           FW     K GY   FH           +  K  G  I +K   F    K  ID+      
Sbjct: 458 FWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMK 517

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE 276
               + T   +       NV +++ L+ ++             + + TTHL W P     
Sbjct: 518 HKKFQRTEDYLNRAMNKDNVALIIKLRHER---------TGEHVWVVTTHLHWDPHFNDV 568

Query: 277 RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQ 320
           +T Q  ++L  +++   +   + + +  D    P   CGDFNSQ
Sbjct: 569 KTFQVAVMLDYIEKLLKQHGGVGSPQ--DKKKIPLVICGDFNSQ 610

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 97/239 (40%), Gaps = 31/239 (12%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L Q      ++  T   A+ W  R + L  +   Y  DV+CLQE++   ++ 
Sbjct: 464 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEE 523

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           +W     K GY   FH           +  K  G  + ++E+ F +  K  +D+      
Sbjct: 524 YWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQK 583

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE 276
               + T   +       NV + L L+  K             + I TTHL W P     
Sbjct: 584 HKKFQRTEDYLNRAMNKDNVAIYLKLQHIK---------SGESVWIVTTHLHWDPQFNDV 634

Query: 277 RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVE 335
           +T Q  +++  ++      +  Q++++      P   CGD NS+   A Y  +++  V+
Sbjct: 635 KTFQVGVLMDHIENLLKEQSNAQSKQEAKKC--PVILCGDLNSEIHSAVYELLSTGRVQ 691

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 110/270 (40%), Gaps = 47/270 (17%)

Query: 88  LPADLRFIKRPMLAVPRDSSGQSTREVCPI----------------SIMTYNCLAQALIR 131
           LPAD +FI+        ++ G+ TRE   +                +I++YN L Q    
Sbjct: 428 LPADRKFIEI-------NTDGEPTREFDSLESANTAVEAGLLKKSFTILSYNTLCQHYAT 480

Query: 132 RTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQF 190
             ++  T   A++W  R + L  +   Y  D+LCLQE+++  Y+ FW     K GY   F
Sbjct: 481 PKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYEDFWAPLLEKNGYTGYF 540

Query: 191 HF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLL 240
           H           +  K  G  + +K+  F +  K  +D+    +GA +     +     L
Sbjct: 541 HCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDF----SGAWQKHKRFQRTEDYL 596

Query: 241 SLKFKKKVLEKYPDTK--VSG--IIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRIN 296
           +    K  +  Y   +   SG  + + TTHL W P     +T Q  ++L  ++      N
Sbjct: 597 NRAMNKDNVAIYMKLQHVQSGEYLWVVTTHLHWDPKFNDVKTFQVGVLLDHMESIIKEEN 656

Query: 297 VLQNEKDGDNSHWPAFFCGDFNSQPFDAPY 326
             Q+ K      +P    GDFNS    A Y
Sbjct: 657 PKQDVKK-----FPIIITGDFNSYLTSAVY 681

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 110/280 (39%), Gaps = 46/280 (16%)

Query: 88  LPADLRFIKRPMLAVPR---DSSGQSTREVCP------ISIMTYNCLAQALIRRTLFP-T 137
           LP + RFI+      P+   DS  QST  +         ++++YN L Q      ++  T
Sbjct: 467 LPHERRFIEINTDGEPQREYDSLQQSTEHLATDLAKRTFTVLSYNTLCQHYATPKMYRYT 526

Query: 138 SGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHF----- 192
              A+ W  R   L  +   Y+ D+LCLQE+++  ++ +W     K GY   FH      
Sbjct: 527 PSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEEYWVPLLDKHGYTGIFHAKARAK 586

Query: 193 -----NPTKNHGVLIAWKEDLFDMTDKMLIDYD---------KETTGAIEPRTTTKNVGM 238
                +  K  G  I +K D F +  K  +D+          + T   +       NV +
Sbjct: 587 TMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVAL 646

Query: 239 LLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEF---QNRI 295
            L        L+  P      I   TTHL W P     +T Q  ++L  ++     +   
Sbjct: 647 FLK-------LQHIPSGDT--IWAVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEETSH 697

Query: 296 NVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVE 335
           N  Q+ K      +P   CGDFNS    A Y  I +  V+
Sbjct: 698 NFRQDIKK-----FPVLICGDFNSYINSAVYELINTGRVQ 732

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 95/241 (39%), Gaps = 38/241 (15%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L Q      ++  T   A+ W  R   L ++   Y+ D++CLQE++   ++ 
Sbjct: 435 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFED 494

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           FW     K GY   FH           +  K  G  + +K   F +  K  +D+      
Sbjct: 495 FWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMK 554

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSG--IIIGTTHLFWHPFGT 274
               + T   +       N+ +   L+              SG  I + TTHL W P   
Sbjct: 555 HEKFQRTEDFLNRAMNKDNIALYFKLQH-----------IASGEHIWVATTHLHWDPKFN 603

Query: 275 YERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPV 334
             +T Q  ++L  ++    + N  Q+ K       P   CGDFNS    A Y  ++S  V
Sbjct: 604 DVKTFQVGVLLDHLQTLIRQDNPRQDVKKA-----PVIICGDFNSYIDSAVYELLSSGSV 658

Query: 335 E 335
           +
Sbjct: 659 K 659

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 99/239 (41%), Gaps = 31/239 (12%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L Q      ++  T   A+ W  R   L ++   +  D+LCLQE+++  Y  
Sbjct: 564 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDD 623

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           FW+    K GY   FH           +  K  G  I +KE  F +  K  +D+      
Sbjct: 624 FWEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMK 683

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE 276
               + T   +       NV + + L+  K         +V+ I+  TTHL W P     
Sbjct: 684 HKNFQRTEDYLNRAMNKDNVAIYMKLQHIKS-------GEVTWIV--TTHLHWDPQFNDV 734

Query: 277 RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVE 335
           +T Q  ++L  ++      + + +++D      P   CGD NS    A Y  +++  VE
Sbjct: 735 KTFQVGVLLDHLESLLKEHSNIHSKQDVKKC--PIIICGDLNSYLDSAVYELLSTGHVE 791

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 99/247 (40%), Gaps = 44/247 (17%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L Q      ++  T   A+ W  R + L  +   +N D++CLQE++   ++ 
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           FW+    K GY   FH           +  K  G    +K   F M  K  +D+      
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGII--IGTTHLFWHPFGT 274
               + T   +       NV +++ L+  +           SG I  + TTHL W P   
Sbjct: 658 HKKFQRTEDYLNRAMNKDNVAIVMKLQHIQ-----------SGEIMWLVTTHLHWDPKFN 706

Query: 275 YERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPV 334
             +T Q  ++L  ++      N  Q+ K      +P   CGD NS      YLS +   +
Sbjct: 707 DVKTFQVGVLLDHMETLLKEQNPKQDVKK-----YPLVICGDLNS------YLSSSVYEL 755

Query: 335 EYTGRAK 341
             TGR +
Sbjct: 756 FSTGRVQ 762

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 94/239 (39%), Gaps = 31/239 (12%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L Q      ++  T   A+ W  R   L  +   +  DV+CLQE++   ++ 
Sbjct: 399 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFED 458

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           FW     K GY   FH           +  K  G  + +K   F +  K  +D+      
Sbjct: 459 FWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMK 518

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE 276
               + T   +       NV + + L+  K   +         I + TTHL W P     
Sbjct: 519 HKKFQRTEDYLNRAMNKDNVALFVKLQHLKTNEQ---------IWVTTTHLHWDPQFNDV 569

Query: 277 RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVE 335
           +T Q  ++L  +++     N + N ++      P   CGDFNSQ   A Y   +S  V 
Sbjct: 570 KTFQVGVLLDYMEKLLRDQNGVGNNQEMKKV--PLVICGDFNSQLDSAVYELFSSGTVR 626

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 98/239 (41%), Gaps = 31/239 (12%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L Q      ++  T   A+ W  R + L ++   +  DV+CLQE+++  Y+ 
Sbjct: 452 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEE 511

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           FW     K GY   F+           +  K  G  I +KE  F++  K  +D+      
Sbjct: 512 FWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMK 571

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE 276
               + T   +       NV + + L+  K             + + TTHL W P     
Sbjct: 572 HKKFQRTEDYLNRAMNKDNVALYMKLEHIK---------SGESVWVVTTHLHWDPQFNDV 622

Query: 277 RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVE 335
           +T Q  I+L  ++E     N   ++++      P   CGD NS    A Y  +++  V+
Sbjct: 623 KTFQVGILLDHLEELLKDNNNASSKQEIRKC--PVIICGDLNSHLDSAVYELLSTGHVQ 679

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 93/239 (38%), Gaps = 31/239 (12%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            ++++YN L Q      ++  T    + W  R + L N+      DV+CLQE++   Y+ 
Sbjct: 540 FTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYED 599

Query: 176 FWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           FW     K GY+  FH           +  K  G  I +KE  F +  +  +D+      
Sbjct: 600 FWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMK 659

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE 276
               + T   +       NV + + L+                + + TTHL W P     
Sbjct: 660 HKKFQRTEDYLNRAMNKDNVALFVKLEHI---------NSGESVWVVTTHLHWDPQFNDV 710

Query: 277 RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVE 335
           +T Q  ++L  ++      N   ++++      P   CGD NS    A Y  +++  V+
Sbjct: 711 KTFQVGVLLDHLESLLKDYNNASSKQEIRKC--PVIICGDLNSHLQSAVYELLSTGHVK 767

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 110/268 (41%), Gaps = 48/268 (17%)

Query: 88  LPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFK 146
           LPA  R I R +L V   S+    R     +++TYN L+   +   ++       K W  
Sbjct: 15  LPA--RMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEY 72

Query: 147 RSQVLLNE-FKYYNVDVLCLQEIDTVQYKSFWKMEFT-KLGYMCQFHFNPTKNH------ 198
           R ++L  E F  Y+ D+LCLQE+    Y+ FW+ +   ++ +  Q+   P   +      
Sbjct: 73  RHKLLEYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQE 132

Query: 199 ---GVLIAWKEDLFD--MTDKMLIDYDKETTGAIEPR----------TTTKNVGMLLSLK 243
              GV   +  D F+   TD   ++Y  +T G + P             T   G ++  +
Sbjct: 133 EMDGVGTFYNADKFEHVATD---LEYLSDTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQ 189

Query: 244 FKKKVLEKYPDTKV----------SGIIIGTTHLFWHPFGTYERTR--QCYIVLKKVKEF 291
             K VL +     +          S  ++  T L+W     Y+  +  QC+I+++++K  
Sbjct: 190 SLKTVLTQRNQVCLFVTLLHKPTGSLFVVVNTQLYW----KYDEVKLAQCFIIMRRLKAI 245

Query: 292 QNRINVLQNEKDGDNSHWPAFFCGDFNS 319
             R   L   KD   S+      GD NS
Sbjct: 246 VKR---LLTRKDTSYSNIKVLLSGDLNS 270

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 85/223 (38%), Gaps = 34/223 (15%)

Query: 117 ISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175
            +I++YN L Q      ++  T   A+ W  R + L  +   Y  D+LCLQE+++  ++ 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 176 FWKMEFTKLGYMCQFHFN----------PTKNHGVLIAWKEDLFDMTDKMLIDYD----- 220
           FW     K  Y   FH              K  G  I +K+  F +  K  +D+      
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMK 688

Query: 221 ----KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE 276
               + T   +       NV + + L+           T    + + TTHL W P     
Sbjct: 689 HKKFQRTEDYLNRAMNKDNVALYMKLQ---------SITSGETVWVVTTHLHWDPKFNDV 739

Query: 277 RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNS 319
           +T Q  I+L  ++      N  Q+ K  +        CGD NS
Sbjct: 740 KTFQVGILLDHMETLLKEENPKQDVKKAN-----VVICGDLNS 777

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 100/256 (39%), Gaps = 40/256 (15%)

Query: 105 DSSGQSTREVCPISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKYYNVDVL 163
           D++G    E    ++++YN L Q      ++  T   A+ W  R + L ++   Y  D+L
Sbjct: 514 DANGNPDLEKKSFTLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDIL 573

Query: 164 CLQEIDTVQYKSFWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKEDLFDMTD 213
           CLQE+++  ++ FW     K  Y   FH           +  K  G  I +K+  F +  
Sbjct: 574 CLQEVESKTFEEFWSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLF 633

Query: 214 KMLIDYD---------KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGT 264
           K  +D+          + T   +       NV + L L+           T    + + T
Sbjct: 634 KEAMDFSGTWMKHKKFQRTEDYLNRAMNKDNVALYLKLQSL---------TSGESVWVVT 684

Query: 265 THLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDA 324
           THL W P     +T Q  I+L  ++      N  Q+ K  +        CGD NS  FD+
Sbjct: 685 THLHWDPKFNDVKTFQVGILLDHMEALLKEENPKQDVKKAN-----VVICGDLNSY-FDS 738

Query: 325 PYLSITSKPVEYTGRA 340
               + S     TGR 
Sbjct: 739 AVYELLS-----TGRV 749

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 101/238 (42%), Gaps = 43/238 (18%)

Query: 117 ISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNEFKY-YNVDVLCLQEIDTVQYK 174
           +S++TYN L+   +   ++    +  K W  R ++L  E  Y +  D+LCLQE+ T  Y 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 175 SFWKMEFT-KLGYMCQFHFNPTKNH---------GV--------------LIAWKEDLFD 210
            FW+ +   +L Y   F   P   +         GV               + +  D   
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLS 149

Query: 211 MTDKMLIDYDK-----ETTGAIEPRTTTKNVGMLLSL-KFKKKVLEKYPDTKVSGIIIGT 264
           M  K  +D+       +T GA +P TT   + +LL   +    V  +  DTK S I++  
Sbjct: 150 MFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREKDTK-SLIVVVN 208

Query: 265 THLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQNEKDGDN-SHWPAFFCGDFNS 319
           THL+W     Y+  +  QC  +++K+K+    IN L    +G   S       GD NS
Sbjct: 209 THLYW----KYDEVKLSQCLTIMRKLKQV---INKLTTTLEGVTYSQIKIILGGDLNS 259

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 104/259 (40%), Gaps = 39/259 (15%)

Query: 95  IKRPMLAVPRDSSGQS--TREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVL 151
           ++ P L++P     Q+    +    + ++YN L+   +   ++       K W  R  +L
Sbjct: 20  VRGPSLSIPIQQPHQTLPAAKNPTFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLL 79

Query: 152 LNE-FKYYNVDVLCLQEIDTVQYKSFWKMEFTK-LGYMCQFHFNPTKNH---------GV 200
             E    Y  D++C+QE+ T+ Y SFW+    K   Y  +F      N+         GV
Sbjct: 80  EKEILDKYRSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGV 139

Query: 201 LIAWKEDLFDMTDKMLID-------YDKETTGAIEPR----------TTTKNVGMLLSLK 243
            I +  D+FD      I+       +D++    +  +           T K     L+L 
Sbjct: 140 GIFYNLDMFDYIGSRSINLNDLASTFDRKELDYMAAKEITILNGNGDVTGKESLYELALS 199

Query: 244 FKKKVLEKYPDTKVSG--IIIGTTHLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQ 299
             +  L    + K+S    +I  THL+W     YE  +  QC I+++K+ +  N +    
Sbjct: 200 KNQVCLFVMVEHKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVNELLFNA 255

Query: 300 NEKDGDNSHWPAFFCGDFN 318
             +D + +     F GD N
Sbjct: 256 ESRDMNYNKVKILFSGDLN 274

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 121/260 (46%), Gaps = 50/260 (19%)

Query: 96  KRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNE 154
           +R ++ V  +++  ++  +   +++TYN L+Q+ +   ++       K W  R ++L  E
Sbjct: 3   QRKLINV--NNTISNSTNLSSFTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYE 60

Query: 155 -FKYYNVDVLCLQEIDTVQYKSFWKMEFTKLG----YMCQFHFNPTKN--------HGVL 201
             K YN D++CLQE+ +  Y+ +W+ + +K      ++C+    P K          GV 
Sbjct: 61  ILKLYNADIICLQELTSRDYEYYWRKKLSKFNKGSDFICK---TPPKYWTKAADDLDGVG 117

Query: 202 IAWKEDLFDMTDK--------MLIDYDKETTGAIEPR--TTTKNVGMLLSLKFKKKVLEK 251
           I +  D+F++ D         ++ D+++     +  R    T   G  + +     VLE+
Sbjct: 118 IFYNLDMFELIDSNGIRLSDFLISDFEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEE 177

Query: 252 YPDT--------KVSG--IIIGTTHLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQ 299
                       K +G  +++ TTHL+W     Y+  +  QC I+++++    ++I   Q
Sbjct: 178 KNQVCLFMTLKHKRTGATVVVVTTHLYW----KYDEIKLTQCMIIMRQL----SKIMKDQ 229

Query: 300 NEKDGDNSHWPAFFCGDFNS 319
            +KDG +S     F GD NS
Sbjct: 230 LKKDG-SSFVKVLFAGDLNS 248

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 101/262 (38%), Gaps = 45/262 (17%)

Query: 97  RPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNE- 154
           +P L   R+S  +ST      ++MTYN L+   +   ++       K W  R ++L  E 
Sbjct: 15  KPSLPEIRNSVSRST-----FTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREI 69

Query: 155 FKYYNVDVLCLQEIDTVQYKSFWKMEF-TKLGYMCQ-----------------------F 190
              Y  D++C+QE+    Y+ FWK  F TK+ Y                          +
Sbjct: 70  LNLYRADIMCVQELTCKDYEGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFY 129

Query: 191 HFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKE-----TTGAIEPRTTTKNVGMLLSLKFK 245
           + N  ++      +  DL  + +   ++Y K      T GA EP      + +L      
Sbjct: 130 NLNKFEHISTSSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQV 189

Query: 246 KKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQNEKD 303
              +        +  ++  THL+W     Y+  +  QC  +++K+       ++L   + 
Sbjct: 190 SLFVSLLHKETRTLFVVVNTHLYW----KYDEVKLCQCLTIMRKLHRVIK--SLLMGMEG 243

Query: 304 GDNSHWPAFFCGDFNSQPFDAP 325
              S     F GD NS P D+P
Sbjct: 244 VTYSKVKILFAGDLNSAP-DSP 264

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 101/267 (37%), Gaps = 61/267 (22%)

Query: 101 AVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNE-FKYY 158
           ++P   +G S       + MTYN L+   +   ++       K W  R ++L  E    Y
Sbjct: 21  SLPEIKNGTSR---STFTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLY 77

Query: 159 NVDVLCLQEIDTVQYKSFWKMEF-TKLGYMCQF---------HFNPTKNHGVLIAWKEDL 208
             D++C+QE+    Y  FWK  F +K+ Y   F            P +  GV I +  D 
Sbjct: 78  RADIMCVQELTCKDYDGFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDK 137

Query: 209 FDMTDKMLI--------------DYDKE-----TTGAIEPRTT---------TKNVGMLL 240
           F+      I              +Y K      T GA EP               V + +
Sbjct: 138 FEHISTTSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFV 197

Query: 241 SLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVL 298
           SL  K        +T+   ++I  THL+W     Y+  +  QC  +++K+       ++L
Sbjct: 198 SLMHK--------ETRTLFVVIN-THLYW----KYDEVKLCQCLTIMRKLHRVIK--SLL 242

Query: 299 QNEKDGDNSHWPAFFCGDFNSQPFDAP 325
              +    S     F GD NS P D+P
Sbjct: 243 MGREGVTYSKVKILFAGDLNSAP-DSP 268

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 103/267 (38%), Gaps = 59/267 (22%)

Query: 95  IKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLN 153
           IK    ++P+  S +   +    + MTYN L+   +   ++    +  K W  R ++L  
Sbjct: 9   IKSITNSLPKSGSKRLIDD--KFTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEK 66

Query: 154 E-FKYYNVDVLCLQEIDTVQYKSFWKMEFTK-LGYMCQFHFNPTKNH---------GVLI 202
           E    Y  D++CLQE+    Y  +W+    +   Y  +F   P   +         GV I
Sbjct: 67  EILNSYRADIMCLQELTASDYHQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGI 126

Query: 203 AWKEDLFDMTDKMLI---------DYD----------KETTGAIEPR---------TTTK 234
            +  + FD      I         D D          K T GA  P+          +  
Sbjct: 127 FYNLNKFDYISSTSIHLNDLIGSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRN 186

Query: 235 NVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTR--QCYIVLKKVKEFQ 292
            VG+ ++LK K        DT    ++I  THL+W     Y+  +  QC I+++K+ +  
Sbjct: 187 QVGLFVALKHK--------DTNTIFVVI-NTHLYW----KYDEVKLTQCLIIMRKLAKII 233

Query: 293 NRINVLQNEKDGDNSHWPAFFCGDFNS 319
              ++L  E     +     F GD NS
Sbjct: 234 R--DLLVGEHGTTYNKMKVVFAGDLNS 258

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 97/239 (40%), Gaps = 45/239 (18%)

Query: 117 ISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNEF-KYYNVDVLCLQEIDTVQYK 174
            +++TYN L+ A +   ++       K W  R  +L  E    Y  D++C+QE+    Y+
Sbjct: 39  FTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDYQ 98

Query: 175 SFWK----------MEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMT-------DKMLI 217
            FW            EF        +   P +  GV I +   +FD         ++ML 
Sbjct: 99  QFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQMLD 158

Query: 218 DYDKE------------TTGAIEPRTTTKNVGMLLSLKFKKKV-LEKYPDTKVSGI--II 262
            ++              T GA  P   T    +L  LK K +V L      K +G+  ++
Sbjct: 159 AFNDHELEYLGQKKLGLTDGAGNP---TGETNLLNFLKLKNQVSLFVSLQHKSTGMYFVV 215

Query: 263 GTTHLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNS 319
             THL+W     Y+  +  QC ++++++ +  +  ++L++  D         F GD NS
Sbjct: 216 INTHLYW----KYDEVKLTQCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLNS 268

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 103/237 (43%), Gaps = 41/237 (17%)

Query: 117 ISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNEFKY-YNVDVLCLQEIDTVQYK 174
            +++TYN L+   +   ++    +  K W  R ++L +E  Y Y  D++CLQE+ T  Y 
Sbjct: 34  FTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYN 93

Query: 175 SFWKME-FTKLGYMCQFHFNPTKNH---------GVLIAWKEDLFD-------MTDKMLI 217
            FWK +   ++ Y   F       +         GV I +  D F+         + ++ 
Sbjct: 94  EFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLVG 153

Query: 218 DYDKETTGAIEPR--TTTKNVGMLL---SLKFKKK--------VLEKYPDTKVSGIIIGT 264
            +D++    +     T T   G ++   SL    K        V+ ++ ++K S I++  
Sbjct: 154 TFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESK-SIIVVIN 212

Query: 265 THLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNS 319
           THL+W     Y+  +  QC I+++K++       +L   +    S+    F GDFNS
Sbjct: 213 THLYW----KYDEVKLVQCLIIMRKLQRIIK--GLLMGIEGVTYSNVKILFSGDFNS 263

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 105/248 (42%), Gaps = 59/248 (23%)

Query: 118 SIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNEF-KYYNVDVLCLQEIDTVQYKS 175
           +++TYN L+   +   ++    +  K W  R ++L  E  + Y  D++CLQE+    Y S
Sbjct: 49  TMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDYIS 108

Query: 176 FWKMEFT-KLGYMCQF-------HFNPTKNH--GVLIAWKEDLFDMT------------- 212
           +WK +   K+ Y  +F       ++  TK    G  I + ++ F+               
Sbjct: 109 YWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVVGT 168

Query: 213 -DKMLIDYDKE-----TTGAIEP---------RTTTKNVGMLLSLKFKKKVLEKYPDTKV 257
            ++  I+Y K+     T GA +P          TT   V + +SL+ K         T  
Sbjct: 169 FEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHKA--------TNT 220

Query: 258 SGIIIGTTHLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQNEKDGDNSHWPA---- 311
             ++I  THL+W     Y+  +  QC I+++K+    N + +  N K  DNS        
Sbjct: 221 VFVVIN-THLYW----KYDEVKLTQCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKI 275

Query: 312 FFCGDFNS 319
            F GD NS
Sbjct: 276 IFSGDLNS 283

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 94/239 (39%), Gaps = 43/239 (17%)

Query: 117 ISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNE-FKYYNVDVLCLQEIDTVQYK 174
            +++TYN L+   +   ++       K W  R ++L +E FK Y  D++CLQE+ T  Y 
Sbjct: 30  FTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDYH 89

Query: 175 SFWKMEFTK-LGYMCQFHF--------NPTKN-HGVLIAWKEDLFDMTDKMLIDYDKETT 224
           +FW  +  + L Y   F           PT    GV I +  D F+      I Y  +  
Sbjct: 90  NFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSI-YLNDVL 148

Query: 225 GAIEPR----------TTTKNVGMLLSLKFKKKVLE-----------KYPDTKVSGIIIG 263
           G    R          T T   G  +       +L+           ++ DT    ++I 
Sbjct: 149 GIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTNTVFVVIN 208

Query: 264 TTHLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQ 320
            THL+W     Y+  +  QC  +++K++      ++L   +    S     F GD NS 
Sbjct: 209 -THLYW----KYDEVKLSQCLTIMRKLERIIK--SLLMGVEGVTYSKVKILFSGDLNSN 260

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 105/254 (41%), Gaps = 42/254 (16%)

Query: 100 LAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNE-FKY 157
           L +P  SS   +     +S++TYN L+   +   ++    +  K W  R ++L  E    
Sbjct: 6   LLIPVRSSIPGSNP-AKLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGL 64

Query: 158 YNVDVLCLQEIDTVQYKSFW-KMEFTKLGYMCQFHFNPTKNH---------GVLIAWKED 207
           Y  D++CLQE+ ++ Y+ +W K+   K  Y  ++   P   +         GV + +  +
Sbjct: 65  YRADIMCLQELTSLDYQQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLN 124

Query: 208 LFDMT-------DKMLIDYDKETTGAIEPRTTTKNVG-------MLLSLKFKKK------ 247
            FD         + +   +D +    +E +      G       M LS   K +      
Sbjct: 125 KFDYISSTGIYLNDLFGTFDLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVLKGRNQVCMF 184

Query: 248 VLEKYPDTKVSGIIIGTTHLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQNEKDGD 305
           V  ++  T    I+I  THL+W     Y+  +  QC I+++++ +     ++L   +D  
Sbjct: 185 VSLRHKATNTFLIVI-NTHLYW----KYDEVKLAQCMIIMRRLSKIIK--DLLIGVQDTT 237

Query: 306 NSHWPAFFCGDFNS 319
            +     F GD NS
Sbjct: 238 YNKVKIIFAGDMNS 251

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 108/267 (40%), Gaps = 65/267 (24%)

Query: 96  KRPM-LAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNE 154
           KRP  + +PR   G         +++TYN L+   +   ++    +  K +K   +LL +
Sbjct: 21  KRPNGINIPRRIPGHK------FTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLED 74

Query: 155 --FKYYNVDVLCLQEIDTVQYKSFWKMEFTK-LGYMCQF-------HFNPTKNH----GV 200
              + Y  DV+CLQE+    Y S+WK  F K L Y  +F       +++ T+      G+
Sbjct: 75  ELLRTYKADVMCLQELTWEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGI 134

Query: 201 LI------------AWKEDLFDMTDKMLIDYDKE-----TTGAIEP---------RTTTK 234
                          +  D+ +  ++  ++Y K      T GA  P              
Sbjct: 135 FFNLDKFEYISSTRLFLNDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRN 194

Query: 235 NVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTR--QCYIVLKKVKEFQ 292
            V + +SLK K        +T    ++I  THL+W     Y+  +  QC I+++K+ +  
Sbjct: 195 QVCLFVSLKHK--------ETNNVFVVIN-THLYW----KYDEVKLTQCMIIMRKLSQI- 240

Query: 293 NRINVLQNEKDGDNSHWPAFFCGDFNS 319
             IN L    D   S    F  GD NS
Sbjct: 241 --INELLIGADPSLSKDVIFITGDLNS 265

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 93  RFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVL 151
           RFI  P++   + + G+  R+    +++TYN L+ + +   ++       K W  R ++L
Sbjct: 5   RFI--PVVQSTKQNIGKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLL 62

Query: 152 LNEF-KYYNVDVLCLQEIDTVQYKSFW 177
             E    +  D++CLQE+ T  Y+++W
Sbjct: 63  EKELLTTFKADIMCLQEMTTRDYENYW 89

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query: 93  RFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVL 151
           RFI  P++   + S G+  ++    +++TYN L+ + +   ++       K W  R ++L
Sbjct: 5   RFI--PVVKSTKQSIGKYVQKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLL 62

Query: 152 ----LNEFKYYNVDVLCLQEIDTVQYKSFWK 178
               LN FK    D++CLQE+    Y+ +W+
Sbjct: 63  ERELLNTFK---ADIMCLQEMTARDYEDYWR 90

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 10/90 (11%)

Query: 93  RFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVL 151
           RFI  P++   + + G+  R+    +++TYN L+ + +   ++       K W  R ++L
Sbjct: 5   RFI--PVVQSTKQNIGKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLL 62

Query: 152 ----LNEFKYYNVDVLCLQEIDTVQYKSFW 177
               LN FK    D++CLQE+    Y+ +W
Sbjct: 63  EKELLNTFK---ADIMCLQEMTARDYEDYW 89

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 10/90 (11%)

Query: 93  RFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVL 151
           RFI  P++   + + G+  R+    +++TYN L+ + +   ++       K W  R ++L
Sbjct: 5   RFI--PVVQSTKQNIGKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLL 62

Query: 152 ----LNEFKYYNVDVLCLQEIDTVQYKSFW 177
               LN FK    D++CLQE+    Y+ +W
Sbjct: 63  EKELLNSFK---ADIMCLQEMTRRDYEDYW 89

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 99/238 (41%), Gaps = 45/238 (18%)

Query: 118 SIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVLLNEF-KYYNVDVLCLQEIDTVQYKS 175
           ++++YN L+ + +   ++       K W  R ++L  E    Y  D++CLQE+ +  Y +
Sbjct: 23  TLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYSN 82

Query: 176 FWKMEF-TKLGYMC--------QFHFNPTKN-HGVLIAWKEDLFDMTDKMLIDYDKETTG 225
           FWK    T + Y          Q+   P +   GV I +  D F+   +  I Y  +  G
Sbjct: 83  FWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGI-YLNQLLG 141

Query: 226 AI----------EPRTTTKNVG-------MLLSLKFKKKVL----EKYPDTKVSGIIIGT 264
                       +P T T   G       +L  LK K +V      K+ +T    ++I  
Sbjct: 142 VFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVIN- 200

Query: 265 THLFWHPFGTYERTR--QCYIVLKKVKE-FQNRINVLQNEKDGDNSHWPAFFCGDFNS 319
           THL+W     Y+  +  QC I+++++    +  +  L+N  D         F GD NS
Sbjct: 201 THLYW----KYDDVKLTQCMIIMRELARIIEKHLVGLENVTD---DKIKILFTGDLNS 251

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 101/236 (42%), Gaps = 44/236 (18%)

Query: 118 SIMTYNCLAQALIRRTLFPTSGNAVK-WFKRSQVL-LNEFKYYNVDVLCLQEIDTVQYKS 175
           ++++YN L+ + +   ++    +  K W  R  +L L     Y  D++C+QE+    Y  
Sbjct: 31  TVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDYID 90

Query: 176 FWKMEF-TKLGYMCQF--------------------------HFNPTKNHGVLIAWKEDL 208
           +W+++  T +GY  +F                           F+   + G+ +    D+
Sbjct: 91  YWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFLDV 150

Query: 209 FDMTD-KMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKK--VLEKYPDTKVSGIIIGTT 265
           F+  + + L +   E T     +   K +  +LS+K +    V  K+ +T    III  T
Sbjct: 151 FNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIIN-T 209

Query: 266 HLFWHPFGTYERTR--QCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNS 319
           HL+W     Y+  +  QC I+++++ +  + +      +D  +S     F GD NS
Sbjct: 210 HLYW----KYDEVKLSQCIIIMRELSKIIDEL-----LQDVRHSKVKIIFAGDLNS 256

>KAFR0J02930 Chr10 complement(556241..558298) [2058 bp, 685 aa] {ON}
           Anc_3.576 YGL249W
          Length = 685

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 65/148 (43%), Gaps = 4/148 (2%)

Query: 119 IMTYN-CLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFW 177
           IM Y  C+ +  +      ++G  + +  + Q LL  FK   + V   + ++TV  + FW
Sbjct: 518 IMNYQTCVFRIRLSNFFQLSNGGKLYYENQLQSLLKNFKTIIILVEYSELLETVDQEVFW 577

Query: 178 KMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVG 237
           ++ F       + HF PT N+  L+ W   L     +M  D D+             ++G
Sbjct: 578 RLRFFLNFPQFEVHFVPTGNNIALLNWITMLVVRFAEMF-DEDESFESITVEEQILCDIG 636

Query: 238 MLLSLKFKKKVLEKYPDTKVSGIIIGTT 265
             L++   K++L+KY   ++   II  +
Sbjct: 637 --LNILLVKRLLKKYDIPQILKHIIANS 662

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 9/104 (8%)

Query: 96  KRPMLAVPRDSSGQS-TREVCPI-----SIMTYNCLAQALIRRTLFPTSGNAVK-WFKRS 148
           +R  L V R S+  S +R    +     +++TYN L+ + +   ++    +  K W  R 
Sbjct: 3   RRQFLPVARSSNVLSASRNASKLINDKFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRH 62

Query: 149 QVLLNEF-KYYNVDVLCLQEIDTVQYKSFWK-MEFTKLGYMCQF 190
           ++L +E    Y  D++CLQE+ +  Y   WK +  + +GY  +F
Sbjct: 63  KLLESELLGSYKADIMCLQEMTSRDYNENWKRLLGSGIGYGSKF 106

>Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}
           YIL014C-A (REAL)
          Length = 107

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/63 (20%), Positives = 27/63 (42%)

Query: 117 ISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSF 176
           +++   + + + L+   L PT  NA +W        ++F+Y      C +  D   +  +
Sbjct: 45  LNVSAIDGIMETLVETKLVPTLENATQWVSDMSAYWSQFEYGEEPTYCPKSFDLNDFYEY 104

Query: 177 WKM 179
           W M
Sbjct: 105 WHM 107

>SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40151 Saccharomyces cerevisiae
           YNL218W MGS1 Protein with DNA-dependent ATPase and ssDNA
           annealing activities involved in maintenance of genome
           interacts functionally with DNA polymerase delta homolog
           of human Werner helicase interacting protein (WHIP)
          Length = 550

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 46/118 (38%), Gaps = 17/118 (14%)

Query: 94  FIKRPMLAVPRDSSGQSTREVCPISIMTYN------------CLAQALIRRTLFPTSGNA 141
           +I R M+ +  +  G     + P+S+ TYN             LAQ  +     P S   
Sbjct: 396 YIARRMIRIASEDVGMVDNSLLPLSVATYNAVTKVGLPEADLALAQCCVALARAPKSVEL 455

Query: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHG 199
            + +K+   LL E K+     L   EI      +  K+   +LGY   + +NP    G
Sbjct: 456 YRAWKQVNALLRENKHS----LASSEIPMHLRNAPTKL-MEELGYHKGYKYNPDYAEG 508

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 408 RAISLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDEL 467
           R + ++ +  +  H   +  D  RN  + +NW H  R   +  Y   S       K+ E 
Sbjct: 120 RVMKIHRLGRTSFHSVRNNRDYLRNSNQGANWMHLSRLAANKEYQFMSMLYSKGFKVPE- 178

Query: 468 STFEQNYGVQVLELLRIPPAKEMTEHGQ-PHEGEYPSDHLCMIVKLG 513
             F+ +  + V+EL+   P + + +H   P   +  SD +C IV+L 
Sbjct: 179 -PFDNSRHIVVMELIEGYPMRRLRKHKNIP---KLYSDLMCFIVELA 221

>Kpol_1073.12 s1073 complement(19854..21152) [1299 bp, 432 aa] {ON}
           complement(19854..21152) [1299 nt, 433 aa]
          Length = 432

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 104 RDSSGQSTREVCPISI--MTYNCLAQALIRRTLFPTSGNAVKWFKR-SQVLLNEF--KYY 158
           R+ S    + V PIS+  ++ + L Q L ++ +FP+  N V W K+ + + +  +  +YY
Sbjct: 62  RNPSLMDGKPVFPISLPLLSTSVLPQLLYKKIIFPSVRNIVPWLKKFNYIRIKNYSDEYY 121

Query: 159 NVDVLCLQEIDTVQYK 174
            +D   L E+ TV+ K
Sbjct: 122 TIDFKPL-EMPTVESK 136

>KLTH0G08096g Chr7 (653942..658783) [4842 bp, 1613 aa] {ON} similar
           to uniprot|Q12275 Saccharomyces cerevisiae YOR093C
           Hypothetical ORF
          Length = 1613

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 50/117 (42%), Gaps = 16/117 (13%)

Query: 164 CLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKED--LFDMTDKMLIDYDK 221
           CL++ID++++    K+  TK G++    F  T + G     K+    FD+     I++  
Sbjct: 270 CLKQIDSLRFDGNNKVRLTKSGFLSDITFITTDDLGTYSKAKKSSPTFDIPSVSYIEF-- 327

Query: 222 ETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERT 278
                     T   +G L  +  K K+L K  +T  S I+       W P G  ER+
Sbjct: 328 ----------TRTPLGRLSGVVMKHKILSKQLETMAS-ILNSRRKAHW-PKGDIERS 372

>KNAG0C06190 Chr3 complement(1200399..1201889) [1491 bp, 496 aa]
           {ON} Anc_5.616 YDR257C
          Length = 496

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 225 GAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLF 268
           G IEP  +  + G +    F K  +EKYPDTK   +++  ++L 
Sbjct: 278 GYIEPDGSKFDFGEIPMETFIKIFMEKYPDTKAEELLVNVSNLL 321

>Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C -
           Hypothetical ORF [contig 247] FULL
          Length = 1617

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 14/97 (14%)

Query: 164 CLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKED--LFDMTDKMLIDYDK 221
           CL++ID + ++   K++ TK G++ +  F  T + G     K+    FD+ +   I++  
Sbjct: 273 CLKQIDNLHFEGNSKIKLTKSGFLSRMVFIRTDDMGTYSKAKKSNPTFDIPNVSYIEF-- 330

Query: 222 ETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVS 258
                     T   +G L  +  K K+L K  +T  S
Sbjct: 331 ----------TRTPLGRLSGVVMKHKILSKQLETMAS 357

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,743,281
Number of extensions: 2254846
Number of successful extensions: 5460
Number of sequences better than 10.0: 79
Number of HSP's gapped: 5422
Number of HSP's successfully gapped: 80
Length of query: 516
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 402
Effective length of database: 40,409,475
Effective search space: 16244608950
Effective search space used: 16244608950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)