Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C06204g6.28ON37737719620.0
Ecym_30326.28ON37738010661e-144
SAKL0E01518g6.28ON37937910501e-141
KLTH0C10978g6.28ON37737910371e-140
Suva_15.1726.28ON39837810381e-139
TDEL0G044106.28ON38138210301e-138
NDAI0C026506.28ON38938910191e-137
Skud_15.1596.28ON37938010031e-134
CAGL0E02497g6.28ON37637810001e-134
NCAS0D021406.28ON3763839961e-133
ZYRO0C07546g6.28ON3773789941e-133
Kpol_1037.236.28ON3783799891e-132
YOL003C (PFA4)6.28ON3783789891e-132
Kwal_56.224596.28ON3833799731e-130
Smik_15.1676.28ON3783799561e-127
ACL003C6.28ON3753779531e-127
TPHA0J003906.28ON3803799301e-123
KNAG0F029306.28ON3863868581e-112
KAFR0A051306.28ON3964008281e-108
TBLA0B004806.28ON3774034502e-51
Kpol_1014.293.12ON3261461921e-15
NCAS0E013003.12ON327661921e-15
SAKL0H13860g8.389ON3521491903e-15
NDAI0G013403.12ON335661885e-15
TPHA0P015603.12ON331501877e-15
KAFR0A085903.12ON331501861e-14
Skud_12.3218.389ON3561201861e-14
CAGL0D02508g3.12ON332501851e-14
KLTH0F19580g3.12ON342561852e-14
TDEL0A003103.12ON329511842e-14
SAKL0C13596g3.12ON333501842e-14
Kwal_55.221263.12ON360511842e-14
KNAG0K025703.12ON3281291814e-14
TBLA0H001503.12ON345501815e-14
Suva_10.3428.389ON3561191799e-14
CAGL0G08217g8.389ON3262601771e-13
KLLA0E02069g3.12ON325491771e-13
Ecym_20143.12ON339531772e-13
TDEL0F051308.389ON3591581772e-13
TBLA0D040408.286ON329491762e-13
YLR246W (ERF2)8.389ON3591621762e-13
Ecym_41788.389ON368561763e-13
ADL197C3.12ON390541754e-13
ZYRO0C03410g3.12ON3271241734e-13
Smik_12.3068.389ON359571744e-13
Suva_14.153.12ON330531734e-13
ZYRO0C04092g8.389ON366571735e-13
Skud_14.153.12ON336531725e-13
KLTH0F08668g8.389ON358571727e-13
KLLA0D18370g8.389ON355691727e-13
AGL125C8.389ON367571719e-13
YDR126W (SWF1)8.286ON336541719e-13
NCAS0C029208.389ON374491701e-12
ZYRO0D06600g8.286ON330481682e-12
TPHA0C023608.389ON4041021702e-12
KNAG0A027108.389ON3541161682e-12
Smik_14.63.12ON334501682e-12
Suva_2.2898.286ON335561682e-12
NCAS0B035908.286ON329541672e-12
KAFR0B053708.286ON329651663e-12
YNL326C (PFA3)3.12ON336501663e-12
Skud_4.3878.286ON336561664e-12
KAFR0H019808.389ON361491664e-12
Kwal_23.33028.389ON353501647e-12
Smik_4.3728.286ON335541621e-11
NDAI0G022508.389ON3891181621e-11
TDEL0F041308.286ON3281361612e-11
SAKL0H16434g8.286ON555491595e-11
TBLA0H009208.389ON360761575e-11
NDAI0J010008.286ON339481567e-11
CAGL0B01991g8.286ON330481551e-10
TPHA0C010708.286ON333511522e-10
KLTH0G13112g8.286ON3491391496e-10
Kpol_1033.168.286ON321481487e-10
Ecym_42828.286ON340491478e-10
AGR065W8.286ON326441423e-09
KLLA0F19690g8.286ON324741407e-09
Kwal_56.236978.286ON338561353e-08
KNAG0H031108.286ON331881327e-08
Smik_4.7375.579ON3782231282e-07
KAFR0I011105.579ON370701249e-07
Skud_4.7345.579ON3802241249e-07
KLTH0G04972g5.579ON367781231e-06
NCAS0F013905.579ON374651222e-06
Kwal_47.183665.579ON356651203e-06
Ecym_41145.579ON372661193e-06
Kpol_1004.575.579ON362651184e-06
YDR459C (PFA5)5.579ON374711185e-06
SAKL0G06160g5.579ON364681167e-06
KNAG0C028305.579ON354741168e-06
NDAI0H018905.579ON406651169e-06
TBLA0E028305.579ON3861081151e-05
Suva_2.6345.579ON388661113e-05
KLLA0D06149g5.579ON349681087e-05
TDEL0A044405.579ON365671087e-05
ZYRO0D13860g5.579ON3652971007e-04
ABR203W5.579ON35965999e-04
KNAG0B031405.626ON682931009e-04
KNAG0C062305.626ON7521361000.001
Kpol_526.325.626ON77798990.001
CAGL0K06347g5.579ON35269970.002
Suva_2.4325.626ON76350980.002
ZYRO0C11132g5.626ON75997970.002
NCAS0C052805.626ON75791960.003
TPHA0C003705.626ON75951950.004
YDR264C (AKR1)5.626ON76450950.004
NDAI0H008505.626ON78653940.005
Skud_4.5275.626ON76450930.007
KAFR0H005705.626ON75756910.011
Smik_4.5155.626ON76450910.012
CAGL0M08712g5.626ON76398900.014
Suva_8.875.626ON73054900.015
TBLA0J008305.626ON73951880.030
TDEL0A049205.626ON75059840.079
KLTH0E02420g5.626ON73457840.080
YOR034C (AKR2)5.626ON74954820.15
Ecym_13305.626ON73996820.15
SAKL0G07326g5.626ON73784810.18
AER388C5.626ON72449810.20
Smik_15.2135.626ON74454780.40
KLLA0E16721g5.626ON75258704.1
Skud_15.1995.626ON74143704.3
KAFR0J014002.279ON46547695.0
YML049C (RSE1)1.497ON1361157678.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06204g
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   760   0.0  
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   415   e-144
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   409   e-141
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   404   e-140
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   404   e-139
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   401   e-138
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     397   e-137
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   390   e-134
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   389   e-134
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   388   e-133
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   387   e-133
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   385   e-132
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   385   e-132
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   379   e-130
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   372   e-127
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   371   e-127
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   362   e-123
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   335   e-112
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   323   e-108
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   177   2e-51
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    79   1e-15
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    79   1e-15
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    78   3e-15
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      77   5e-15
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    77   7e-15
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    76   1e-14
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    76   1e-14
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    76   1e-14
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    76   2e-14
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    75   2e-14
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    75   2e-14
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    75   2e-14
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    74   4e-14
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    74   5e-14
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    74   9e-14
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    73   1e-13
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    73   1e-13
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    73   2e-13
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    73   2e-13
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    72   2e-13
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    72   2e-13
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    72   3e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    72   4e-13
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    71   4e-13
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    72   4e-13
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    71   4e-13
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    71   5e-13
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    71   5e-13
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    71   7e-13
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    71   7e-13
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    70   9e-13
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    70   9e-13
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     70   1e-12
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    69   2e-12
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    70   2e-12
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    69   2e-12
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    69   2e-12
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    69   2e-12
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      69   2e-12
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    69   3e-12
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    69   3e-12
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    69   4e-12
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    69   4e-12
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    68   7e-12
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    67   1e-11
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     67   1e-11
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    67   2e-11
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    66   5e-11
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    65   5e-11
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    65   7e-11
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    64   1e-10
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    63   2e-10
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    62   6e-10
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    62   7e-10
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    61   8e-10
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    59   3e-09
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    59   7e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    57   3e-08
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    55   7e-08
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    54   2e-07
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    52   9e-07
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    52   9e-07
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    52   1e-06
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    52   2e-06
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    51   3e-06
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    50   3e-06
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    50   4e-06
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    50   5e-06
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    49   7e-06
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    49   8e-06
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    49   9e-06
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    49   1e-05
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    47   3e-05
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    46   7e-05
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    46   7e-05
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    43   7e-04
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    43   9e-04
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    43   9e-04
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    43   0.001
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    43   0.001
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    42   0.002
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    42   0.002
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    42   0.002
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    42   0.003
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    41   0.004
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    41   0.004
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    41   0.005
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    40   0.007
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    40   0.011
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    40   0.012
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    39   0.014
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    39   0.015
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    39   0.030
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    37   0.079
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    37   0.080
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    36   0.15 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    36   0.15 
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    36   0.18 
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    36   0.20 
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    35   0.40 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    32   4.1  
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    32   4.3  
KAFR0J01400 Chr10 complement(255158..256555) [1398 bp, 465 aa] {...    31   5.0  
YML049C Chr13 complement(174220..178305) [4086 bp, 1361 aa] {ON}...    30   8.6  

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/377 (96%), Positives = 364/377 (96%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHFMRFLFWVIFSTA             WSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240
           VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240

Query: 241 NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD 300
           NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD
Sbjct: 241 NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD 300

Query: 301 PNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSWY 360
           PNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSWY
Sbjct: 301 PNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSWY 360

Query: 361 NDWGEDLSDFGVDTELE 377
           NDWGEDLSDFGVDTELE
Sbjct: 361 NDWGEDLSDFGVDTELE 377

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  415 bits (1066), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 200/380 (52%), Positives = 256/380 (67%), Gaps = 7/380 (1%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M +KLK  WLG+AIP FL+A IGY +  F+L  FLS  +QI++Q   TMIW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P   F+P   EW NYCKKC+ +KPER HHCKTC QCVL MDHHCP+T+NCVG++NF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHFMRFLFW+I +T              W+IRH+     +  EIIF+ I+TP +AFVLLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240
           +S L GRCI NQ L+GMTQIE+WEMDRI+S+ Y  RL+ Q++  L E  P  L   + EI
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240

Query: 241 NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD 300
           +++L+ R ++ ED  NFPYD +PW N+ N MGP   WL P+ KP   G  F KNEL  Y+
Sbjct: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300

Query: 301 PNSSIEDMLMSLPWPPDGLTHHSRALGSGSS---IETIVSGGEQVIRDKSVDLRDRLGRN 357
             S++ D L+SLPWPPDG     RA  S +S   +E+    GE +IR +S + R  L R 
Sbjct: 301 HGSTLTDKLLSLPWPPDG----ERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRT 356

Query: 358 SWYNDWGEDLSDFGVDTELE 377
            WYNDWGE+L+ FGVD + +
Sbjct: 357 EWYNDWGENLAHFGVDVDAD 376

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  409 bits (1050), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 201/379 (53%), Positives = 258/379 (68%), Gaps = 2/379 (0%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           MA+KLK  WLG+AIP FL++ IGY +HYFILSNFL   +Q++++    MIW+SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P   F+PS  EW N+C KC  YKPERAHHCK CNQCVL+MDHHCPWT+NCVGH NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
            HF+RFLFWVI +T+             W+ RH   +    SE+IF+ I+TPMDAFVLLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240
           +S LL RC  NQ L GMTQIESWEMDRI+++ +  +L+ ++++ L E RP  L  +  +I
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240

Query: 241 NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD 300
            KLLS+  ++ ++  NFPYD+NPW N  N++G  Y W+ PW      G  F KNEL  Y+
Sbjct: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300

Query: 301 PNSSIEDMLMSLPWPPDGLTHHSRALGSGSS--IETIVSGGEQVIRDKSVDLRDRLGRNS 358
           P   IED L+SLPWPPDG  H     G+     +E+    GE+V+R + VD R  + R  
Sbjct: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360

Query: 359 WYNDWGEDLSDFGVDTELE 377
           WYNDWGE+L+DFGVD + E
Sbjct: 361 WYNDWGENLADFGVDLDEE 379

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  404 bits (1037), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/379 (52%), Positives = 258/379 (68%), Gaps = 5/379 (1%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M ++LK  WLG+A+P+FL+A IGY SHYFIL NF S  +Q++++   T+IWVSY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG PP +F+P   +W NYCKKC  YKPER HHCKTC QCVL+MDHHCPWT+NCVGH+NF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHT-AFHHRSTSEIIFICIMTPMDAFVLL 179
           PHF+RFL WV+ +T+             W+ R+T  F H  TSE+ F+ +  P++AF+LL
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVH--TSELCFLFVNAPLNAFILL 178

Query: 180 TVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHE 239
           TVS L+ RC+ NQ L+GMTQIESWE DRI++L +  RL+ Q+ID L E  PE     +  
Sbjct: 179 TVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDT-FDEGA 237

Query: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299
             KLLS + +  ED  NFPYDV+   N+ ++MGP Y W  P  +P   GT F  N+L  Y
Sbjct: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297

Query: 300 DPNSSIEDMLMSLPWPPDGLTHHS-RALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNS 358
           D  +SIED L+SLPWPPDG    S R+    S++ET  SGGE  +R++S D R  + R  
Sbjct: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 359 WYNDWGEDLSDFGVDTELE 377
           W+NDWGE+LSDFGVD + E
Sbjct: 358 WHNDWGENLSDFGVDVDAE 376

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  404 bits (1038), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 256/378 (67%), Gaps = 1/378 (0%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           MA+KLK  WLG+AIP FL++ IGYG+HYFILSNFLS ++QI +++  +MIWVSYYLAIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P   ++P+   W NYCKKC+ YKPER+HHCK CNQCVL MDHHCPWT+NCVG  N+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHF+RF+FWVI +T              W  RH   +    SE++F+ I+TP++ FVLLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEIL-PAKQHE 239
           +  L  RC++NQ ++G +QIESW+MDR++SL    RL+ ++I+      PE   P  + +
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299
             KLL++  +  E+  NFPY+++ +TN    +GP +LWLWP   P   G SF KN++  Y
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSW 359
           + NSS+ED+++SLPWPPDG    + +  S  +IET   GGEQV+R +         R  W
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380

Query: 360 YNDWGEDLSDFGVDTELE 377
           YNDWGE L DFGVD ++E
Sbjct: 381 YNDWGESLDDFGVDVDME 398

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  401 bits (1030), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/382 (50%), Positives = 254/382 (66%), Gaps = 9/382 (2%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M +KLK  WLG+AIP  LV+ IGY  H+FILSNFLS ++Q+++Q    +IW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P  +F+    EW NYCKKC+ YKPERAHHCKTCNQCVL MDHHCPWT+NCVGH+NF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHF+RFL WVI +TA             W  R+   +    SE++F+ I+TP+DAFVLLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240
           ++ LL RC+ NQ  +GM+QIE+WE++R+Q+L    RL    +  L+E   +I P  + +I
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRL----VPLLIEAAWDIFPGTREQI 236

Query: 241 N-----KLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNE 295
           N     +L   + +  ED  NFPYD++PW+N    +G   LWLWP+ +P   G SF KNE
Sbjct: 237 NESTAAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNE 296

Query: 296 LFFYDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLG 355
           +  Y   +S ED+L+SLPWPPDG    +      SSIE+I   GEQ+IR +  D  D +G
Sbjct: 297 ISEYSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIG 356

Query: 356 RNSWYNDWGEDLSDFGVDTELE 377
           R  W NDWGE+L DFGVD + E
Sbjct: 357 RRQWQNDWGENLEDFGVDVDTE 378

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  397 bits (1019), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 195/389 (50%), Positives = 257/389 (66%), Gaps = 14/389 (3%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           MAIKLK  WLGVAIP+F+++ IGY SHYFILSNFLS  +QI++Q   +MIWVSY LAI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGIPPKDFKP----SAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVG 116
           NPG PPK+ KP       +W+ +CKKC  YKPER+HHCKTCNQCVL MDHHCPWT+NCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 HSNFPHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAF 176
           + NFPHF+RFL W+I +T              W++RH   +    +EIIF+ I+ PMDAF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 VLLTVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRP-EILPA 235
           +LLT+S L  RC  NQ + GMTQIE WE++R+++L Y  +LL  +I  L E  P E    
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 236 KQHEINKLLSKR-YVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKN 294
             +  + LLS+R  V  E+  NFPYD++ WTN+N  MG  + W+W +  P   G  F KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 295 ELFFYDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVD----- 349
           E+  Y+P SS+ED+L+SLPWPPD     +      +S+E++V  GEQV+R+++ +     
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPD--KGRNFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358

Query: 350 -LRDRLGRNSWYNDWGEDLSDFGVDTELE 377
            +   + R  W NDWGE L DFGVD E E
Sbjct: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  390 bits (1003), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 189/380 (49%), Positives = 257/380 (67%), Gaps = 4/380 (1%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           MA+KLK  WLG+AIP FL++ IGYG+HYFILSNFLS ++Q+ ++   +MIWVSYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           N G P  +++PS   W N+CKKC+ YKPER+HHCK CNQCVL MDHHCPWT+NCVG  N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHF+RFLFWVI +T+             W  R    +    SE+IF+ I++P+D FVLLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHE- 239
           ++ L  RC+ NQ ++G +QIESW+MDR++SL    +L+ ++ID      PE   + QHE 
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEAR-SSQHER 239

Query: 240 -INKLLSKR-YVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELF 297
             +KLL++R     ++  +FPY+ NP TN    +GP  LWLWP+  P   G SF KN++ 
Sbjct: 240 DADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDIS 299

Query: 298 FYDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRN 357
            Y+ NS +ED+++SLPWPPDG    + +  + S+IET   GGEQ++R ++        R 
Sbjct: 300 QYEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIRE 359

Query: 358 SWYNDWGEDLSDFGVDTELE 377
            WYNDWGE L DFGVD ++E
Sbjct: 360 KWYNDWGESLDDFGVDVDME 379

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  389 bits (1000), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 187/378 (49%), Positives = 256/378 (67%), Gaps = 3/378 (0%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M +KLK  WLG+AIP+FL+A IGY +HYFIL NFLS  +Q++YQ CQTMIW+SYYLAIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
            PG PP +FKPS  EW  YCKKC+ YKPER+HHCKTCNQCVL MDHHCPWT+NCVG++NF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHF+RFLFWVI  T              W  R +  +    SE+IF+ I+TP++AF+LLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAK-QHE 239
           +S L+ RC++NQ  +G +QIESWEMDR+++L   ++LL  +I+ +    P +     + +
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299
              LL+K+ ++ ++  NFPYD+ P+ N    +G   LWL+P+S P   G  F KNE    
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSW 359
           +  +S+ D+++ LPWPPD   H +      S+++ I   GEQVIR ++ +   +L R+ W
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPE--KKLSRSEW 358

Query: 360 YNDWGEDLSDFGVDTELE 377
            NDWGE L DFGVD ++E
Sbjct: 359 LNDWGESLEDFGVDVDVE 376

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  388 bits (996), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 182/383 (47%), Positives = 255/383 (66%), Gaps = 13/383 (3%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M +KLK  W+GV IP  L + IGY +H F+L+NF+SW  Q+++Q+  TM+W+SY LAI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P K FKP  +EW ++CKKC+++KPERAHHCKTCNQCVL MDHHCPWT+NCVG  NF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHF+RFLFWV+ +T              W ++    +    +EI F+ I+ PMD FVL+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240
           V+ L  RC+ NQ + G TQIESWE++R+++L+Y+ +LL Q++  L     EI P ++   
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLW----EIYPNEKTPE 236

Query: 241 NKLLSK------RYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKN 294
           NK+L+K      R V  E+   FPYD++ W+N    +G    WLW +  P + G  F KN
Sbjct: 237 NKVLAKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKN 296

Query: 295 ELFFYDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRL 354
           EL  Y+  ++IED+L+SLPWPPDG  +  +    G+++E+I   GEQVIR ++ +  D  
Sbjct: 297 ELALYEEGAAIEDLLLSLPWPPDGGRNFIQQ--KGTNVESITENGEQVIRQRNFE-NDNS 353

Query: 355 GRNSWYNDWGEDLSDFGVDTELE 377
            R +W NDWGE+L DFGVD ++E
Sbjct: 354 YRKTWNNDWGENLEDFGVDVDVE 376

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  387 bits (994), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 187/378 (49%), Positives = 251/378 (66%), Gaps = 2/378 (0%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M ++LK  +LG+AIP FL++ IGY +HYFILSNFLS  +QI+++   TMIW SYYLAIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
            PG P  +F+PS   W +YCKKCR YKPERAHHCKTCNQCVLAMDHHCPWT NCVG+ NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHFMRFLFWVI +T               S  ++  +  + SE+IF+ I+ PMD F+LLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAK-QHE 239
           +S L  RC+ NQ   G TQIE+WE +R++ L+Y  RLL  ++    E  PE+   + + E
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299
            ++L ++R +  +   NFPYD++PW+N    +G    WLWP+ KP   G  F KN++  +
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSW 359
           +  +++ DML++LPWPPDG      ++   +++ET V  GEQVIR + VD RD   R  W
Sbjct: 301 E-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359

Query: 360 YNDWGEDLSDFGVDTELE 377
            N WGE+L DFGVD + E
Sbjct: 360 QNTWGENLEDFGVDVDAE 377

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  385 bits (989), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 190/379 (50%), Positives = 243/379 (64%), Gaps = 3/379 (0%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M +KLK  W+G+AIP FL++ I Y +HYFIL NFLS  +QI+++   TMIW+SYYLAIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P  ++ P + +W NYCKKC  YKPER HHCKTC QCVL MDHHCPWT+NCVG+ NF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHF+RFLFWVI +T              W  R+   +  + SEIIF+ I TPMD FVLLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEI-LPAKQHE 239
           +S L  RC  NQ L G TQIE+WE +R++SL Y  RL  Q+I  L E  PE+  P  + +
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299
             K++SKR +  +   +FPYD+    NI   +G    WLW + +P   G  F KNE   +
Sbjct: 241 AEKIVSKR-IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299

Query: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGS-SIETIVSGGEQVIRDKSVDLRDRLGRNS 358
           + +S +ED ++SLPWPPDG  H      S + SIET    GE VIR +S   +    R  
Sbjct: 300 EEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 359 WYNDWGEDLSDFGVDTELE 377
           WYNDWGE+L DFGVD ++E
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  385 bits (989), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 184/378 (48%), Positives = 252/378 (66%), Gaps = 1/378 (0%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M +KL+  WLG+AIP FL++ IGYG+HYFILSNFLS  +QI ++ C +MIW+SYYLAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P  ++KP  + W N+CKKC+ YKPER+HHCKTCNQCVL MDHHCPWT+NCVG +N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHF+RFLFW+I +T+             W  RH   +    SE+IF+ I +P+++FVLLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAK-QHE 239
           ++ L  RC++NQ L+G +QIESW+MDR++SL    RL  ++ID      PE    + + +
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299
             + L+K+    ++  NFPYD + +TN    +GP +LWLWP+  P   G +F KN +  Y
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSW 359
           + NSS+ED ++SLPWPPDG   ++      S+IE     GEQ+IR +         R  W
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360

Query: 360 YNDWGEDLSDFGVDTELE 377
           YNDWGE L DFGVD ++E
Sbjct: 361 YNDWGESLDDFGVDVDME 378

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  379 bits (973), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 193/379 (50%), Positives = 247/379 (65%), Gaps = 5/379 (1%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M +KLK  WLG+AIP+ L+A IGYGSHYFIL NFLS  +Q+++Q C +MIW+SY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG PP  F+P   +W N C+KC+ YKPER HHCKTC+QCVL MDHHCPWT+NCVGH+NF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHF+RFL WVI +T+             W +RHT  + +   E++FI I TP++AFV LT
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKI-ELVFIFINTPLNAFVWLT 179

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVE-RRPEILPAKQHE 239
           +  LL RC  NQ L GMTQIE WE +RI++     RL+ Q+++ L E    +IL +   +
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAK 239

Query: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299
             KL++ R +  E+  NFPYD+N   N  +A+G     + PWS P   G  F KN+L  Y
Sbjct: 240 --KLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297

Query: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSS-IETIVSGGEQVIRDKSVDLRDRLGRNS 358
           D   +IED L+SLPWPPDG           SS IE   S GE V+R +  D R  + R  
Sbjct: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357

Query: 359 WYNDWGEDLSDFGVDTELE 377
           WYNDWGE+LSDFGVD E E
Sbjct: 358 WYNDWGENLSDFGVDVESE 376

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  372 bits (956), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 180/379 (47%), Positives = 250/379 (65%), Gaps = 3/379 (0%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           MA+KL+  WLG+AIP  L++ IGYG+HYFILSNFL   +QI ++   +MIW SYYLAIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P  +++P+   W N+CKKC+ YKPER+HHCKTCNQCVL MDHHCPWT+NCVG  N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHF+RFLFW+I +T+             W  R+   +    SE+ F+ I++P++ FVLLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240
           ++ L  RC++NQ ++G +QIESW+MDR++SL    RL+ ++I       PE     QHE 
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPES-KTLQHER 239

Query: 241 NK--LLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFF 298
           +   LL ++  + E   NFPY+ +  TN    +GP +LWLWP+  P   G +F KN++  
Sbjct: 240 DAEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISN 299

Query: 299 YDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNS 358
           Y+ +S +ED+++SLPWPPDG    + +    S+IET   GGEQV+R +         R  
Sbjct: 300 YEVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359

Query: 359 WYNDWGEDLSDFGVDTELE 377
           W+NDWGE L DFGVD ++E
Sbjct: 360 WFNDWGESLDDFGVDVDME 378

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  371 bits (953), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 181/377 (48%), Positives = 237/377 (62%), Gaps = 2/377 (0%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           MA+ +K  WLGVAIP FL++  GY +H+F+L+NFLS+ E +++Q   +MIW+SY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P K F+P   EW NYC KC  YKPER HHCK CNQCVL MDHHCPWT+NC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
                   W+I +T              W  R+   +  S  E+IF+ I+TP+DAF+LLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240
           +S L  RC+ NQ ++G TQIE+WEMDRI++L Y  RLL Q++  L E  P  L  ++ E+
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240

Query: 241 NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD 300
            + LS    + ++  NFPYD+NPW N+ N MG    WL P+  P   G  F KNE+  YD
Sbjct: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300

Query: 301 PNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSWY 360
             +SI+D L++LPWPPD  T H  A  S S +E    GGEQV+R + V +     RN WY
Sbjct: 301 EATSIQDKLLALPWPPDD-TRHGIAFPSVSHVEKDTQGGEQVVRRRHVPIAVP-PRNEWY 358

Query: 361 NDWGEDLSDFGVDTELE 377
           NDWGE L  FGVD E+E
Sbjct: 359 NDWGESLEHFGVDVEVE 375

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 177/379 (46%), Positives = 249/379 (65%), Gaps = 2/379 (0%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M +K K  W+G+AIP  L++ IGY SHY+IL   LS  +Q +++   TMIWVSYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           NPG P K+FKP   EW N+CKKC  YKPER+HHCKTCNQCVL MDHHCPWT+NC+G +NF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180
           PHFMRFL W++ +T              W+ R+   +    SE+I + + TP++ F+LLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQ-HE 239
           ++ L  RC++NQ ++G TQIE WEMDR+++  Y  +LL Q+I  L E  PE+  AK   E
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299
             +L+ K+ +  +   NFPYD+  + NI   +G    WLWP+  P   G +F KNE+  +
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 300 DPNSSIEDMLMSLPWPPD-GLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNS 358
           DP+SS+    ++LPWPPD G  ++S+ L + S++E I + GEQV+R+++      L R  
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 359 WYNDWGEDLSDFGVDTELE 377
           W+N+WGE+L DFGVD E+E
Sbjct: 361 WFNEWGENLEDFGVDVEME 379

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  335 bits (858), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 235/386 (60%), Gaps = 17/386 (4%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M ++LK  W G+AIP  L+  IGY +H+FIL N LS   QI +Q C TMIW+SYY+AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGIPPKDF--KPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHS 118
           NPG PP     + +  + + YC KC  +KPER+HHCKTC QCVL MDHHCPWT+NC+G  
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFPHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFH----HRSTSEIIFICIMTPMD 174
           NFP FMRFL WVI +T+             W  R+          +T E++ + ++TPMD
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 AFVLLTVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRP-EIL 233
            FVL T+++L  RC+ NQ + GMTQIESWEM+R+Q++ Y  +LL  +I+R+ E+ P E  
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 234 PAKQHEINKLLSKRYVNQEDFT---NFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTS 290
           P  + E  KLL         F+   NFPYDV+  TNI+ ++G   L LWP+S     G +
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 291 FAKNELFFYDPNSSIEDMLMSLPWPPDG---LTHHSRALGSGSSIETIVSGGEQVIRDKS 347
           F KN++  Y+ N SI D+L+ L WPPDG   + H  R  G+   I+  V  GE +IR ++
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGA-HMIDQTVEDGEFMIRKRN 359

Query: 348 VDLRDRLGRNSWYNDWGEDLSDFGVD 373
             +     R +W N WGE L  FGVD
Sbjct: 360 SPIES---RTTWENQWGETLEGFGVD 382

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  323 bits (828), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 178/400 (44%), Positives = 242/400 (60%), Gaps = 27/400 (6%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           MAI+LK  WLG+AIP FL++ IGY +HYFIL + LSW  Q+++Q   +MIW+SYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGIPP-KDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSN 119
           +PG P   D     +    YCKKC  YKP RAHHCKTCN+C+L MDHHCPWT+NCVG  N
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 FPHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLL 179
           +PHF+RFLFWVI +TA             W+  +++       EI+ + I+TPMDAF+LL
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 180 TVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNR---------LLAQVIDRLVERRP 230
           T++ LL RC  NQ   GM+QIE WEM+R++S  Y  +         L+  V        P
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240

Query: 231 EILPAKQHEINKLL---SKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTI 287
           E     Q E+N LL    KR +      NFPYD++  TN    +GP++ WL P+  P   
Sbjct: 241 E---DYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGD 297

Query: 288 GTSFAKNELFFYDPNSSIEDMLMSLPWPPDGLT-HHSRALGSGSS-IETIVSGGEQVIRD 345
           G  F  NE+   +  S++ D+L+SLPWPPD  T  + +++  G+  +ET + GGE V+R+
Sbjct: 298 GMHFELNEI-ASEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRN 356

Query: 346 KSV----DL----RDRLGRNSWYNDWGEDLSDFGVDTELE 377
           ++V    DL     ++L R SW N+WGE+L  FGVD E E
Sbjct: 357 RTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  177 bits (450), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 139/403 (34%), Positives = 196/403 (48%), Gaps = 59/403 (14%)

Query: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           M I+    W GVAIP+ ++  +   S++ IL + L+ N+ I+Y T   MI  SYYLAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGIPPKDFKPS--AEEWHN--------YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPW 110
            P   P     S  ++  +N         CKKC+  K  RAHHCKTCN CV+ MDHHCPW
Sbjct: 61  PPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHHCPW 120

Query: 111 TLNCVGHSNFPHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFH--HRSTSEIIFIC 168
           T+NCVG++N+PHF+RFL WVI ST              +  R++ FH       +II + 
Sbjct: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIIILT 180

Query: 169 IMTPMDAFVLLTVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVER 228
           ++ P   FV LTV  LL + + NQ  +GMTQIE W+ + I++ +++++     +   +  
Sbjct: 181 LLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQLLE 240

Query: 229 RPEILPAKQ------HEINKLLSKRY------VNQEDFTNFPYDVNPWTNINNAMGPW-- 274
                  K+       +I KL+S          +     NFPYD+    NI   MG    
Sbjct: 241 NLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300

Query: 275 YLWLWPWSKPPTIGTSFAK-NELFFYDPNSS---IEDMLMSLPWPPDGLTHHSRALGSGS 330
             W  PW  P T   S+ K NE   +D N +   I+DML+ LPWP +             
Sbjct: 301 LSWFNPWYTPLT--ASYNKINEFAIWDDNETHDNIKDMLLCLPWPLN------------Y 346

Query: 331 SIETIVSGGEQVIRDKSVDLRDRLGRNSWYNDWGEDLSDFGVD 373
           S  +    GE V++                ND+GE L DFGVD
Sbjct: 347 SNNSTFQDGELVVKS---------------NDYGETLQDFGVD 374

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 70/146 (47%), Gaps = 9/146 (6%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           +  + F    +     C+ C V+KP+R HHC  C++C+L MDHHCPW   CVG  N  +F
Sbjct: 90  LAQRSFTLKHDGRFRVCRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYF 149

Query: 124 MRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTP--MDAFVLLTV 181
           ++FL   I++T              +       +    +EII I ++    +   V LTV
Sbjct: 150 VQFL---IYTTVYAILVMTYTSFQIYDWFKNELYE---TEIIKIRLLMVWILSVAVFLTV 203

Query: 182 SSLLGRCIYNQCLHGMTQIESWEMDR 207
           +   G  IY Q ++  T IE + + +
Sbjct: 204 TCFTGFSIY-QTINNRTTIEMYTLRK 228

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           I  + F    +  +  C+ C+V+KP+R HHC TC++C+L MDHHCPW   C+G  N  +F
Sbjct: 85  IAKRSFTLKKDGRYRLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYF 144

Query: 124 MRFLFW 129
           ++FL +
Sbjct: 145 VQFLIY 150

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 27/149 (18%)

Query: 12  VAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYTNPGIPPKDFK- 70
           V IP  L ++  + +H    S++      +F+    T+ +VS+     T+PG+ P++   
Sbjct: 81  VTIPMVLFSI--FETHRLWYSDYGYKVLVVFFYYFWTLCFVSFIKTATTDPGVLPRNVHV 138

Query: 71  PSAE-------EWHN-----------------YCKKCRVYKPERAHHCKTCNQCVLAMDH 106
           PS E       E++N                 YC  CR+++P RA HC TC  C++  DH
Sbjct: 139 PSVENDYEIPQEYYNMITLPTGNPLIANIEVKYCTTCRIWRPPRASHCSTCEACIITHDH 198

Query: 107 HCPWTLNCVGHSNFPHFMRFLFWVIFSTA 135
           HC W  NC+G  N+ +F  FL   + +TA
Sbjct: 199 HCKWVNNCIGQRNYHYFFTFLVSCVIATA 227

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           +  K +       +  C+ C+V+KP+R HHC TCN+C+L MDHHCPW   C+G  N   F
Sbjct: 93  LTKKSYTMKRNGRYRLCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFF 152

Query: 124 MRFLFW 129
           ++FL +
Sbjct: 153 IQFLIY 158

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           C+ C V+KP+R+HHC TCN+CVL MDHHCPW   C+G  N   F++FL +
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIY 159

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           C+ C  +KP+R HHC +CN+C+L MDHHCPW   C+G  N  +F++FLF+
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFY 155

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 59/120 (49%), Gaps = 25/120 (20%)

Query: 41  IFYQTCQTMIWVSYYLAIYTNPGIPPKDFK--------PSAEEWHN-------------- 78
           IF+     ++ +S+     ++PG+ P++           + +E++N              
Sbjct: 111 IFFYYFWAIMLISFIRTATSDPGVLPRNIHLGQLQNNYQTPQEYYNLITLPTHSSVLEDI 170

Query: 79  ---YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTA 135
              YC+ CR+++P R  HC TCN CV+  DHHC W  NCVG  N+  F+ FL   IFS+ 
Sbjct: 171 TIKYCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSV 230

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           CK C  +KP+R HHC TCN CVL MDHHCPW   CVG+ N   F++FL +
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIY 155

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 1/56 (1%)

Query: 79  YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW-VIFS 133
           +C+ C V+KP+R HHC  C +C L MDHHCPW  +CVG++N  +F++FL +  +FS
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFS 160

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 37/51 (72%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWV 130
           C+ C V+KP+R HHC  CN+C+L MDHHCPW  +CVG  N  +F++FL + 
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYA 158

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           C+ C+V+KP+R+HHC +CN+C L MDHHCPW  +C+G  N   F++FL +
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY 154

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 37/51 (72%)

Query: 79  YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           +C+ C V+KP+R HHC  CN+C L MDHHCPW  +CVG+ N  +F+ FL +
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLY 182

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 62/129 (48%), Gaps = 7/129 (5%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTAXXXX 139
           C+ CR +KP+R HHC +C++C+L MDHHCPW   CVG  N   F++FL   +++TA    
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFL---LYTTAYAIF 159

Query: 140 XXXXXXXXXWS-IRHTAFHHRSTSEIIFICIMTPMDAFVLLTVSSLLGRCIYNQCLHGMT 198
                    +    +  F     S  +    +  +  F+ +T+ S       +Q L   T
Sbjct: 160 VLSMTSVQLYRWFYNDKFQEELISGYLLFLWIFSLVVFIAMTLFSAFS---VSQVLKNQT 216

Query: 199 QIESWEMDR 207
            IE + + R
Sbjct: 217 TIEMYGVQR 225

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           C+ C V+KP+R HHC +C++C+L MDHHCPW   C+G  N  +F+ FL +
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIY 155

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (47%), Gaps = 25/119 (21%)

Query: 41  IFYQTCQTMIWVSYYLAIYTNPGIPPKDFK--------------------PSAEEWHN-- 78
           IF+     + ++++     ++PG+ P++                      P+    HN  
Sbjct: 111 IFFYYFWVVTFIAFIRTATSDPGVLPRNIHLGQLQNNYQIPQEYYNLITLPTHPSVHNDI 170

Query: 79  ---YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFST 134
              YC  CR+++P R+ HC TCN CV+  DHHC W  NC+G  N+  F+ FL   IFS+
Sbjct: 171 TIKYCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSS 229

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 110/260 (42%), Gaps = 57/260 (21%)

Query: 8   RWLGVAIPAFLVALIGYGSHYFILSNFLS---WNEQIFYQTCQTMIW-------VSYYLA 57
           R +  A P  LV L    S   + S F +   W+ +  Y+    + +       +S+   
Sbjct: 55  RAVKTARPFSLVVLFLILSPMVLFSVFEAHRLWHTRYGYKALVVLFYYAWAWSLLSFTKT 114

Query: 58  IYTNPGIPPKDF---KPSAEEWHN--------------------YCKKCRVYKPERAHHC 94
             ++PG+ P++    K + +E+ N                    YC  C++++P RA HC
Sbjct: 115 ATSDPGVLPRNIHMHKDTPQEYFNNVTLPYGAGGSAGNASVTLKYCHTCKIWRPPRASHC 174

Query: 95  KTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTAXXXXXXXXXXXXXWSIRHT 154
             C  CVL  DHHC W  NCVG  N+ +F+ FL     + A               I + 
Sbjct: 175 SVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALL-------------IANC 221

Query: 155 AFH-HRSTSEIIFICIMTPMDAFVLLTVSSLLGRCIYNQCLHG----MTQIESWEMDRIQ 209
           A H HR+  E I +    P+   VLL V + +  C+Y   L G    M+  +    + ++
Sbjct: 222 ALHLHRALHEGIRVS-HRPLPVAVLLCVYAAV-LCVYPVILLGYHVAMSGTQQTTREYLR 279

Query: 210 SLHYKNRLLAQVIDRLVERR 229
           S+ ++N     V+ R+  RR
Sbjct: 280 SIGFRN----PVMHRIRRRR 295

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%)

Query: 79  YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           +C+ C ++KP+R HHC  CN+C L MDHHCPW  +CVG  N   F++FL
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFL 152

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (71%)

Query: 77  HNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           + YC  C V+KP+R+HHC +CN+C L  DHHCPW  +C+G +N   F++FL +
Sbjct: 107 YRYCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMY 159

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 73/158 (46%), Gaps = 20/158 (12%)

Query: 65  PPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFM 124
           P  +  P ++    YC  CR+++P RA HC TC  CV+  DHHC W  NCVG  N+ +F+
Sbjct: 166 PKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFI 225

Query: 125 RFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFH-HRSTSEIIFICIMTPMDAFVLLTVSS 183
            FL   + +               + I + + H  R +S++    ++       +L  + 
Sbjct: 226 IFLIGTVLAE-------------LFLIANCSIHIARRSSQVPVTILLLVYACLSILYPAI 272

Query: 184 LLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQV 221
           LLG  ++      MT  +    + ++ +H KN +  ++
Sbjct: 273 LLGYHVF------MTGTQQTTREFLKQVHTKNPVFTKI 304

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128
           CK C+V KP R+ HC  C+QC+L  DHHC W  NC+G  NF +F  FLF
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLF 185

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 71/162 (43%), Gaps = 37/162 (22%)

Query: 6   KNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQ-------IFYQTCQTMIWVSYYLAI 58
           K  WLGV     L+A++     + I      W+ Q       IF+     +   S+    
Sbjct: 74  KPLWLGV-----LLAIVCPMVLFSIFEAHKLWHTQNGYKVLVIFFYYFWVITLASFIRTA 128

Query: 59  YTNPGIPPKDFKPSA--------EEWHN-----------------YCKKCRVYKPERAHH 93
            ++PG+ P++   S         +E++N                 YC  CR+++P R+ H
Sbjct: 129 TSDPGVLPRNIHLSQLRNNYQIPQEYYNLITLPTHSSISKDITIKYCPSCRIWRPPRSSH 188

Query: 94  CKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTA 135
           C TCN CV+  DHHC W  NC+G  N+  F+ FL   I S+ 
Sbjct: 189 CSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSV 230

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFS 133
            YC  CR+++P RA HC TCN C++  DHHC W  NCVG  N+ +F+ F++  + +
Sbjct: 187 KYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLT 242

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (66%)

Query: 77  HNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWV 130
           H YC KC+V+KP+R HHC  C++C L  DHHC W   C+G++N   F+ FL + 
Sbjct: 168 HRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYA 221

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 63/124 (50%), Gaps = 12/124 (9%)

Query: 12  VAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYTNPGIPP----- 66
           V++  FLVA IG  ++Y ++         + Y T    I V    A+ +   +PP     
Sbjct: 41  VSVDVFLVA-IGLYTYYKVI--ITGPGSPLDYDT----IKVYDMQAVESGAELPPEFLSR 93

Query: 67  KDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRF 126
           +      +     C+ C V+KP+R HHC  C++C+L MDHHCPW   C+G +N   F+++
Sbjct: 94  RSITTKRDGRFRVCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQY 153

Query: 127 LFWV 130
           L + 
Sbjct: 154 LLYA 157

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFST 134
            YC+ CR+++P R+ HC TCN CV+  DHHC W  NC+G  N+  F+ FL   + S+
Sbjct: 173 KYCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISS 229

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIF 132
           C+ C V+KP+R HHC +C+ C+L MDHHCPW   C G  N   F++FL +  F
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTF 158

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFST 134
            YC  CR+++P RA HC TC  C+L  DHHC W  NC+G  N+ +F+ FL   I S+
Sbjct: 179 KYCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSS 235

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 70.9 bits (172), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIF 132
           C+ C V+KP+R HHC +C+ C+L MDHHCPW   C G  N   F++FL +  F
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTTF 158

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFST 134
            YC  CR+++P RA HC TC  CVL  DHHC W  NC+G  N+ +F+ FL     +T
Sbjct: 176 KYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLAT 232

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 59  YTNPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHS 118
           Y N  I P    P+A     YC+ CR+++P R+ HC  C+ CVL+ DHHC W  NC+G  
Sbjct: 154 YYNYAILPTK-NPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKR 212

Query: 119 NFPHFMRFL 127
           N+  F+ FL
Sbjct: 213 NYRFFLEFL 221

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFST 134
            YC  CR+++P RA HC  C+ C+L+ DHHC W  NC+G  N  +F+ FLF  + S+
Sbjct: 185 KYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSS 241

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 33/54 (61%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFS 133
           C  CR+ KP R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FL   IFS
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFS 189

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%)

Query: 79  YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           YCK CR+++P R+ HC  C  CVL  DHHC W  NCVG  N+ +F+ FL
Sbjct: 183 YCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFL 231

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (70%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           C+ C++ KP R+ HC  CNQCVLA+DHHC W  NCVG  N+ +F  FL
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFL 182

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (51%), Gaps = 24/102 (23%)

Query: 57  AIYTNPGIPPKDFKPSA--------EEWHN----------------YCKKCRVYKPERAH 92
           A+ ++PGI PK+             +E++N                YC+ CR+++P R+ 
Sbjct: 149 AMTSDPGILPKNIHIPKLANNFQLPQEYYNLIRLPIKDESQYVEITYCRTCRIWRPPRSS 208

Query: 93  HCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFST 134
           HC  C+ CV+++DHHC W  NCVG  N+ +F+ FL   I + 
Sbjct: 209 HCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTV 250

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 54/116 (46%), Gaps = 30/116 (25%)

Query: 41  IFYQTCQTMIWVSYYLAIYTNPGIPPKDFK-------------PSAEEWHN--------- 78
           +FY  C  M  V++  +  T PG+ P++                S +E++N         
Sbjct: 119 VFYY-CWAMAAVNFVQSSTTGPGVLPRNIHVPKVGGPPGQTPVQSPQEYYNIVTLPTAQR 177

Query: 79  -------YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
                  YC  C++++P RA HC+ C  CV   DHHC W  NCVG  N+ +F+ FL
Sbjct: 178 SAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFL 233

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           C+ C V+KP+R HHC +C+ CVL MDHHCPW   C G  N   F++FL +
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY 155

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 33/56 (58%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTA 135
           C  CR  K  R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FLF  IFS +
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMS 191

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (62%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFS 133
           C+ C+ YKP R+ HC  C++CVL  DHHC W  NCVG  N+ +F  FL    FS
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFS 190

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 2/65 (3%)

Query: 65  PPKDFKPSAEEWH--NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPH 122
           P +DF+  +  ++   +C  CR+ KP R+ HC  CN+CVL  DHHC W  NC+G  N+ +
Sbjct: 120 PYQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQY 179

Query: 123 FMRFL 127
           F  FL
Sbjct: 180 FYTFL 184

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           C+ C V+KP+R HHC +C+ C+L MDHHCPW   C G  N   F++FL +
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMY 155

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTA 135
           C  CR+ KP R+ HC  CN+C+L  DHHC W  NC+G  N+  F  FL   I S +
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMS 191

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%)

Query: 79  YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           YC+ CR+++P RA HC  C  CV+  DHHC W  NCVG  N+ +F+ FL
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFL 225

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
            YC  CR+++P RA HC  C  C+L  DHHC W  NC+G  N+ +F+ FL
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFL 220

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFS 133
           C  C + KP R+ HC  CN+C+L  DHHC W  NC+G  N+  F  FL   IFS
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFS 189

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 24/118 (20%)

Query: 41  IFYQTCQTMIWVSYYLAIYTNPGIPPKDFKPSA--------EEWHN-------------- 78
           IF+       + S+     ++PG+ P++   S         +E++N              
Sbjct: 154 IFFYYTWGTCFTSFIKTATSDPGVLPRNIHLSQISNNFKIPQEYYNEVTLPTGNPESTIN 213

Query: 79  --YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFST 134
             YC  CR+++P R+ HC  C  C++  DHHC W  NC+G  N+  F+ FL    F++
Sbjct: 214 IKYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTS 271

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 59/136 (43%), Gaps = 16/136 (11%)

Query: 8   RWLGVAIPAFLVALIGYGSHYFI------LSNFLSWNEQ-----IFYQTCQTMIWVSYYL 56
           RW    +PAF ++L  Y     I      + N L   E+     +       + W+S  +
Sbjct: 50  RWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGNRLLSVEKLCIIPVLVVATPVLGWLSMTV 109

Query: 57  AIYTNPGIPPKDFKPSAEEWHNY-----CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWT 111
              T+ G  P   +    ++  Y     C+ C + KP R+ HC  C +CVL  DHHC W 
Sbjct: 110 KAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWV 169

Query: 112 LNCVGHSNFPHFMRFL 127
            NC+G  N+  F  FL
Sbjct: 170 NNCIGKGNYQFFYAFL 185

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128
           C+ C   KP R+ HC  CN+C+L +DHHC W  NC+G  N+ +F  FL 
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 59  YTNPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHS 118
           YTN    P   K  + E   YC  C +++P RA HC  C  C+   DHHC W  NCVG+ 
Sbjct: 170 YTNTIRLPVANKNHSIEL-KYCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNR 228

Query: 119 NFPHFMRFLFWVIFST 134
           N+ +F+ FL   I S+
Sbjct: 229 NYRYFIIFLVGAILSS 244

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 31/48 (64%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           C+ C + KP R+ HC+ CN C+L  DHHC W  NC+G  N+ +F  FL
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFL 186

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 29/48 (60%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           C+ C+  KP R+ HC  CN C+   DHHC W  NCVG  N+ +F  FL
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL 183

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128
           N C  C + KP R+ HC  C  C+L  DHHC W  NC+G  N+ +F  FL 
Sbjct: 137 NVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLL 187

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 60/139 (43%), Gaps = 12/139 (8%)

Query: 8   RWLGVAIPAFLVALIGYGSHYF-------ILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60
           RW   AIPAF +++  Y +  F       I S        +      +   ++  L I+ 
Sbjct: 49  RWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTIWI 108

Query: 61  NPGIPPKDFKPSAEE---WHN--YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCV 115
            P          A +   +H+   C+ C++ K  R  HC  C+QCV   DHHC W  NC+
Sbjct: 109 KPKSTYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCI 168

Query: 116 GHSNFPHFMRFLFWVIFST 134
           G  N+ +F  FL   +F T
Sbjct: 169 GRGNYQYFYLFLVSNVFLT 187

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           CK CR  KP R+ HC  C++C+L  DHHC W  NC+G  N+  F  F+
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFI 182

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128
           C+ CR+ K  R+ HC  C +C+L  DHHC W  NC+G  N+ +F  FL 
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 27/44 (61%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           C+ CRV KP R+ HC  C +CV   DHHC W  NCVG  N+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 56  LAIYTNPGIPPK--DFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLN 113
           L +   P   P    F PSA      C+ C+  K  R+ HC  C +C+   DHHC W  N
Sbjct: 108 LGLQAGPQFQPDYIIFHPSAV-----CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINN 162

Query: 114 CVGHSNFPHFMRFL 127
           CVG+ N+ +F  FL
Sbjct: 163 CVGYGNYEYFYSFL 176

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTA 135
           C+ C++ K  R+ HC  C +C    DHHC W  NC+G  N+ +F  FL   +F T 
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTV 186

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 40/88 (45%), Gaps = 12/88 (13%)

Query: 52  VSYYLAIYTNP---GIPPKDFKPSAEEW---------HNYCKKCRVYKPERAHHCKTCNQ 99
           VS  L ++T P   G   +   PS  +W         +  C+ C   K  R+ HC  C +
Sbjct: 99  VSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHCSICRR 158

Query: 100 CVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           C+   DHHC W   C+G  NF +F  FL
Sbjct: 159 CIQLADHHCIWFNTCIGRGNFFYFYVFL 186

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 91/223 (40%), Gaps = 25/223 (11%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           IPPK ++     +  +C  C+  K ER+HH      C+   DH+C W    +G  N+  F
Sbjct: 115 IPPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPF 174

Query: 124 MRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLTVS- 182
           ++F  +  FS+                IR+   HH + +        +P++A V LT++ 
Sbjct: 175 VQFTGY--FSSLLLIMWVSICVF----IRNITQHHHNHN--------SPLNANVFLTLAF 220

Query: 183 SLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEINK 242
           ++ G       L   + + S      Q+  Y   ++         R+   +     E NK
Sbjct: 221 AIFGW------LFTTSMLASNIFYMCQNKTYLEAIMDSKRKNFGTRK---IFCYYSEANK 271

Query: 243 LLSKRYVNQEDFTNFPYDVNPWTNINNAMGP-WYLWLWPWSKP 284
           L       + +F +F      + NI + MGP   +WL P+ KP
Sbjct: 272 LRFVVEFERTEFHSFWSKKTIFANIKDFMGPNMLMWLIPFGKP 314

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           +P K ++  +  +  +C  C   K  R+HH    N C+   DH+C W    +G  N+  F
Sbjct: 103 VPAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQF 162

Query: 124 MRFLFWVIFS 133
           + FLF+   S
Sbjct: 163 VIFLFYCTVS 172

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 85/224 (37%), Gaps = 27/224 (12%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           IPPK ++     +  +C  C+  K ER HH      CV   DH+C W    +G  N+  F
Sbjct: 116 IPPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLF 175

Query: 124 MRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMTPMDAFV--LLTV 181
           ++F+ +  FS               ++   T  HH     I    ++T   A +  LLT 
Sbjct: 176 VQFVAY--FSI---LLLIMWASICVYTKEITQRHHSQGPRINVNVMLTLAFAILGWLLTT 230

Query: 182 SSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEIN 241
           S+L     Y      M+Q              K  L A +  +  +     + +   E N
Sbjct: 231 STLGSAIFY------MSQ-------------NKTSLEAIMDSKRKKFGTRKIFSYYSESN 271

Query: 242 KLLSKRYVNQEDFTNFPYDVNPWTNINNAMGP-WYLWLWPWSKP 284
           KL      ++ +F  F        N+ + MGP   +WL P  KP
Sbjct: 272 KLRFVVEFDRSEFHAFWSKKTILANVKDFMGPNMLMWLIPLGKP 315

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 65  PPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFM 124
           PP+ ++   + +  +C  C+  K  R HH  T   C+   DH+C W    VG  N+  F+
Sbjct: 117 PPRIYQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFV 176

Query: 125 RFLFW-------VIFSTA 135
           +F F+       VI STA
Sbjct: 177 QFAFYFWAFAIFVIVSTA 194

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%)

Query: 65  PPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFM 124
           PPK ++     +  +C  C+  K  R+HH K   +C+L  DH+C W    +  +N+  F+
Sbjct: 103 PPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFL 162

Query: 125 RFLFW 129
           +++ W
Sbjct: 163 QYVGW 167

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%)

Query: 65  PPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFM 124
           PP+ ++   + +  +C  C+  K  R HH  T   C+   DH+C W    VG  N+  F+
Sbjct: 110 PPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFV 169

Query: 125 RFLFW 129
           +F F+
Sbjct: 170 QFAFY 174

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           IPP  ++   + +  +C  C+  K ER+HH +    CV   DH+C W    +G  N+  F
Sbjct: 111 IPPDIYQCDPQGYPMWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLF 170

Query: 124 MRFLFW 129
           M+++ +
Sbjct: 171 MQYVMY 176

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%)

Query: 65  PPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFM 124
           PP  ++     +  +C  C+  K  R HH K    C+   DHHC W    +G SN+  F 
Sbjct: 109 PPVFYECDINGYPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFT 168

Query: 125 RFLFW 129
           +F+F+
Sbjct: 169 QFVFY 173

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           +PPK ++     +  +C +C+  K ER HH      C+   DH+C W    +G  N+  F
Sbjct: 115 VPPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLF 174

Query: 124 MRFLFWVIFST 134
           ++F  +  FST
Sbjct: 175 VQFAAY--FST 183

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%)

Query: 65  PPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFM 124
           PP  ++   + +  +C  C+  K ER HH  T   CV   DH+C W    VG  N+  F+
Sbjct: 112 PPDIYQCDPQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFI 171

Query: 125 RFLFWVIF 132
           +F  +  F
Sbjct: 172 QFSMYFFF 179

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 59  YTNPGI--PPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVG 116
           +T+P +  PP  ++     +  +C  C+  K  R HH      CV   DH+C W    +G
Sbjct: 103 FTSPQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIG 162

Query: 117 HSNFPHFMRFLFWV 130
             N+  F++FL ++
Sbjct: 163 AGNYLLFIQFLVYM 176

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%)

Query: 65  PPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFM 124
           PP  ++     +  +C  C+  K ER HH +    C+   DH+C W    +G +N+  F+
Sbjct: 102 PPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFI 161

Query: 125 RFLFW 129
           +++F+
Sbjct: 162 QYVFY 166

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 43/108 (39%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           +PP  ++     +  +C +C+  K ER HH      CV   DH+C W    +G  N+  F
Sbjct: 107 LPPITYQCDPHGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLF 166

Query: 124 MRFLFWVIFSTAXXXXXXXXXXXXXWSIRHTAFHHRSTSEIIFICIMT 171
           ++F+ +   + +                R    HH   + +I I +  
Sbjct: 167 LQFVAYYAINLSIIWVSIVSYIHMIIRKRPNQPHHHFNTNLIIILVFA 214

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           IPP+ ++     +  +C  C+  K ER HH      CV   DH+C W    +G  N+  F
Sbjct: 121 IPPRCYQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLF 180

Query: 124 MRFLFW 129
           ++F+ +
Sbjct: 181 VQFVTY 186

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 64  IPPKDFKPSAEEWHN-YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPH 122
           I P D  P  E  +  +C  C+  K  R HH      CV   DH+C W    +G  N+  
Sbjct: 111 IAPPDIYPCDERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKL 170

Query: 123 FMRFLFWV 130
           F++F F++
Sbjct: 171 FVQFTFYL 178

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           +PP  ++        +C  C   K ERAHH      CV   DH C W    +G  N+  F
Sbjct: 111 VPPVCYQSCPRGNPIWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFF 170

Query: 124 MRFLFWV 130
           ++F+ ++
Sbjct: 171 IQFVMYM 177

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 113/297 (38%), Gaps = 82/297 (27%)

Query: 79  YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTAXXX 138
           +C  C+  K ERAHH +    CV   DH C +  + +G  N+  F+++    +F T    
Sbjct: 126 WCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQY---CVFMTIWLA 182

Query: 139 XXXXXXXXXXWSIRHTAFHHRS--TSEIIFICIMTPMDAFVLLTVSSLLGRCIYNQCLHG 196
                      SI      H S     +I I I+T +     +TV+SLL           
Sbjct: 183 IIWTSIVAYIRSITRDYRGHGSHLNGNLIAILILTTL---FWITVTSLL----------- 228

Query: 197 MTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEINKLLSKRYVNQEDFTN 256
           +TQ+         +   KN+   +V++R   RR      K     K+    Y N +D   
Sbjct: 229 LTQL---------NCIVKNKTSIEVMER---RR------KAFSTRKMFC--YYNPDDGCR 268

Query: 257 FPYDVNP------------WTNINNAMGP-WYLWLWPWSKPPTIGTSFAKNELFFYDPNS 303
           +  ++N             W N   ++G   ++W+ PW      GTS  K   F  DP  
Sbjct: 269 YVVELNKKEYESCWSKDSWWANAVESLGSNIFMWVIPW------GTSVPK---FKPDPEK 319

Query: 304 SIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDL-RDRLGRNSW 359
           +  +                      S+IE ++   ++ + +K+++L R ++  N +
Sbjct: 320 NGRN--------------------DKSTIEAVLGPYKETVGNKTIELIRKKISNNEY 356

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 64  IPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHF 123
           +PP  ++   + +  +C  C+  K  R HH      CV  +DH+C W    +G  N+  F
Sbjct: 106 LPPDVYQCDTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLF 165

Query: 124 MRFLF 128
            +FL 
Sbjct: 166 NQFLM 170

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 13/93 (13%)

Query: 48  TMIWVSYYLAIYTNPGIPPKD-------------FKPSAEEWHNYCKKCRVYKPERAHHC 94
           T++ + Y   I+++PG  P++              K  +   H +C K  + KP R    
Sbjct: 360 TLLLLCYGRLIFSDPGCIPEETDTDLIRNDIEKLIKLGSFNCHTFCLKTWIRKPVRCSLS 419

Query: 95  KTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           K   Q V   DH+C W  N VG  N   ++ FL
Sbjct: 420 KLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFL 452

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 61/136 (44%), Gaps = 23/136 (16%)

Query: 18  LVALIGYGSHYFILSNFLS--WNEQIFYQTCQTMIWVS--------YYLAIYTNPGI--P 65
           L+A + YGS  ++   FL   +   IF +   ++++V+        ++  +Y++PG+  P
Sbjct: 375 LMAGVFYGSLLWVSIVFLLVLFPTVIFEEPMLSILFVAVLGCVHLLFFQLVYSDPGVLEP 434

Query: 66  PKDF-----------KPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNC 114
             DF           K    +  N+C +    KP R       ++ VL  DH+CPW  N 
Sbjct: 435 ETDFNEIRNKISELLKIGKFDTKNFCIETWQRKPLRCKFSSFHSRLVLRFDHYCPWVYND 494

Query: 115 VGHSNFPHFMRFLFWV 130
           VG  N   FM ++  V
Sbjct: 495 VGLLNHKKFMYYVMSV 510

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 15/98 (15%)

Query: 49  MIWVSYYLA--IYTNPGIPPKDFKPSAE-------------EWHNYCKKCRVYKPERAHH 93
           +I +SY     + ++PG  P +F   +              + +N+C +  V KP R+ +
Sbjct: 433 IISLSYLFVNLVRSDPGTKPAEFNHDSIRETITNLMLIGKFDTNNFCIESSVRKPLRSRY 492

Query: 94  CKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVI 131
               +  V   DH CPW  N +G  N   F+ F+  ++
Sbjct: 493 SYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMV 530

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%)

Query: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120
           N  + P  ++     +  +C  C+  K  R  H      CV   DH+C W    +G  N+
Sbjct: 97  NTTVAPNCYQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNY 156

Query: 121 PHFMRFLFW 129
             F++F+F+
Sbjct: 157 RLFVQFVFY 165

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           N+C +    KP R+      N  V   DH+CPW  N VG  N   FM F+
Sbjct: 469 NFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 15/97 (15%)

Query: 49  MIWVSYYLAIY--TNPGIPP------------KDFKPSAE-EWHNYCKKCRVYKPERAHH 93
           ++ VSY L +   ++PG  P            KD   + + +  N+C +  V KP R+  
Sbjct: 418 ILAVSYLLVVLVKSDPGRIPTEKNTQVIRETIKDLLATGKFDSKNFCIETWVKKPLRSRF 477

Query: 94  CKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWV 130
               N  V   DH+CPW  N +G  N   F+  +  V
Sbjct: 478 SSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLV 514

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 16/91 (17%)

Query: 54  YYL---AIYTNPGIPP-----KDFKPSAEEW--------HNYCKKCRVYKPERAHHCKTC 97
           YYL    I+++PG  P     ++ + + +E          N+C +  + KP R+H     
Sbjct: 415 YYLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLN 474

Query: 98  NQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128
              V   DH CPW  N +G  N  +FM F+ 
Sbjct: 475 THNVARFDHFCPWIYNDIGLKNHKNFMWFIL 505

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128
           N+C +    KP R+ +    N  V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 462 NFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           N+C +  + KP R+      N  V   DH+CPW  N VG  N   F+ F+
Sbjct: 470 NFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWV 130
           N+C +    KP R+ +    N  V   DH CPW  N VG  N  +F+ F+  V
Sbjct: 472 NFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLV 524

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           N+C +    KP R+      N  V   DH+CPW  N VG  N   F+ F+
Sbjct: 470 NFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%)

Query: 75  EWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWV 130
           +  N+C +  + KP R+      N  V   DH+CPW  N +G  N   F+ F+  V
Sbjct: 458 DTRNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISV 513

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
           ++C +    KP R+ +    N  V   DH+CPW  N VG  N   F+ F+
Sbjct: 470 SFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 15/98 (15%)

Query: 46  CQTMIWVSY--YLAIYTNPGIPPKD-------------FKPSAEEWHNYCKKCRVYKPER 90
           C  + +V Y  +L  +++PG    +              K    +  ++C +  V KP R
Sbjct: 407 CAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLR 466

Query: 91  AHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128
           + +    +  +L  DH+CPW  N VG  N   F+ F+ 
Sbjct: 467 SKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%)

Query: 77  HNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWV 130
           +N+C +    KP R+ +       V   +H+CPW  N +G  N   FM F F V
Sbjct: 428 NNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSV 481

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 79  YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFW 129
           +C +  V KP R+         V   DH+CPW  N +G  N   F+ F+F+
Sbjct: 467 FCLETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFF 517

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 26/59 (44%)

Query: 69  FKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127
            K    +  ++C +  + KP R+         +   DH+CPW  N VG  N   F+ F+
Sbjct: 451 LKVGKYDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFV 509

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%)

Query: 75  EWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVI 131
           +  ++C      KP R+   +     ++  DH CPW  N VG  N   F+ FL  ++
Sbjct: 449 DTRHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLV 505

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%)

Query: 77  HNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWV 130
            N+C +    KP R+ +       V   DH+CPW  N VG  N   F+ F   V
Sbjct: 445 ENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTV 498

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 15/96 (15%)

Query: 50  IWVSYYLAIY--TNPG-IP----PKDFKPSAEEW--------HNYCKKCRVYKPERAHHC 94
           I VS  L I   ++PG IP    PK+ + +  E          ++C    V  P R+ + 
Sbjct: 411 ITVSSLLVILMQSDPGSIPASSDPKEIRATMSELLRIGKFDAKHFCIHSWVRIPLRSKYK 470

Query: 95  KTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWV 130
              N  +   DH+CPW  N +G  N   F+ F+ ++
Sbjct: 471 TARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFL 506

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 13/84 (15%)

Query: 58  IYTNPGIPPKD-----FKPSAEEWHN--------YCKKCRVYKPERAHHCKTCNQCVLAM 104
           + ++PG+ P++      K + +E  N        +C    V KP R+         V   
Sbjct: 417 VRSDPGLIPEETDHSKVKETIKELLNVGKFDAKHFCISTWVRKPIRSKFSNFSRALVTRF 476

Query: 105 DHHCPWTLNCVGHSNFPHFMRFLF 128
           DH CPW  N +G  N   F+ F+ 
Sbjct: 477 DHFCPWIYNDIGLRNHKTFLFFIL 500

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRF 126
           ++C    +  P RA + +  +  +L  DH+CPW  N +G  N   F+ F
Sbjct: 446 HFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 22/54 (40%)

Query: 77  HNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWV 130
            N+C +    KP R+         V   DH CPW  N +G  N   F+ F   V
Sbjct: 442 ENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALTV 495

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 78  NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTA 135
           ++C    +  P R+ + +     + A DH CPW  N +G  N  H + ++F V+   +
Sbjct: 466 HFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLN--HKLFYMFVVLLEIS 521

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 19/43 (44%)

Query: 77  HNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSN 119
            N+C +    K  R+ +       V   DH+CPW  N +G  N
Sbjct: 439 ENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN 481

>KAFR0J01400 Chr10 complement(255158..256555) [1398 bp, 465 aa] {ON}
           Anc_2.279 YIL097W
          Length = 465

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 209 QSLHYKNRLLA---QVIDRLVERRPEILPAKQHEINKLLSKRYVNQE 252
           QS H    LL    ++++ L+ER   +L  K HE+N LLSK  ++ +
Sbjct: 19  QSFHIPYELLTRNFKLLNELIERESSLLNKKFHELNSLLSKNAISHD 65

>YML049C Chr13 complement(174220..178305) [4086 bp, 1361 aa] {ON}
           RSE1Protein involved in pre-mRNA splicing; component of
           the pre-spliceosome; associates with U2 snRNA; involved
           in ER to Golgi transport
          Length = 1361

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 62/157 (39%), Gaps = 24/157 (15%)

Query: 202 SWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEINKLLSKRYVNQEDFTNFPYDV 261
           S ++  +  L  +  L   +  ++V   P  +  K    NK+++    N  +++N     
Sbjct: 469 SIKLQNLSILSQQLNLNPSIKSQIVSDSPLSIATKHFTNNKIIT--LTNAVNYSNL---- 522

Query: 262 NPWTNINNAMGPWYLWLWPWSKPPTIG-------TSFAKNELFFYDPNSSIEDMLMSLPW 314
                I+ ++ P    LW    P T G        +F K  +     N S+E++      
Sbjct: 523 -----ISTSLPPNATKLWLIPDPATTGDNNTLLFITFPKKTMILQIDNESMEEL------ 571

Query: 315 PPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLR 351
            PD  T  +  L   ++I T + G   +I+  + +LR
Sbjct: 572 TPDEATRSAFKLSQDTTIHTCLMGSHSIIQVCTAELR 608

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.472 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,367,412
Number of extensions: 1776574
Number of successful extensions: 6024
Number of sequences better than 10.0: 127
Number of HSP's gapped: 6046
Number of HSP's successfully gapped: 127
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)