Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C06182g6.29ON1519151966350.0
ACL004W6.29ON137797030130.0
SAKL0E01540g6.29ON141595429460.0
Ecym_30336.29ON147496229340.0
ZYRO0C07524g6.29ON1670100729020.0
TDEL0G044006.29ON149096328730.0
KNAG0F029206.29ON1492112328340.0
Kwal_56.224626.29ON154197327990.0
Kpol_1037.226.29ON149697627920.0
KLTH0C10956g6.29ON143394727870.0
NCAS0D021306.29ON143499527110.0
KAFR0A051206.29ON1479101727080.0
TPHA0J004006.29ON151288127040.0
YOL004W (SIN3)6.29ON153694326910.0
Skud_15.1586.29ON155596126720.0
Smik_15.1666.29ON156696426670.0
Suva_15.1716.29ON156195426600.0
TBLA0E031606.29ON173985525930.0
NDAI0C026606.29ON165786525910.0
CAGL0E02475g6.29ON149392925480.0
CAGL0J11594g6.29ON9377988931e-101
Kpol_1064.538.403ON48972801.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06182g
         (1519 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  2560   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1165   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1139   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1134   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1122   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1111   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1096   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1082   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1080   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1078   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1048   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1047   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1046   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1041   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1033   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1031   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1029   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1003   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1002   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...   986   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   348   e-101
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    35   1.3  

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 2560 bits (6635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1278/1519 (84%), Positives = 1278/1519 (84%)

Query: 1    MSAPWNXXXXXXXXXXXXXXXXXXXSTGMINGVQGQSENSPNLLPQLAPPAVNIQIKPEH 60
            MSAPWN                   STGMINGVQGQSENSPNLLPQLAPPAVNIQIKPEH
Sbjct: 1    MSAPWNQQPDGPQQQQQQQQQQIPPSTGMINGVQGQSENSPNLLPQLAPPAVNIQIKPEH 60

Query: 61   DQQQHHVTLPSISTIXXXXXXXXXXXXXXXXXXXNARXXXXXXXXXXXXXXGPLSGVSNR 120
            DQQQHHVTLPSISTI                   NAR              GPLSGVSNR
Sbjct: 61   DQQQHHVTLPSISTISGSNQPSQGQGQEQVQGQQNARSHSHSHSHVHPHIHGPLSGVSNR 120

Query: 121  MDNINLQNGGTPINSAAGSNGPVSTNSEGAIPTPSINNIVQQPDITHXXXXXXXXXGHNV 180
            MDNINLQNGGTPINSAAGSNGPVSTNSEGAIPTPSINNIVQQPDITH         GHNV
Sbjct: 121  MDNINLQNGGTPINSAAGSNGPVSTNSEGAIPTPSINNIVQQPDITHQQQQQQLLQGHNV 180

Query: 181  QVENAMTVGQDPLQQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQ 240
            QVENAMTVGQDPLQQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQ
Sbjct: 181  QVENAMTVGQDPLQQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQ 240

Query: 241  AIDTPGVIQRVTTLFQGFPNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAG 300
            AIDTPGVIQRVTTLFQGFPNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAG
Sbjct: 241  AIDTPGVIQRVTTLFQGFPNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAG 300

Query: 301  PPTQYQLAPVAGQNVENQNIEMQQQVSQPQFNNGXXXXXXXXXXXXXXXSATSAAMLVXX 360
            PPTQYQLAPVAGQNVENQNIEMQQQVSQPQFNNG               SATSAAMLV  
Sbjct: 301  PPTQYQLAPVAGQNVENQNIEMQQQVSQPQFNNGDQIQHQQLQDQLQNQSATSAAMLVSQ 360

Query: 361  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLENQFVNQKIVXXXXXXXXXXXXQQ 420
                                               LENQFVNQKIV            QQ
Sbjct: 361  PQSQTQPQQLHSQQSPQQQGQPPQRQAQQQPQPPQLENQFVNQKIVAAGGGMLGALPGQQ 420

Query: 421  KTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNX 480
            KTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNN 
Sbjct: 421  KTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNP 480

Query: 481  XXXXXXXXXXXXSSVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
                        SSVS                                            
Sbjct: 481  DLLDDFKKFLPDSSVSQQQQEQQQEPQQQQQDQQQEHQQDQEQQHHEQKQQPLPQDQNQQ 540

Query: 541  AMLPPQPYLQQNQSMQGQGFYPQSGVLMQPTNLPPLGNFSASGQASPAENSHMLPSMHQH 600
            AMLPPQPYLQQNQSMQGQGFYPQSGVLMQPTNLPPLGNFSASGQASPAENSHMLPSMHQH
Sbjct: 541  AMLPPQPYLQQNQSMQGQGFYPQSGVLMQPTNLPPLGNFSASGQASPAENSHMLPSMHQH 600

Query: 601  IAGGHVIPQHVVTQGMSNQDIPVSEMRSTMNGTYNQVEYIQGAPGYPQPLEGVQYMEAPM 660
            IAGGHVIPQHVVTQGMSNQDIPVSEMRSTMNGTYNQVEYIQGAPGYPQPLEGVQYMEAPM
Sbjct: 601  IAGGHVIPQHVVTQGMSNQDIPVSEMRSTMNGTYNQVEYIQGAPGYPQPLEGVQYMEAPM 660

Query: 661  ARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQ 720
            ARPEIDLDPSL            DAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQ
Sbjct: 661  ARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQ 720

Query: 721  DLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPS 780
            DLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPS
Sbjct: 721  DLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPS 780

Query: 781  YKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEER 840
            YKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEER
Sbjct: 781  YKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEER 840

Query: 841  HEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXX 900
            HEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTI            
Sbjct: 841  HEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKD 900

Query: 901  XGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLT 960
             GFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLT
Sbjct: 901  RGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLT 960

Query: 961  FKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFT 1020
            FKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFT
Sbjct: 961  FKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFT 1020

Query: 1021 FVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQXXXXXXXXXXXX 1080
            FVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQ            
Sbjct: 1021 FVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDS 1080

Query: 1081 XXXXXRTLSDEDSYLMKDILRRTKNAKTXXXXXXXXXXXXXXXXXDETELLAKEAAKPWL 1140
                 RTLSDEDSYLMKDILRRTKNAKT                 DETELLAKEAAKPWL
Sbjct: 1081 EKSNKRTLSDEDSYLMKDILRRTKNAKTSNSEENQNSSSVKSNEEDETELLAKEAAKPWL 1140

Query: 1141 LGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRK 1200
            LGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRK
Sbjct: 1141 LGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRK 1200

Query: 1201 IVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKA 1260
            IVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKA
Sbjct: 1201 IVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKA 1260

Query: 1261 FKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGE 1320
            FKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGE
Sbjct: 1261 FKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGE 1320

Query: 1321 SENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDIS 1380
            SENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDIS
Sbjct: 1321 SENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDIS 1380

Query: 1381 QPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSV 1440
            QPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSV
Sbjct: 1381 QPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSV 1440

Query: 1441 NKFPSSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQTLTITA 1500
            NKFPSSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQTLTITA
Sbjct: 1441 NKFPSSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQTLTITA 1500

Query: 1501 KIEEPNEPISKEDVPEKAV 1519
            KIEEPNEPISKEDVPEKAV
Sbjct: 1501 KIEEPNEPISKEDVPEKAV 1519

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1165 bits (3013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/970 (60%), Positives = 700/970 (72%), Gaps = 39/970 (4%)

Query: 546  QPYLQQNQSMQGQGF-YPQSGV---------LMQPTNLPPLGNFSASGQASPAENSHMLP 595
            Q + Q N +M   GF + QSG+         LM   NLPPLGNFS  G   P      LP
Sbjct: 358  QSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHHPMS----LP 413

Query: 596  SMHQ-HIAGGHVIPQHVVTQGMSNQDIPVSEMRSTMNGTYNQVEYIQGAPGYPQPLEGVQ 654
            S+   ++        H+VTQG+SNQ IPVS++R   + ++   EY Q        ++ VQ
Sbjct: 414  SVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQ--------VQDVQ 465

Query: 655  YMEAPMARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKI 714
            YME P  RPEIDLDPSL            D + L +E TFF++ K+FIGNKQ+Y EFLKI
Sbjct: 466  YME-PTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKI 524

Query: 715  LNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLC 774
            LNLYSQDLL   +LV  V  YL  S ELFDWFKSFVGYQE+PKHIEN++HEKHRLDLDLC
Sbjct: 525  LNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLC 584

Query: 775  EACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLF 834
            EACGPSYK+LPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLF
Sbjct: 585  EACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLF 644

Query: 835  KVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXX 894
            K+EEERHEYDFYIE+NLRTIQTLETIANKIANMT EEK  FKLPPGLGHTS+TI      
Sbjct: 645  KIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIR 704

Query: 895  XXXXXXXGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSL 954
                   GFEIIDALHEHPA+TVP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV+YKSL
Sbjct: 705  KVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSL 764

Query: 955  DHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDI 1014
            DHLGLTFKQADKKLLT KQL+SEISSIKVDQ+NKRIHPLTPK KSQL ++  + EV  DI
Sbjct: 765  DHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDI 824

Query: 1015 LDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSS----ITDQXX 1070
            L LV  F+  N +YS SD  +L  FFK FISLFFSYP+ ++ E + +RSS    I+    
Sbjct: 825  LSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDD 884

Query: 1071 XXXXXXXXXXXXXXXRT-LSDEDSYLMKDILRRTKNAKTXXXXXXXXXXXXXXXXXD--E 1127
                           R  + D+  +L++DIL R K  K                  D  E
Sbjct: 885  TRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQSSEEFEKESDIEE 944

Query: 1128 TELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKK 1187
             E++ +EA KPWLLGS++DEA+N G VSDR  FN+F NT IYVFFRHL T+YERL+EVKK
Sbjct: 945  KEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKK 1004

Query: 1188 IDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQW 1247
            I+ EVT EI NRK+VQFA DLNLISTQL DMGL FK   AY ELLRLS+ LI+G+L+HQW
Sbjct: 1005 INGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQW 1064

Query: 1248 FEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQ 1307
            FEESLRQAYKNKAFK+YTIDKV+Q+LVKHAH+I+ D K   +M+LF+ DR    T+ KDQ
Sbjct: 1065 FEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQ 1124

Query: 1308 ILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSL 1367
            ILYRL+VR+ M   ENMFRIEYNT +SH SIQ+VAV+DLTL EP+++++KW YY+TSYSL
Sbjct: 1125 ILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSL 1184

Query: 1368 SHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTF 1427
            SHPTEGI+ +++  PFL KIIE++  Y+DD   ++++SPEGV+ S +KV I P TY +  
Sbjct: 1185 SHPTEGISHDNLRTPFLEKIIERDEGYIDD--GDERYSPEGVASSNMKVKIDPLTYSMEV 1242

Query: 1428 ECGSTDVFTRKSVNKFPS------SQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKM 1481
            E G  D+F+RKSVNKFP+       +S +    ++ FLN  +GWK+ L+T+    AE ++
Sbjct: 1243 EPGCHDIFSRKSVNKFPTRVDVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRL 1302

Query: 1482 KILKEQGKLE 1491
            + +K  G L+
Sbjct: 1303 EYVKNNGTLD 1312

 Score =  197 bits (500), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 92/130 (70%), Positives = 103/130 (79%), Gaps = 8/130 (6%)

Query: 199 SSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGF 258
           S+YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVI+RV+TLF G+
Sbjct: 127 SAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGY 186

Query: 259 PNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQNVENQ 318
           P LIQGFNTFLPHGY IEC ++PNDPIKVTTPFGT GE+         +    G +    
Sbjct: 187 PALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIP--------ITGAGGNHAHGA 238

Query: 319 NIEMQQQVSQ 328
           N E + Q +Q
Sbjct: 239 NTEPRLQSTQ 248

 Score =  113 bits (282), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 57/59 (96%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K G+VEFSHAISYVNKIKTRFA+QPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQN
Sbjct: 279 KKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 337

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 41/62 (66%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 269 LP 270
           LP
Sbjct: 349 LP 350

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           A+SY+ ++K +F+ +PD+Y  FL+I++ ++ +      V  +V+ LF  
Sbjct: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHG 185

 Score = 33.9 bits (76), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     +++  ++K RF     +Y  FL+IL  Y ++    +E+ ++V     ++ +L D
Sbjct: 284 VEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 343

Query: 745 WFKSFVGYQEKPK 757
            FK F+     P+
Sbjct: 344 DFKKFLPDSSAPQ 356

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1139 bits (2946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/954 (61%), Positives = 703/954 (73%), Gaps = 38/954 (3%)

Query: 555  MQGQGFYPQSGVLMQPTNLPPLGNFSASGQASPAENSHM-LPSMH---QHIAGGHVIPQH 610
            + G  FYPQ+       NLPPLG+FS     S  E  H+ LP++      I+G     QH
Sbjct: 419  VNGGTFYPQAA---PQQNLPPLGSFSPPSSGSAREGEHVGLPAVQPPSMDISGQP--QQH 473

Query: 611  VVTQGMSNQDIPVSEMRSTMNGTYNQVEYIQGAPGYPQPLEGVQYMEAPMARPEIDLDPS 670
            ++TQGMSN DIP+SE+R+T +G Y       G          VQYME P+ARPEIDLDPS
Sbjct: 474  IITQGMSNDDIPISEVRNTADGAYRSDLRNSGE---------VQYME-PVARPEIDLDPS 523

Query: 671  LXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVS 730
            L            + ++L +E +FF++ K+FIGNKQ+Y EFLKILNLYSQDLL   ELV 
Sbjct: 524  LVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVE 583

Query: 731  KVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTF 790
            KVE+YL  +KELFDWFK+FVGY++KPKHIENIVHEKHRLDLDLCEACGPSYKKLPK DTF
Sbjct: 584  KVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTF 643

Query: 791  MPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESN 850
            MPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIE+N
Sbjct: 644  MPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEAN 703

Query: 851  LRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXGFEIIDALH 910
            LRTIQTLETIANKIANMT EEK  FKL PGLGHTS+TI             GFEIIDALH
Sbjct: 704  LRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALH 763

Query: 911  EHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLT 970
            E P++ VPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLT
Sbjct: 764  ETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLT 823

Query: 971  TKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSN 1030
            TKQL+SEIS+IKVDQ NKRIHPLTPKPKSQLD+   DREVLYDIL+L   F+  N +YSN
Sbjct: 824  TKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSN 883

Query: 1031 SDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQXXXXXXXXXXXXXXXXXRTLSD 1090
             DK K+  F K+F+ LFFSYP+ +V  A + R                       RT  +
Sbjct: 884  PDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSRKRTREE 943

Query: 1091 EDSYLMKDILRRTKN------AKTXXXXXXXXXXXXXXXXXDETELLAKEAAKPWLLGSL 1144
            E+  L+KD+LRR K       A+                  +E E++ +EA KPWLLGS+
Sbjct: 944  EN--LLKDVLRRNKYQKGRNFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKKPWLLGSI 1001

Query: 1145 IDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQF 1204
            +DEAN  G V +R  FN+F NT IYVFFRHL TLY RL EVK I+  VT+EIKNRK+VQF
Sbjct: 1002 VDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQF 1061

Query: 1205 ASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIY 1264
            A DLNLISTQL+DMGL F+   AYG++L LSKRLI GD++HQWFEESLRQAYKNKAFKIY
Sbjct: 1062 AKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIY 1121

Query: 1265 TIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENM 1324
            TIDKVVQSLVKHAH+IITDPK   +M+LFE+DR   +T+AK+QILYRL+VR+ M  +ENM
Sbjct: 1122 TIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENM 1181

Query: 1325 FRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFL 1384
            FRIEYN  S+H SIQ+VAVDDLTL+EP++++++W YYVTSYSLSHPTEGI+ E++  PFL
Sbjct: 1182 FRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQPPFL 1241

Query: 1385 GKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFP 1444
             KI+EKE E+   + +N ++SPEGVS S LKV I+PETY L  + GS D F+RKS+NKFP
Sbjct: 1242 EKILEKEEEF---QCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFP 1298

Query: 1445 --------SSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKL 1490
                     S+  + A  +  +LN +KGWK+ L    + +A+++++ +K +G L
Sbjct: 1299 IEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGTL 1352

 Score =  194 bits (493), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 94/126 (74%), Positives = 105/126 (83%), Gaps = 8/126 (6%)

Query: 197 QYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256
           Q  SYRPLNVKDALSYLEQVKFQF++RPDVYNHFLDIMKDFKSQAIDTPGVI+RV+ LFQ
Sbjct: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

Query: 257 GFPNLIQGFNTFLPHGYKIECSTNPND--PIKVTTPFGTTGEVSAGPPTQYQLAPVAGQN 314
           G+PNLIQGFNTFLP GYKIECS+NPND  PIKVTTPFGTTG V+         AP+  + 
Sbjct: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLN------TAPLEQRY 267

Query: 315 VENQNI 320
             N+N+
Sbjct: 268 PSNENV 273

 Score =  111 bits (278), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 57/59 (96%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K G+VEFSHAISYVNKIKTRFA+QPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQN
Sbjct: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 45/73 (61%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 269 LPHGYKIECSTNP 281
           LP     + +T P
Sbjct: 404 LPDASAPQSTTTP 416

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F ++PD+Y  FL+I++ ++ +      V  +V+ LFQ
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     +++  ++K RF     +Y  FL+IL  Y ++    +E+ ++V     ++ +L D
Sbjct: 339 VEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 398

Query: 745 WFKSFV 750
            FK F+
Sbjct: 399 DFKKFL 404

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1134 bits (2934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/962 (59%), Positives = 702/962 (72%), Gaps = 36/962 (3%)

Query: 572  NLPPLGNFSASGQASPAENSHMLPSMHQHIAGGHVIPQHVVTQGMSNQDIPVSEMRSTMN 631
            NLPPLG+FS  G   P  N  ++ + + ++  GH  P H++TQGMSNQ IP+S++R+T +
Sbjct: 488  NLPPLGSFSTPGDHHPM-NLPLVQAPNMNLNQGH--PAHIITQGMSNQKIPISDLRTTAD 544

Query: 632  GTYNQVEYIQGAPGYPQPLEGVQYMEAPMARPEIDLDPSLXXXXXXXXXXXXDAIALGDE 691
             +Y   EY QG        +  QYME   ARPEIDLDPSL            D + L +E
Sbjct: 545  TSYRPAEYSQG--------QDTQYMET-NARPEIDLDPSLVPVIPEPIKPLEDELNLVEE 595

Query: 692  VTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVG 751
             +FF++ K++IGNKQ+Y EFLKILNLYSQDLL    LV KV  YL    ELFDWFKSFVG
Sbjct: 596  ASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVG 655

Query: 752  YQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGH 811
            YQEKPKHIENIVHEKHRLDLDLCEACGPSYK+LPK DTFMPCSGRDEMCWEVLNDEWVGH
Sbjct: 656  YQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGH 715

Query: 812  PVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEE 871
            PVWASEDSGFIAHRKNQYEDTLFK+EEERHEYDFYIE+NLRTIQTLETIANKIANMT EE
Sbjct: 716  PVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEE 775

Query: 872  KNNFKLPPGLGHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVLKRLKQKDEEW 931
            K  FKLPPGLGHTS+TI             G+EIIDALHE+PA+TVPIVLKRLKQKDEEW
Sbjct: 776  KATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEW 835

Query: 932  RRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIH 991
            RRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQL+SEISSIKVDQ NKRIH
Sbjct: 836  RRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIH 895

Query: 992  PLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYP 1051
            PLTPK KSQLD +  D EV YDIL+L   F++ N +YS  DK +L  FFK FISLF SYP
Sbjct: 896  PLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYP 955

Query: 1052 IKDVNEAVSERSSITD--------QXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDILRRT 1103
            +  + +A+++R + +         +                 R   D D  L++D+L R 
Sbjct: 956  VPQIEKALAKRDAASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSDR-LLRDVLFRN 1014

Query: 1104 KNAKTXXXX--XXXXXXXXXXXXXDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFN 1161
            K  K                    +E E++ +EA  PWLLGS++DEA+N G V +R  FN
Sbjct: 1015 KQQKGGRNSPRGDSSISAEKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFN 1074

Query: 1162 LFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLA 1221
            LF NT IYVFFRHL T+YERL+EVKK++ EVT EI NRK+VQFA DLNLISTQL DMGL 
Sbjct: 1075 LFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLD 1134

Query: 1222 FKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSII 1281
            FK   AY +LL+LS+ LI GDL+HQWFEESLRQAYKNKAFKIYT+DKV+Q+LVKHAH+II
Sbjct: 1135 FKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAII 1194

Query: 1282 TDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYV 1341
            TD K   +M+LFE+DR    T+ KDQILYRL+VR+ M   ENMFRIEYN  ++HV IQ+V
Sbjct: 1195 TDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFV 1254

Query: 1342 AVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQN 1401
            AVDDLTL+EP+++K+KW YY+TSYSLSHPTEGI+ +++  PFL KIIE E + +  E+++
Sbjct: 1255 AVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDII--EDKD 1312

Query: 1402 DKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFP------SSQSTQPASKM 1455
            +K+SPEGV+ S LKV I P TY +  E GS D+F+RK+VNKFP        +S++   ++
Sbjct: 1313 EKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIRKKKSSELKLEL 1372

Query: 1456 DKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKLE---IDQTLTITAKIEEPNEPISKE 1512
            ++FLNS+ GWKK+LS + I   E +++ +K  G LE    D  +  T+ +   +  ++KE
Sbjct: 1373 ERFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEEYSDDSAVASTSAVSGSD--LAKE 1430

Query: 1513 DV 1514
            D+
Sbjct: 1431 DI 1432

 Score =  200 bits (508), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 97/100 (97%)

Query: 199 SSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGF 258
           SSYRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVI+RV+TLFQG+
Sbjct: 158 SSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGY 217

Query: 259 PNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVS 298
           P LIQGFNTFLP GY IECS++PNDPIKVTTPFGTTGEV+
Sbjct: 218 PTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTTGEVA 257

 Score =  116 bits (290), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 54/59 (91%), Positives = 58/59 (98%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +KTG+VEFSHAISYVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQN
Sbjct: 347 KKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 41/62 (66%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 269 LP 270
           LP
Sbjct: 417 LP 418

 Score = 38.9 bits (89), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LFQ
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQ 215

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 40/83 (48%), Gaps = 1/83 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     +++  ++K RF     +Y  FL+IL  Y ++    +E+ ++V     ++ +L D
Sbjct: 352 VEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 411

Query: 745 WFKSFVGYQEKPKHIENIVHEKH 767
            FK F+     P+  +  + + H
Sbjct: 412 DFKKFLPDASAPQAQQQHLAQSH 434

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1122 bits (2902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/1007 (57%), Positives = 697/1007 (69%), Gaps = 69/1007 (6%)

Query: 550  QQNQSMQGQGFYPQSGVLMQPTNLPPLGNFSA--SGQA------SPAENSHMLPSMHQHI 601
            QQ  +  G G+Y ++  + +  NLPPLG+FS   +G A       P++   + P  H   
Sbjct: 607  QQAAAATGYGYYGENQPVAR-QNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLET 665

Query: 602  AGGHVIPQH-VVTQGMSNQDIPVSEMRSTMNGTYNQVEYIQGAPGY-------------- 646
                V P H V+TQGMSN  IP+S MRS   G       ++ AP +              
Sbjct: 666  QAAKVTPSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQL 725

Query: 647  ---------------PQ-----------PLEGVQYMEAPMARPEIDLDPSLXXXXXXXXX 680
                           PQ           P + VQY++  + RPEIDLDPS+         
Sbjct: 726  PQQQLPPQQQEQSLPPQTIPLTQPSQLGPQQEVQYVDIAV-RPEIDLDPSIVPVVPEPTE 784

Query: 681  XXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSK 740
               D+++L +E +FF++ K+FIGNKQ+Y EFLKILNLYSQDLL    LV KVE YL  SK
Sbjct: 785  PIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSK 844

Query: 741  ELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMC 800
            ELF WFK+FVGYQ++PK+IEN++HEKHRLDLD+CEA GPSYKKLPK DTFMPCSGRDEMC
Sbjct: 845  ELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMC 904

Query: 801  WEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETI 860
            WEVLNDEW+GHPVWASEDSGFIAHRKNQYE+TLFKVEEERHEYDFYIESNLRTIQTLETI
Sbjct: 905  WEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETI 964

Query: 861  ANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIV 920
            A+KIANMT EEK NFKLPPGLGHTSLTI             GFEIIDALHEHPAV VP+V
Sbjct: 965  ASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVV 1024

Query: 921  LKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISS 980
            LKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEISS
Sbjct: 1025 LKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISS 1084

Query: 981  IKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFF 1040
            IKVDQTNKRIH LTPKPKSQLD++  DRE+  DIL L   F+    +YSNSDK +L  F 
Sbjct: 1085 IKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFL 1144

Query: 1041 KAFISLFFSYPIKDVNEAVSERSSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDIL 1100
            K+F+SLFFS P+ +VN+ +  RS    +                 R    E    ++DIL
Sbjct: 1145 KSFLSLFFSIPVSEVNDGLRRRSPSNKEEHEANKKENGTALAHGKR--PREIELPLRDIL 1202

Query: 1101 RRTK--------NAKTXXXXXXXXXXXXXXXXXDETELLAKEAAKPWLLGSLIDEANNSG 1152
             R K        + +                  +E E++ +EA KPWLLG++++EAN  G
Sbjct: 1203 HRNKYQKLKLRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQG 1262

Query: 1153 IVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLIS 1212
            I+S+R  FNLF NT+IYVFFRHL TLYERL+EVK ID EVT EI +RK+ QFA DLNLIS
Sbjct: 1263 IISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLIS 1322

Query: 1213 TQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQS 1272
             QL +MGL F    AY +LL LSKRLI GD++HQWFEESLRQAY N+AFK YT+DKVVQ+
Sbjct: 1323 EQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQA 1382

Query: 1273 LVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTD 1332
            LVKHAH+I+TD K + +MVLFE+DR    T+AKDQILYR++ R+ M  +ENMFRIE+N  
Sbjct: 1383 LVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRI 1442

Query: 1333 SSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEA 1392
            S HV IQY+A+DDLTL E +++++KW YYVTSYSLSHPTEGI+ ED+  PFL KIIE E 
Sbjct: 1443 SKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQ 1502

Query: 1393 EYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQSTQP- 1451
            EY +D   + KFSPEGVS+S L++ I PETY L  E GS DVF+RK+VNKFP  ++++  
Sbjct: 1503 EYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESH 1562

Query: 1452 ASKMDK-------FLNSSKGWKKNLSTEIIGRAESKMKILKEQGKLE 1491
             +K+DK       +L+S KGWKKNL  + I   E K+  +K  G L+
Sbjct: 1563 KTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQ 1609

 Score =  184 bits (466), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (85%), Gaps = 2/113 (1%)

Query: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260
           YRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVI+RV+TLF+G+PN
Sbjct: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336

Query: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQ 313
           LIQGFNTFLP GY+I+CS NP++PIKVTTP G++    AG     Q A   GQ
Sbjct: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSS--TVAGVAEMNQAALFQGQ 387

 Score =  106 bits (264), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (91%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K  +VEFS AISYVNKIK RF+DQPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQN
Sbjct: 515 KKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 573

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +FS +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 269 LP 270
           LP
Sbjct: 585 LP 586

 Score = 37.7 bits (86), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           A+SY+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+ 
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333

 Score = 36.2 bits (82), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 45/105 (42%), Gaps = 5/105 (4%)

Query: 647 PQPLEGVQYMEAPMARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVK-RFIGNK 705
           PQP   V     P  +PE+   P+               +     +++  ++K RF    
Sbjct: 485 PQPTSAVSSGTGP-TQPEV---PAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQP 540

Query: 706 QVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFV 750
            +Y  FL+IL  Y ++    +E+ ++V     ++ +L D FK F+
Sbjct: 541 DIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFL 585

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/963 (58%), Positives = 685/963 (71%), Gaps = 35/963 (3%)

Query: 559  GFYPQSGVLMQPTNLPPLGNFSASGQASPAENSHM--------LPSMHQ---HIAGGHVI 607
             +Y ++       NLPPLG+FS     +   N +         LP + Q   HI      
Sbjct: 473  AYYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQPQTLGLPPVAQVENHI--DQRS 530

Query: 608  PQHVVTQGMSNQDIPVSEMRSTMNGT----YNQVEYIQGAPGYPQP-LEGVQYMEAPMAR 662
            P H+ TQG++ + +PVS +RS +         Q+   Q  P  P   +   QY++  + R
Sbjct: 531  PPHIATQGIAGEPMPVSNLRSQITAQSPSELAQLHQQQQIPSQPTANIPDGQYLDIAV-R 589

Query: 663  PEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDL 722
            PEIDLDPS+            D++ L +E +FF+R K+FIGNKQ+Y EFLKILNL+SQDL
Sbjct: 590  PEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDL 649

Query: 723  LTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYK 782
            L   ELV +VE YL  +KELF WFK+FVG+Q+KPKHIENIVHEKHRLDLDLCEACGPSYK
Sbjct: 650  LDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYK 709

Query: 783  KLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHE 842
            KLPK DTFMPCSGRDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHE
Sbjct: 710  KLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE 769

Query: 843  YDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXG 902
            YDFYIESNLRTIQTLETIA+KIANM+ EEK  FKLPPGLGHTSLTI             G
Sbjct: 770  YDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERG 829

Query: 903  FEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK 962
            FEIIDALHE+PA+ VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK
Sbjct: 830  FEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK 889

Query: 963  QADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFV 1022
            QADKKLLTTKQL+SEI SIK DQTNKR+H LTPKPK QLD+ + D+ V +DIL L  TF+
Sbjct: 890  QADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFI 949

Query: 1023 KTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQXXXXXXXXXXXXXX 1082
              N+SYSN DKI+L   FK F+SLFFS P+ +VNEAVS R ++ D               
Sbjct: 950  NHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNLN 1009

Query: 1083 XXXRTLSDEDSYLMKDILRRTKN----AKTXXXXXXXXXXXXXXXXXDETELLAKEAAKP 1138
               R   DE S  + ++L R KN    ++                  +E E + +EA KP
Sbjct: 1010 NSKRPREDEIS--LSEVLHRAKNQRFKSRAADETSEESAAEPEPELNEEEETIRQEAKKP 1067

Query: 1139 WLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKN 1198
            WLLG+L++E N  G++++R  FN+F NT IYVFFRHL TLYERL EVKK++  VT EI +
Sbjct: 1068 WLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINS 1127

Query: 1199 RKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKN 1258
            RK+VQFA DLNLIS QL +MGL F+   AY +L  L KRLI GD++HQWFEESLRQAY N
Sbjct: 1128 RKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNN 1187

Query: 1259 KAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTM 1318
            KAFK+YT+DKV+QSLVKHAH+I+TD K + +M  FE+DR + +T+AKDQILYRL+VR+ M
Sbjct: 1188 KAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYM 1247

Query: 1319 GESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQED 1378
              +ENMFRIEYN  S +V IQ++AVDDLTL EP++++EKW YYVTSYSLSHPTEGI+QE+
Sbjct: 1248 SSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEE 1307

Query: 1379 ISQPFLGKIIEKEAEYLDDEEQN--DKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFT 1436
            +  PFL K++E E +Y  D +    DKFSPEGVS+S LK+ I PETY L  E GS DVF+
Sbjct: 1308 LQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFS 1367

Query: 1437 RKSVNKFP--------SSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQG 1488
            RKSVN+FP        +++  +  + + +FL S KGWKKNL  + +   + K+  +KE G
Sbjct: 1368 RKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENG 1427

Query: 1489 KLE 1491
             L+
Sbjct: 1428 SLD 1430

 Score =  180 bits (456), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 89/95 (93%)

Query: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260
           YRPLNVKDALSYLEQVK+QF+SRPDVYNHFLDIMKDFKSQAIDTPGVI RV+TLF+G+P 
Sbjct: 191 YRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPG 250

Query: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTG 295
           LIQGFNTFLP GY+IECS NP++PI+VTTP G++ 
Sbjct: 251 LIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSS 285

 Score =  105 bits (263), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 55/59 (93%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +KT +VEFS AI+YVNKIK RFA+QPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQN
Sbjct: 375 KKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 433

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A++Y+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 269 LP 270
           LP
Sbjct: 445 LP 446

 Score = 37.0 bits (84), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 31/48 (64%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     + +  ++K RF     +Y  FL+IL  Y ++    +E+ ++V     ++ +L D
Sbjct: 380 VEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 439

Query: 745 WFKSFV 750
            FK F+
Sbjct: 440 DFKKFL 445

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1096 bits (2834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1123 (52%), Positives = 729/1123 (64%), Gaps = 106/1123 (9%)

Query: 420  QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNN 479
            +K  +VEFS AISYVNKIK RF+DQPDIYK FLEILQTYQREQKPI+EVYAQVT+LF N 
Sbjct: 374  KKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNA 433

Query: 480  XXXXXXXXXXXXXSSVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 539
                         SS S                                           
Sbjct: 434  PDLLDDFKKFLPDSSASNEQQPKQS----------------------------------- 458

Query: 540  XAMLPPQPYLQQNQSMQGQGFYPQSGVLMQP------TNLPPLGNFS--ASGQASPAENS 591
                P  P +     M     Y  +GV   P      +NLPP+G+FS  A+G A P   +
Sbjct: 459  ----PYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQSNLPPIGSFSPPANGVA-PTTGT 513

Query: 592  HMLPSMHQHIAGGHVIP-------QHVVTQGMSNQDIPVSEMRSTMNGTYNQV-EYIQGA 643
             +  +  QH+  G  +P       QH  +  ++N  I +S MR    GT   + +Y   +
Sbjct: 514  AIPHADEQHVVAG--VPAMAPHEQQHAPSM-INNDGIQISNMRG--GGTVPALNQYGMIS 568

Query: 644  P---------------------GYPQPLEGVQYMEAPM-ARPEIDLDPSLXXXXXXXXXX 681
            P                          +   QY    M  RPEIDLDPS+          
Sbjct: 569  PHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQYGSGDMQVRPEIDLDPSIVPVVPEPTEP 628

Query: 682  XXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKE 741
              + ++L +E +FFE+VK+ IGN+Q+Y EFLK+LNL+SQDL+   ELV+KVE YL    E
Sbjct: 629  IENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPE 688

Query: 742  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCW 801
            LF+WFK+FVGYQ+KPK IEN++HEKHRLDLDLCEA GPSYKKLPK DTFMPCSGRD+MCW
Sbjct: 689  LFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCW 748

Query: 802  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIA 861
            EVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQTLETIA
Sbjct: 749  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIA 808

Query: 862  NKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVL 921
            +KIANMT EEKN FKLPPGLGHTSLTI             GFEIID LHEHPA+TVPIVL
Sbjct: 809  SKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVL 868

Query: 922  KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSI 981
            KRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEISSI
Sbjct: 869  KRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSI 928

Query: 982  KVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFK 1041
            KVDQ NKR+H LTPKPK QLD++ ND ++++DI+ L   FV   ++YSN DK +L   F+
Sbjct: 929  KVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFR 988

Query: 1042 AFISLFFSYPIKDVNEAV---SERSSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKD 1098
             FISLFF  P   ++ A+   S+    TD                   +LS        D
Sbjct: 989  VFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKADDSKKRPRPDVELSLS--------D 1040

Query: 1099 ILRRTK--NAKTXXXXXXXXXXXXXXXXXDETELLAKEAAKPWLLGSLIDEANNSGIVSD 1156
            IL R K    K                  +  E+  K A+KPWL+G +++ AN+ G+V+D
Sbjct: 1041 ILHRAKYQKLKNGEGLGMSEDDDEEKLAKEAEEMSEKNASKPWLVGDIVERANSHGLVTD 1100

Query: 1157 RHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLA 1216
            R ++NLF NT +Y+F RH +TLY RLLE+K++D  VT EI NRK+VQFA DLNL+STQL 
Sbjct: 1101 RAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLR 1160

Query: 1217 DMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKH 1276
            DMGL F    AY E L+LSKRLI  +L+HQWFEESLRQAY NKAFK+YT+DKVV SLVKH
Sbjct: 1161 DMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKH 1220

Query: 1277 AHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHV 1336
            AH+++TD K++ +M LFE+DRL+  T  KDQILYRL  R+ M  +ENMFR++YN D+ HV
Sbjct: 1221 AHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHV 1280

Query: 1337 SIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLD 1396
            SIQY+ +DD+TL++ ++  E+W+YY+TSY+L HPTEGI Q+ +  PFL +I+E E + LD
Sbjct: 1281 SIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLD 1340

Query: 1397 DEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQSTQPASKM- 1455
             E  +D+++P G S SKLK+NI P+TY+L  + GS D+F+R S+N++P    ++   +M 
Sbjct: 1341 VEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMV 1400

Query: 1456 -------DKFLNSSKGWKKNLSTEIIGRAE--SKMKILKEQGK 1489
                    KFL+   GWKK+LS ++I   E   K+ +L E+ K
Sbjct: 1401 EKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSEETK 1443

 Score =  175 bits (444), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 92/115 (80%), Gaps = 1/115 (0%)

Query: 199 SSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGF 258
           S YRPLNVKDALSYLEQVK QF+SRP +YN FLDIMKDFKSQ IDTPGVI+RV+TLF+GF
Sbjct: 216 SPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGF 275

Query: 259 PNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQ 313
           P LIQGFNTFLP GY+IECS+NPN+PIKVTTP G    V     T  Q  P  GQ
Sbjct: 276 PALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQ-QPAIGQ 329

 Score = 55.8 bits (133), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 16/125 (12%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +FS +PD+Y +FL+I++ ++ +      V  +VT LF   P+L+  F  F
Sbjct: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKF 443

Query: 269 LPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVA-GQNVENQNIEMQQQVS 327
           LP       ++N   P +  +P+          P  Y  A +A G    N  +    QV+
Sbjct: 444 LPDS----SASNEQQPKQ--SPYS---------PQVYSGADMARGYMYNNTGVYYPPQVN 488

Query: 328 QPQFN 332
           QPQ N
Sbjct: 489 QPQSN 493

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F  +P IY QFL+I++ ++ +      V  +V+ LF+
Sbjct: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFK 273

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1082 bits (2799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/973 (57%), Positives = 679/973 (69%), Gaps = 59/973 (6%)

Query: 572  NLPPLGNFSASGQASPAENSHMLPSMH--------QHIAGGHVIPQHVVTQGMSNQDIPV 623
            NLPPLGNFS        E    LP++         Q  +  H   +HVV QGM+N  +PV
Sbjct: 579  NLPPLGNFSPPINGRDNEAQVNLPAVQPPALDFPPQQQSQSH---RHVVAQGMTNNSLPV 635

Query: 624  SEMRSTMNGTYNQVEYIQGAPGYPQPL--EGVQYMEAPMARPEIDLDPSLXXXXXXXXXX 681
            S+MR  ++G +            PQPL  + VQYME P +RPEIDLDPSL          
Sbjct: 636  SDMRGPVDGGFA-----------PQPLYSQDVQYME-PTSRPEIDLDPSLVPVIPEPIRP 683

Query: 682  XXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKE 741
              +   L +E +FF++ K+++GNKQVY EFLKILNL+SQDL+ T ELV KVE YL  + E
Sbjct: 684  LENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSE 743

Query: 742  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCW 801
            LFDWFKSFV Y E+PKHIEN+VHEKHRLDLDLCEAC PSYKKLPK DTFMPC GRDEMCW
Sbjct: 744  LFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCW 803

Query: 802  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIA 861
            EVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYD+YIE+NLRTIQ LETIA
Sbjct: 804  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIA 863

Query: 862  NKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVL 921
            NKI+NMT EEK  FKLPPGLGHTS TI             GFEIIDALHE+PAV+VPIVL
Sbjct: 864  NKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVL 923

Query: 922  KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSI 981
            +RLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEISSI
Sbjct: 924  RRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSI 983

Query: 982  KVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFK 1041
            K+DQ NKRI+P T KPKSQLDF+I+D+ VL+DIL+LV TF+  + +YSN DK KL  FF+
Sbjct: 984  KIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFR 1043

Query: 1042 AFISLFFSYPIKDVNEAVSERSSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDIL- 1100
             F+S+FFS P+ D++    E                        R  S +D    +D+L 
Sbjct: 1044 GFLSIFFSIPLTDLDNPSEEHK---------------VENGDSTRKRSRDDDQFFRDLLK 1088

Query: 1101 -------RRTKNAKTXXXXXXXXXXXXXXXXXDETELLAKEAAKPWLLGSLIDEANNSGI 1153
                   ++T   +                  +  E +  +A KPWLLG+++DEANN G 
Sbjct: 1089 SKHKQAKKKTSQQEDESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGF 1148

Query: 1154 VSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLIST 1213
            VS+R  +N+F NT IYVFFRHL T+Y+RL E K I+ EVT EI +RK+VQFA DLNL ST
Sbjct: 1149 VSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLAST 1208

Query: 1214 QLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSL 1273
            QL+DMGL FK   AY +LL L KRLI  D++HQWFEESLRQAYKNKAFKIYT+DKV+QSL
Sbjct: 1209 QLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSL 1268

Query: 1274 VKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDS 1333
            VKHAHSIITD K A +M+LFE+DR    T+ ++QILYRL+VR+ MG +ENMFRIE N+ S
Sbjct: 1269 VKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTS 1328

Query: 1334 SHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAE 1393
            +HVSIQ+VAVDDLTL +P ++K++W YY+TSYSLSHPTEG+  E+I  PFL K +  + +
Sbjct: 1329 AHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDGD 1388

Query: 1394 YLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSS---QSTQ 1450
              +D E    +SP G S S+L++ I+PE+Y L  E  S D+FTR +VNK P+     S +
Sbjct: 1389 SDEDSEW---YSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGR 1445

Query: 1451 PASKMDKFL----NSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQTLTITAKIEEPN 1506
             A  M K L    NS  GWKK L  E IG+AES +  +K +G LE   T++   K+E+ +
Sbjct: 1446 DAKTMQKSLADMVNSEHGWKKGLQNESIGKAESIINFVKARGFLEKATTVSPDPKVEKEH 1505

Query: 1507 EPISKEDVPEKAV 1519
               S   +PE A 
Sbjct: 1506 S-ASNGAIPEGAT 1517

 Score =  179 bits (454), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (87%), Gaps = 2/112 (1%)

Query: 189 GQDPLQQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVI 248
           G  PL+  Q +SYRPLN KDALSYLEQVKFQF++RPDVYNHFLDIMKD+KSQAIDT GVI
Sbjct: 237 GVLPLEHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVI 296

Query: 249 QRVTTLFQGFPNLIQGFNTFLPHGYKIECSTNPNDP--IKVTTPFGTTGEVS 298
           +R++TLF+G+P LIQG NTFLP GYKIEC++NP+DP  IKVTTPF TT E+S
Sbjct: 297 ERISTLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELS 348

 Score =  111 bits (278), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 52/56 (92%), Positives = 53/56 (94%)

Query: 423 GEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           G+VEFSHAISYVNKIKTRFADQPDIYK FLEILQTYQREQKPIHEVY QVT LFQN
Sbjct: 438 GDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493

 Score = 59.7 bits (143), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 198 YSSYRP---LNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTL 254
           Y++ RP   +    A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT+L
Sbjct: 431 YATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSL 490

Query: 255 FQGFPNLIQGFNTFLP 270
           FQ  P+L+  F  FLP
Sbjct: 491 FQNAPDLLDDFKKFLP 506

 Score = 40.8 bits (94), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 34/53 (64%)

Query: 425 VEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           + F  A+SY+ ++K +F ++PD+Y  FL+I++ Y+ +      V  +++ LF+
Sbjct: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304

 Score = 32.7 bits (73), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     +++  ++K RF     +Y  FL+IL  Y ++     E+ ++V     ++ +L D
Sbjct: 440 VEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLD 499

Query: 745 WFKSFV 750
            FK F+
Sbjct: 500 DFKKFL 505

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/976 (56%), Positives = 682/976 (69%), Gaps = 61/976 (6%)

Query: 559  GFYPQSGVLMQPTNLPPLGNFSASGQAS----PAENS-----HM--LPSMHQ----HI-- 601
            G+Y    +     NLPPLGNFS     +    P E S     HM  LPSM Q    H   
Sbjct: 459  GYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMALPSMLQAPTEHAQL 518

Query: 602  -AGGHVIPQHVVTQGMSNQDIPVSEMRSTM--NGTYNQVEYIQGAPGYPQP--------- 649
             A  H+ P       M+N+ IP+S++RS +  N   +    I+ A    Q          
Sbjct: 519  HAQQHIAP-------MTNEAIPISDLRSQIIDNNHVHNYTPIELAQLQQQQQQQQQQQQQ 571

Query: 650  -------LEGVQYMEAPMARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFI 702
                   LE   Y    + RPEIDLDPS+            ++++L +E  FF++ K+FI
Sbjct: 572  QQQQQMQLEAA-YATEGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFI 630

Query: 703  GNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENI 762
            GNKQVY EFLKILNLYSQD+L+  +L+ KV++YL S+KELFDWFK+FVG+Q+KPKHIEN+
Sbjct: 631  GNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENV 690

Query: 763  VHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI 822
            VHEKH+LDLDLCEACGPSYKKLPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
Sbjct: 691  VHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI 750

Query: 823  AHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLG 882
            AHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQTLETIA+KIANMT EEK  FKLP GLG
Sbjct: 751  AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLG 810

Query: 883  HTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVW 942
            HTS TI             GFEIIDALHE+P+V VP+VLKRLKQKD+EWRRAQREWNKVW
Sbjct: 811  HTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVW 870

Query: 943  RELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLD 1002
            RELEQKV++KSLDHLGLTFKQ+DKKLLTTKQLL+EISSIKVDQTNKRIH LTPKPKSQLD
Sbjct: 871  RELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLD 930

Query: 1003 FEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSER 1062
            +E+ D+ VL+DIL L   F+   +SYSN DK +L  F +++I LFFS PI+++ +AV   
Sbjct: 931  YEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVEAA 990

Query: 1063 SSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDILRRT-----KNAKTXXXXXXXXX 1117
                 Q                 R +       + DIL R+     K++           
Sbjct: 991  IDNGKQLDENEQNSSKKNSNKRPRDVE----ICLSDILNRSRYQRLKHSLDSSEASLGAV 1046

Query: 1118 XXXXXXXXDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNT 1177
                    D  E++ +EA KPWLLGSL++EAN+ G++ +R I+N+F N  +YVF R+L T
Sbjct: 1047 SPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLIT 1106

Query: 1178 LYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKR 1237
            +Y+RL EVK I+  VT EI  RK+VQFA DLNLIS QL +MGL F    +Y +LL LSKR
Sbjct: 1107 IYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKR 1166

Query: 1238 LITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDR 1297
            LI GDL+HQWFEESLRQAY+N+AFK+YTIDKV+QSLVKHAH+I+TD K++ VM LFE+DR
Sbjct: 1167 LIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDR 1226

Query: 1298 LKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEK 1357
            +   TT+KDQILYRL+ R+ M  +E+MFRIEYNT  S +SIQY+A+DDLTL+EP+ +++K
Sbjct: 1227 ISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDK 1286

Query: 1358 WDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVN 1417
            W YY+TSYSLSHPTEGI QE+I  PFL K+IE E  +++DE+ N K+SPEGVS+S L + 
Sbjct: 1287 WKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIK 1346

Query: 1418 IHPETYELTFECGSTDVFTRKSVNKFP-----SSQSTQPASKMDK---FLNSSKGWKKNL 1469
            I PETY L  E GS D+F+RKSVNKFP      S   +  ++ ++   FLN   GWK+ L
Sbjct: 1347 IDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQL 1406

Query: 1470 STEIIGRAESKMKILK 1485
            S++ I + E K   LK
Sbjct: 1407 SSDAISKIEQKFNDLK 1422

 Score =  182 bits (463), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 80/98 (81%), Positives = 91/98 (92%)

Query: 196 AQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLF 255
           A  S YRPLNVKDAL+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVI+RV+TLF
Sbjct: 116 ADGSYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 175

Query: 256 QGFPNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGT 293
           +G+PNLIQGFNTFLP GY IECS+NP+DPIKVTTP G+
Sbjct: 176 RGYPNLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGS 213

 Score =  106 bits (264), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (89%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K  +VEFS A+SYVNKIK RFADQPDIYK FLEILQTYQREQKPI EVYAQVT+LFQN
Sbjct: 356 EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 41/62 (66%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L+  F  F
Sbjct: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKF 425

Query: 269 LP 270
           LP
Sbjct: 426 LP 427

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 31/48 (64%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A++Y+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

 Score = 36.2 bits (82), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     V++  ++K RF     +Y  FL+IL  Y ++    SE+ ++V     ++ +L D
Sbjct: 361 VEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLD 420

Query: 745 WFKSFV 750
            FK F+
Sbjct: 421 DFKKFL 426

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1078 bits (2787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/947 (57%), Positives = 678/947 (71%), Gaps = 54/947 (5%)

Query: 569  QPTNLPPLGNFSASGQASPAENSHMLPSMH---QHIAGGHVI--PQHVVTQGMSNQDIPV 623
            +P NLPPLG+FS        +    LP++       A   V   P HVV Q +    +P+
Sbjct: 466  RPQNLPPLGSFSPPINGRENDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQVIPGGTLPL 525

Query: 624  SEMRSTMNGTYNQVEYIQGAPGYPQPLEG--VQYMEAPMARPEIDLDPSLXXXXXXXXXX 681
            S++R  M+G +            PQPL+   VQ++E P +RPEIDLDPSL          
Sbjct: 526  SDLRGAMDGNF-----------APQPLQSQDVQFIE-PTSRPEIDLDPSLVPVIPEPIKP 573

Query: 682  XXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKE 741
              + + L +E +FF+R K+++GNKQVY EFLKILNL+SQDL+ T ELV KVE YL  S E
Sbjct: 574  LENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPE 633

Query: 742  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCW 801
            LFDWFKSFV Y EKPKHIEN++HEKHRLDLDLCEAC PSYKKLPK DTFMPCSGRDEMCW
Sbjct: 634  LFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCW 693

Query: 802  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIA 861
            EVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYD+YIE+NLRTIQ LETIA
Sbjct: 694  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIA 753

Query: 862  NKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVL 921
            NKI+NMT EEK  FKLPPGLGHTS+TI             GFEIIDALHE+PAV+VPI+L
Sbjct: 754  NKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIIL 813

Query: 922  KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSI 981
            KRLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEISSI
Sbjct: 814  KRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSI 873

Query: 982  KVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFK 1041
            KVDQTNKRI+P TPKPKSQLD+++ D+ VL+DIL LV  F+  +++YSN DK KL  FFK
Sbjct: 874  KVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFK 933

Query: 1042 AFISLFFSYPIKDV-NEAVSERSSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDIL 1100
             F+S+FFS   +++ N   ++  ++++                  R    E    +K++L
Sbjct: 934  GFLSVFFSISYQEIENSTPADSDAVSN---------------SNPRKRLWESEQPLKELL 978

Query: 1101 R--------RTKNAKTXXXXXXXXXXXXXXXXXDETELLAKEAAKPWLLGSLIDEANNSG 1152
            R        R  +A+                  ++ E++ +EA KPWLLG+++DEAN+ G
Sbjct: 979  RSKHKHHKKRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHG 1038

Query: 1153 IVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLIS 1212
             VS+R IFNLF NT +YVFFRHL T+Y+RL EVK ++ EVT EI +R +VQFA DLNL+S
Sbjct: 1039 YVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVS 1098

Query: 1213 TQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQS 1272
            TQL+DMGL FK   AY +LL L KRLI  D+DHQWFEESLRQAYKNKAFKIYT+DKV+QS
Sbjct: 1099 TQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQS 1158

Query: 1273 LVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTD 1332
            LVKHAHSIITD K+A +M+LFE+DR    T+ K+QILYRL+VR+ MG +ENMFR+E N D
Sbjct: 1159 LVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKD 1218

Query: 1333 SSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEA 1392
            S HV IQYVA+DDLTLKEP+++K++W YY+TSY+LSHPTEGI  E+I  PFL K ++ + 
Sbjct: 1219 SCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDE 1278

Query: 1393 EYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQSTQPA 1452
            E    +E +++ SP G S S L++ ++PE+YEL  E GS D+FTR +VN+F +S      
Sbjct: 1279 EA---DEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSN 1335

Query: 1453 SKMDKF--------LNSSKGWKKNLSTEIIGRAESKMKILKEQGKLE 1491
            + + +         L+ S+GWKK +S E++ +  + +  ++  GK E
Sbjct: 1336 TDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGKHE 1382

 Score =  169 bits (429), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 91/107 (85%), Gaps = 2/107 (1%)

Query: 194 QQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTT 253
           +  Q  SYRPLN KDALSYLEQVKFQF++RPDVYNHFLDIMKD+KSQAIDT GVI+R++T
Sbjct: 135 EHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERIST 194

Query: 254 LFQGFPNLIQGFNTFLPHGYKIECSTNPNDP--IKVTTPFGTTGEVS 298
           LF+G+P LIQG NTFLP GYKIEC+ NPNDP  IKVTTPF    E++
Sbjct: 195 LFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELN 241

 Score =  112 bits (279), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%)

Query: 422 TGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +G+VEFSHAISYVNKIKTRFADQP+IYK FLEILQTYQREQKPIHEVYAQVT LFQN
Sbjct: 331 SGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 42/62 (67%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+ +P++Y HFL+I++ ++ +      V  +VT+LFQ  P+L+  F  F
Sbjct: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKF 398

Query: 269 LP 270
           LP
Sbjct: 399 LP 400

 Score = 40.8 bits (94), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 34/53 (64%)

Query: 425 VEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           + F  A+SY+ ++K +F ++PD+Y  FL+I++ Y+ +      V  +++ LF+
Sbjct: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197

 Score = 34.7 bits (78), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     +++  ++K RF    ++Y  FL+IL  Y ++     E+ ++V     ++ +L D
Sbjct: 334 VEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLD 393

Query: 745 WFKSFV 750
            FK F+
Sbjct: 394 DFKKFL 399

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/995 (55%), Positives = 678/995 (68%), Gaps = 54/995 (5%)

Query: 545  PQPYLQQNQSMQGQGFYPQSGVLMQPTNLPPLGNFS-----ASGQASPAE---NSHMLPS 596
            P P  +  Q      +YP      Q  NLPP+G+F+     AS + +P         LPS
Sbjct: 448  PTPNPKHQQYGYPNNYYPNGTGTQQ--NLPPIGSFAPPNGTASREYAPGNQFVGPGGLPS 505

Query: 597  MHQHIAGGHVIPQHVVTQGMSNQDIPVSEMRSTM-NGTYNQVEYIQG--APG------YP 647
            M  +        Q  +  G +N+ IPVS +RS + +  Y  +  +Q    PG        
Sbjct: 506  MIPNDQALQQQQQPGLVHGYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNAT 565

Query: 648  QPLEGVQYMEAPMARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGNKQV 707
             P+      EAP+ RPEIDLDPS+              ++L +E  FFE+ K+FIG KQV
Sbjct: 566  APMAQQYTNEAPI-RPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQV 624

Query: 708  YAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKH 767
            Y EFLKILNLYSQDLLTT EL  KVE+YL S++ELF WFK+FVG+QEKP  IENIVHEKH
Sbjct: 625  YTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKH 684

Query: 768  RLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKN 827
            +LDLDLCEACGPSYKKLPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKN
Sbjct: 685  KLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKN 744

Query: 828  QYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLT 887
            QYE++LFK EEERHEYDF IESNLRTIQTLETIANKI NMTNEEK NFKLPPGLGHTS T
Sbjct: 745  QYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSST 804

Query: 888  IXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQ 947
            I             GFEIID LHE PA+TVP+VLKRLKQKDEEWRRAQREWNKVWRELEQ
Sbjct: 805  IYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQ 864

Query: 948  KVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEIND 1007
            KVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIH LTPKPKSQL+F+ +D
Sbjct: 865  KVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDD 924

Query: 1008 REVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITD 1067
             ++  DIL L   F+  +++YSN +K ++  F + F+SLFFS P+  VNEA+S+RS    
Sbjct: 925  NDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQ 984

Query: 1068 QXXXXXXXXXXX----------XXXXXXRTLSDEDSYLMKDILRRTK------------- 1104
            +                           R L+ +    + DILR+ K             
Sbjct: 985  EKEKKTKESSRNIDSTTSSSSSGSNSKKRPLNID--IPLADILRKHKYQKIRKQAKESNE 1042

Query: 1105 -NAKTXXXXXXXXXXXXXXXXXDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLF 1163
             NA+                  DE E++ +E  +PWLLG++I+ A+N G +S+R +FN+F
Sbjct: 1043 ENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMF 1102

Query: 1164 TNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFK 1223
             NT IYVFFR    +YERL E+K+I+ +VT E+ +R+I QFA DLNLISTQL DMGL F 
Sbjct: 1103 ANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFV 1162

Query: 1224 DTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITD 1283
               +Y ELL LSKRLI  D++HQWFEESLRQA+ NKAFK+YT+DKV+QSLVKHAH+I+ D
Sbjct: 1163 GVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGD 1222

Query: 1284 PKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAV 1343
             K + +MVLFE+DRL   T+AK+QILYRL+ R  M  +ENMFRIE+N + +HV IQY+A+
Sbjct: 1223 VKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIAL 1282

Query: 1344 DDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDK 1403
            +DLT+K+P++M++ W+YYVTSYSL HPTEG+ Q+++  PFL K +E E     DEE ++K
Sbjct: 1283 EDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEV----DEEGDNK 1338

Query: 1404 FSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPS----SQSTQPASKMDKFL 1459
             SPEGVS SKLK+ I P++Y L  E GS D+F+RKS+N +P+    ++  +   +M KFL
Sbjct: 1339 SSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKSIDQMTKFL 1398

Query: 1460 NSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQ 1494
            +   GWKKNL+T      E  +K  +E  K   +Q
Sbjct: 1399 DGKNGWKKNLTTADSTNIEDLVKKSRELSKATGEQ 1433

 Score =  176 bits (446), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 104/130 (80%), Gaps = 8/130 (6%)

Query: 200 SYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFP 259
           +YRPLNVKDALSYLEQVK+QFS RPD+YN FLDIMKDFKSQ+IDTPGVI+RV+ LF+G+P
Sbjct: 206 AYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYP 265

Query: 260 NLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQNVENQN 319
            L+QGFNTFLP GY+IEC+T+P+ PI+VTTP GT+  +S GP  +   AP + ++    N
Sbjct: 266 MLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTST-LSGGPAME---APSSSES----N 317

Query: 320 IEMQQQVSQP 329
           ++ QQ    P
Sbjct: 318 LQQQQHHQSP 327

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/58 (82%), Positives = 54/58 (93%)

Query: 421 KTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           K  EVEFS AI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPI+EVY+QVT+LFQ+
Sbjct: 354 KNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQH 411

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 10/140 (7%)

Query: 131 TPINSAAGSNGPVSTNSEGAIPTPSINNIVQQPDITHXXXXXXXXXGHNVQVENAMTVGQ 190
           TP+ ++  S GP         P+ S +N+ QQ    H             Q  N     Q
Sbjct: 295 TPMGTSTLSGGPAM-----EAPSSSESNLQQQQH--HQSPTIPSLAASTFQESN---FQQ 344

Query: 191 DPLQQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQR 250
            P  + Q +    +    A++Y+ ++K +F+ +PD+Y  FL+I++ ++ +      V  +
Sbjct: 345 TPQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQ 404

Query: 251 VTTLFQGFPNLIQGFNTFLP 270
           VT LFQ  P+L+  F  FLP
Sbjct: 405 VTVLFQHAPDLLDDFKKFLP 424

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 33/48 (68%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F+ +PDIY QFL+I++ ++ +      V  +V+ LF+
Sbjct: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     + +  ++K RF     +Y  FL+IL  Y ++    +E+ S+V      + +L D
Sbjct: 358 VEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLD 417

Query: 745 WFKSFV 750
            FK F+
Sbjct: 418 DFKKFL 423

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1047 bits (2708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1017 (53%), Positives = 675/1017 (66%), Gaps = 99/1017 (9%)

Query: 573  LPPLGNFSASGQAS-----PAENSHM--LPSMHQH----IAGGHVIPQHVVTQGMSNQDI 621
            LPP+G+FS            ++  HM  LPSM QH        H  P  V TQG+SN +I
Sbjct: 479  LPPIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPA-VSTQGISNDEI 537

Query: 622  PVSEMRSTMNGTYNQVEYIQGA-------PGYPQ--PLEGVQ------------------ 654
            PVS++R          +Y  GA       P +PQ  P    Q                  
Sbjct: 538  PVSDVR--------MAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLMLQQ 589

Query: 655  -------------YMEAPMARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRF 701
                         Y+EAP+ RPEIDLDPS+                L +E +FF++ K+F
Sbjct: 590  QQEQELLEQQQQQYVEAPV-RPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKF 648

Query: 702  IGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIEN 761
            I NKQ+Y EFLK+LNL+SQDL++  +LV+KVE+Y+ SSKELF+WF++FVGYQ  PK IEN
Sbjct: 649  INNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIEN 708

Query: 762  IVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGF 821
            IVHEKHRLDLDLCEACGPSYK+LPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGF
Sbjct: 709  IVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGF 768

Query: 822  IAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGL 881
            IAHRKNQYE+TLFK+EEERHEYD+YIESNLRTIQTLE I NKI+NM+ EEK NFKL PGL
Sbjct: 769  IAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGL 828

Query: 882  GHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKV 941
            GHTSLTI             GFEIIDALHEHPA+  PIVLKRLKQKDEEWRRAQREWNKV
Sbjct: 829  GHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKV 888

Query: 942  WRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQL 1001
            WRELEQKVY+KSLDHLGLTFKQADKKLLT KQL+SEISSIKVDQ NKRIH LTPKPKSQL
Sbjct: 889  WRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQL 948

Query: 1002 DFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSE 1061
            +F+I D E+L+DIL L   F+  +++YS SDK +L+ F K+FISLFFS P+ ++N A+ +
Sbjct: 949  NFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDK 1008

Query: 1062 RSSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDILRRTKNAKTXXXXXXXXXX--- 1118
            R++  +                  R++ D +   M DIL RTK  K              
Sbjct: 1009 RNNQKNSEKVTDSALPDGTENQKKRSIHDIE-LSMSDILHRTKYQKMKLSNRGSDSQEEN 1067

Query: 1119 --------XXXXXXXDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYV 1170
                           +E +L+ ++A +PWLLG +ID+ N  GI++DR  FNLF NT IYV
Sbjct: 1068 NIDTIIDEESDERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYV 1127

Query: 1171 FFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGE 1230
            F RH  TLYERLLE+K+++ EVT EI NRK V+FA DL L+STQL +MGL F D  +Y E
Sbjct: 1128 FLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEE 1187

Query: 1231 LLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVM 1290
            LLRLSKRLI  D++HQWFEESLRQAY N+AFK+YT+DKVVQ+LVKH H+++TD K   VM
Sbjct: 1188 LLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVM 1247

Query: 1291 VLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKE 1350
             LFE+DRL   T+AKDQILYRL+ R+ M  +E MFRIEYN D  ++ IQY+A+DDLTLKE
Sbjct: 1248 KLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKE 1307

Query: 1351 PQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIE----KEAEYLDDEEQNDKFSP 1406
                +EKW YYVTSYSL HPTEGI  E +  PFL KI+E    +     ++ + N K+SP
Sbjct: 1308 GNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSP 1367

Query: 1407 EGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFP--------SSQSTQPASKMDKF 1458
            EGVS S  K+ IHP  Y L  + GS D+F+RKS+NK+P        S +  +  + ++ F
Sbjct: 1368 EGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTF 1427

Query: 1459 LNSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQTLTITAKIEEPNEPISKEDVP 1515
            L S+ GWKK+L        + ++ + K + + E  +T TI      P  P S  D P
Sbjct: 1428 LESNNGWKKHL--------KKQLSLKKNESEPESAETRTI------PAVPASTTDKP 1470

 Score =  177 bits (448), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 100/126 (79%)

Query: 199 SSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGF 258
           +SYRPLNVKDALSYLEQVK QF+SRPD+YN FLDIMKDFKSQ IDTPGVI+RV+TLF+G+
Sbjct: 208 ASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGY 267

Query: 259 PNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQNVENQ 318
           P+LIQGFNTFLP GY+I+C +NPNDPIKVTTP G++         Q   + +  Q   +Q
Sbjct: 268 PSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQALSQ 327

Query: 319 NIEMQQ 324
           N  MQQ
Sbjct: 328 NNMMQQ 333

 Score =  106 bits (264), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/59 (84%), Positives = 54/59 (91%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K  +VEFS AI+YVNKIK RFADQPDIYK FLEILQTYQREQKPI+EVYAQVTILFQN
Sbjct: 363 KKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQN 421

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 52/82 (63%), Gaps = 2/82 (2%)

Query: 195 QAQYSSYRPLNVK--DALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVT 252
           QA+ ++ +P +V+   A++Y+ ++K +F+ +PD+Y +FL+I++ ++ +      V  +VT
Sbjct: 357 QAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVT 416

Query: 253 TLFQGFPNLIQGFNTFLPHGYK 274
            LFQ  P+L+  F  FLP   K
Sbjct: 417 ILFQNAPDLLDDFKKFLPDSSK 438

 Score = 40.4 bits (93), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F  +PDIY QFL+I++ ++ +      V  +V+ LF+
Sbjct: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFR 265

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     + +  ++K RF     +Y  FL+IL  Y ++    +E+ ++V     ++ +L D
Sbjct: 368 VEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLD 427

Query: 745 WFKSFV 750
            FK F+
Sbjct: 428 DFKKFL 433

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1046 bits (2704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/881 (59%), Positives = 647/881 (73%), Gaps = 25/881 (2%)

Query: 645  GYPQPLEGVQYMEAPMARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGN 704
            GYPQ +           RPEIDLDPS+            D+++L +E  FF++ K+FI N
Sbjct: 615  GYPQDIS---------VRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINN 665

Query: 705  KQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVH 764
            KQ+Y EFLKILNLYSQ++L  +ELV KV++YL S+KELFDWFK FVGYQ+KPKHIENIVH
Sbjct: 666  KQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVH 725

Query: 765  EKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAH 824
            EKH+LDLDLCEA GPSYKKLPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDSGFIAH
Sbjct: 726  EKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAH 785

Query: 825  RKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHT 884
            RKNQYE+TLFK+EEERHEYDFYIESNLRTIQTLETIA+KIANMT EE+ NFKLP GLGHT
Sbjct: 786  RKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHT 845

Query: 885  SLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRE 944
            S+TI             GFE+IDALHE+PAV VPI+LKRLKQKDEEWRRAQREWNKVWRE
Sbjct: 846  SVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRE 905

Query: 945  LEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFE 1004
            L+QKVYYKSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNK++H LTPKPKSQLD++
Sbjct: 906  LQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYK 965

Query: 1005 INDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSS 1064
            + DR++LYDIL L   F+   ++YSN DK +L  F ++FISLFF  P+ D+  A+  RS 
Sbjct: 966  VADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIRSP 1025

Query: 1065 ITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDILRRTKNAKTXX---XXXXXXXXXXX 1121
            + D                  R++ D+D     DIL + K  K                 
Sbjct: 1026 LDDTKTDSEESSGDSDKFPKKRSIEDDD-ISFHDILDKVKYQKVKQGLDKNETFSNDISS 1084

Query: 1122 XXXXDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYER 1181
                D+ EL+ +EA KPWLLGS++D+AN+ GI+ +R  +N+F NT IYVF RHL TLYER
Sbjct: 1085 ATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYER 1144

Query: 1182 LLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITG 1241
            L E K+++AEVT+EIKNR IV FA DLNL+STQL +MGL F+ T +Y +LL LS RLI G
Sbjct: 1145 LNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEG 1204

Query: 1242 DLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRD 1301
            +L+H WFEESLRQA++NKAFK+YTIDKV QS+VKHAH+I++D K A +M+L E+DR    
Sbjct: 1205 NLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCAT 1264

Query: 1302 TTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYY 1361
            T++KDQILYRL+ R+ M  ++NMFRIE+N  S ++SIQY+ +DDLTL EP+  +EKW YY
Sbjct: 1265 TSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYY 1324

Query: 1362 VTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQ-NDKFSPEGVSQSKLKVNIHP 1420
            +TSY+LSHPTEG+ QE+I  PFL KI+E E  Y ++EE  NDK+SP+GVSQS LK+ I P
Sbjct: 1325 ITSYALSHPTEGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKGVSQSDLKIKISP 1384

Query: 1421 ETYELTFECGSTDVFTRKSVNKFP--------SSQSTQPASKMDKFLNSSKGWKKNLSTE 1472
            E Y L  E GS D F+R S+NK+P         ++      +++ FLN   GWK++LS +
Sbjct: 1385 ENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSED 1444

Query: 1473 IIGRAESKMKILKEQGKLEIDQTLTITAKIEEPNEPISKED 1513
             I     K   +K+ G L+ +  + + A I  PN+P+  ++
Sbjct: 1445 EINNINLKYSHIKKYGSLK-NYVVPVVAAI--PNKPLENKE 1482

 Score =  180 bits (457), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%)

Query: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260
           YRPLNVKDAL+YLEQVK QFSSRPD+YNHFLDIMKDFKSQ+IDTPGVI+RV+TLF+G+P+
Sbjct: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201

Query: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGP 301
           LIQGFNTFLP GY IEC+ NPNDPIKVTTP G+     A P
Sbjct: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAKP 242

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/59 (79%), Positives = 53/59 (89%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K  +VEFS A+SYVNKIK RF D+PDIYK FLEILQTYQ+EQKPIHEVY+QVTILFQN
Sbjct: 347 EKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 38/62 (61%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +VT LFQ  P+L+  F  F
Sbjct: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKF 416

Query: 269 LP 270
           LP
Sbjct: 417 LP 418

 Score = 38.5 bits (88), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 32/48 (66%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A++Y+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     V++  ++K RF+    +Y  FL+IL  Y ++     E+ S+V     ++ +L D
Sbjct: 352 VEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLD 411

Query: 745 WFKSFV 750
            FK F+
Sbjct: 412 DFKKFL 417

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1041 bits (2691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/943 (56%), Positives = 663/943 (70%), Gaps = 44/943 (4%)

Query: 560  FYPQSGVLMQPTN-------LPPLGNFSASGQASPAENSHMLPSMHQHIAGGHVIP---- 608
             YP SG    P+N       LPP+G+FS     S    ++      QH+   H +P    
Sbjct: 521  LYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQ---DQQHMQPPHFMPLPSI 577

Query: 609  -QH---VVTQGMSNQDIPVSEMRSTMNGTY--NQVEYIQGAPGYPQPLEGVQYMEAPMAR 662
             QH   +V QG++N++ P+S++R+++   Y  + +++ Q  P    P+   QY + P+ R
Sbjct: 578  VQHGPNMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQHPQSISPIANTQYGDIPV-R 636

Query: 663  PEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDL 722
            PEIDLDPS+            + I+L +EVTFFE+ KR+IGNK +Y EFLKILNLYSQD+
Sbjct: 637  PEIDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDI 696

Query: 723  LTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYK 782
            L   +LV KV+FYL S+KELF WFK+FVGYQEK K IENIVHEKHRLDLDLCEA GPSYK
Sbjct: 697  LDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYK 756

Query: 783  KLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHE 842
            +LPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHE
Sbjct: 757  RLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE 816

Query: 843  YDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXG 902
            YDFYIESNLRTIQ LETI NKI NMT  EK NFKLPPGLGHTS+TI             G
Sbjct: 817  YDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERG 876

Query: 903  FEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK 962
            FEIIDALHEHPAVT P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFK
Sbjct: 877  FEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFK 936

Query: 963  QADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFV 1022
            QADKKLLTTKQL+SEISSIKVDQTNK+IH LTPKPKSQLDF+  D+ + YDIL L  TF+
Sbjct: 937  QADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFI 996

Query: 1023 KTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAV-SERSSITDQXXXXXXXXXXXXX 1081
                +YSN DK +L    K FISLFFS   + + E++ S + ++++              
Sbjct: 997  THTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVSESSGSDDGSSIASRK 1056

Query: 1082 XXXXRTLSDEDSYLMKDILRRTK-------NAKTXXXXXXXXXXXXXXXXXDETELLAKE 1134
                + +S      + DIL R++       N +                  +E EL+ +E
Sbjct: 1057 RPYQQEMS------LLDILHRSRYQKLKRSNDEDGKVPQLSEPPEEEPNTIEEEELIDEE 1110

Query: 1135 AAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTD 1194
            A  PWL G+L++EAN+ GI+ +R IFNLF NT IY+FFRH  T+YERLLE+K+++  VT 
Sbjct: 1111 AKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTK 1170

Query: 1195 EIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQ 1254
            EI  R  V FA DL+L+S+QL++MGL F    AY ++LRLS+RLI GDL+HQWFEESLRQ
Sbjct: 1171 EINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQ 1230

Query: 1255 AYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKV 1314
            AY NKAFK+YTIDKV QSLVKHAH+++TD K A +M LF +DR    T+AKDQI+YRL+V
Sbjct: 1231 AYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQV 1290

Query: 1315 RNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGI 1374
            R+ M  +ENMFRIE++  + HVSIQY+A+DDLTLKEP+  ++KW YYVTSY+L HPTEGI
Sbjct: 1291 RSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGI 1350

Query: 1375 TQEDISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDV 1434
              E +  PFL ++IE   + +D  E +++FSPEG+S S LK+ I P TY+L  E GS DV
Sbjct: 1351 PHEKLKIPFLERLIEF-GQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDV 1409

Query: 1435 FTRKSVNKFPS--------SQSTQPASKMDKFLNSSKGWKKNL 1469
            FTRK+ NK+P+           +Q    + KFL+ + G + NL
Sbjct: 1410 FTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNL 1452

 Score =  182 bits (461), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 91/96 (94%)

Query: 199 SSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGF 258
           + YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVI+RV+TLF+G+
Sbjct: 214 ADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGY 273

Query: 259 PNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTT 294
           P LIQGFNTFLP GY+IECS+NP+DPI+VTTP GTT
Sbjct: 274 PILIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTT 309

 Score =  105 bits (261), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (91%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K  +VEFS AISYVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 401 KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 459

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L++ F  F
Sbjct: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470

Query: 269 LP 270
           LP
Sbjct: 471 LP 472

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 271

 Score = 32.7 bits (73), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/66 (22%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     +++  ++K RF     +Y  FL+IL  Y ++    +E+ ++V     ++ +L +
Sbjct: 406 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 465

Query: 745 WFKSFV 750
            FK F+
Sbjct: 466 DFKKFL 471

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/961 (55%), Positives = 666/961 (69%), Gaps = 46/961 (4%)

Query: 572  NLPPLGNFSASGQASPAENSHMLPSMHQHIAGGHVIP-----QH---VVTQGMSNQDIPV 623
            NLPP+G+FS     S   +++      QH+   H++P     QH   +V QG++N+++P+
Sbjct: 558  NLPPIGSFSPPTNGSTVHDNYQ---DQQHMQPPHLVPLPSMVQHGPNMVHQGIANENLPI 614

Query: 624  SEMRSTMNGTYNQVEYIQGAPGYPQ--PLEGVQYMEAPMARPEIDLDPSLXXXXXXXXXX 681
            S++R+++   Y    + Q     P   P+  +QY + P+ RPEIDLDPS+          
Sbjct: 615  SDLRTSLTDQYAPSTFQQQQQNPPSISPITDLQYGDVPV-RPEIDLDPSIVPVVPEPTEP 673

Query: 682  XXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKE 741
              D I+L +EVTFFE+ KR+IGNK +Y EFLKILNLYSQD+L   +LV KV+FYL S+KE
Sbjct: 674  IEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKE 733

Query: 742  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCW 801
            LF WFK+FVGYQEK K IENIVHEKHRLDLDLCEA GPSYK+LPK DTFMPCSGRD+MCW
Sbjct: 734  LFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCW 793

Query: 802  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIA 861
            E+LNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQ LETI 
Sbjct: 794  EILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIV 853

Query: 862  NKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVL 921
            NKI NMT  EK++FKLPPGLGHTS+TI             GFEIIDALHEHPAVT P+VL
Sbjct: 854  NKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVL 913

Query: 922  KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSI 981
            KRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQL+SEI+SI
Sbjct: 914  KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSI 973

Query: 982  KVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFK 1041
            KVDQTNK+IH LTPKPKSQLDF+  D+++ YDIL L  +F+    +YSN DK +L    K
Sbjct: 974  KVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLK 1033

Query: 1042 AFISLFFSYPIKDVNEAVSERSSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDILR 1101
             FISLFFS P++ + +A+       +                  R    E S L  DIL 
Sbjct: 1034 YFISLFFSIPLEKIEKALQFHK---ENVSESSGSDDGGSSTSRKRPYQQEMSLL--DILH 1088

Query: 1102 RTKNAKTXXXXXXXXXXXXXXXXXD-------ETELLAKEAAKPWLLGSLIDEANNSGIV 1154
            R +  K                  D       E EL+++EA  PWL G+L++EAN+ GI+
Sbjct: 1089 RNRYQKLKRSNDEEGKIPQLSEPLDEESNTIEEEELISEEARNPWLTGNLVEEANSQGII 1148

Query: 1155 SDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQ 1214
             +R IFNLF NT IY+FFRH  T+YERLLE+K+++ ++T E+  R  V FA DL+L+S Q
Sbjct: 1149 QNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQ 1208

Query: 1215 LADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLV 1274
            L +MGL F    AY ++LRLS+RLI GDL+HQWFEESLRQAY NKAFK+YTIDKV QSLV
Sbjct: 1209 LPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLV 1268

Query: 1275 KHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSS 1334
            KHAH+++ D K A +M LF +DR    T+AKDQI+YRL+VR+ M   ENMFRIE N  S 
Sbjct: 1269 KHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSL 1328

Query: 1335 HVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEY 1394
            HVS+QY+A+DDLTLKEP+  ++KW YYVTSY L HPTEGI+ E +  PFL ++IE   + 
Sbjct: 1329 HVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEF-GQD 1387

Query: 1395 LDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPS--------S 1446
             D  E +++FSPEG+S S L++ I P TY+L  E GS DVFTRK+VNK+P+         
Sbjct: 1388 TDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKE 1447

Query: 1447 QSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQTLTITAKIEEPN 1506
               Q  + + +FL ++   + +L+       + K+ +LK            +TAK+ + N
Sbjct: 1448 MVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLK-----------GVTAKVNDEN 1496

Query: 1507 E 1507
            E
Sbjct: 1497 E 1497

 Score =  183 bits (464), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (95%)

Query: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260
           YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVI+RV+TLF+G+P 
Sbjct: 224 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 283

Query: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTT 294
           LIQGFNTFLP GY+IECSTNP+DPI+VTTP GTT
Sbjct: 284 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTT 317

 Score =  105 bits (261), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (91%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K  +VEFS AISYVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 409 KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 467

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 269 LP 270
           LP
Sbjct: 479 LP 480

 Score = 38.1 bits (87), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279

 Score = 32.7 bits (73), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/66 (22%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     +++  ++K RF     +Y  FL+IL  Y ++    +E+ ++V     ++ +L +
Sbjct: 414 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 473

Query: 745 WFKSFV 750
            FK F+
Sbjct: 474 DFKKFL 479

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/964 (55%), Positives = 668/964 (69%), Gaps = 46/964 (4%)

Query: 572  NLPPLGNFSASGQASPA-----ENSHM-------LPSMHQHIAGGHVIPQHVVTQGMSNQ 619
            NLPP+G+FS     S       +  HM       LPSM QH A       ++V QG++N+
Sbjct: 571  NLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQHGA-------NIVHQGIANE 623

Query: 620  DIPVSEMRSTMNGTYNQVEYIQGAPGYPQ---PLEGVQYMEAPMARPEIDLDPSLXXXXX 676
            ++P+S++R+++   Y      Q    +PQ   P+   QY + P+ RPEIDLDPS+     
Sbjct: 624  NLPLSDLRTSLTEQYAPSNIQQQQQQHPQSISPIANSQYGDVPV-RPEIDLDPSIVPVVP 682

Query: 677  XXXXXXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYL 736
                   D I+L +EVTFFE+ KR+IGNK +Y EFLKILNLYSQD+L   +LV KV+FYL
Sbjct: 683  EPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYL 742

Query: 737  HSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGR 796
             S+KELF WFK+FVGYQE+ K IENIVHEKHRLDLDLCEA GPSYK+LPK DTFMPCSGR
Sbjct: 743  GSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGR 802

Query: 797  DEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQT 856
            D+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQ 
Sbjct: 803  DDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQC 862

Query: 857  LETIANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVT 916
            LETI NKI NMT  EK NFKLPPGLGHTS+TI             GFEIIDALHEHPAVT
Sbjct: 863  LETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVT 922

Query: 917  VPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLS 976
             P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQL+S
Sbjct: 923  APVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLIS 982

Query: 977  EISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKL 1036
            EISSIKVDQTNK+IH LTPKPKSQLDF+  D+ +  DIL L  +F+    +YSN DK +L
Sbjct: 983  EISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERL 1042

Query: 1037 DHFFKAFISLFFSYPIKDVNEAVSERSSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLM 1096
                K FISLFFS  ++++ E++        +                 R  S +    +
Sbjct: 1043 KDLLKYFISLFFSISLEEIEESLQAY-----KQSVSESSGSDDGGSSVSRKRSYQQEMTL 1097

Query: 1097 KDILRRTKNAKTXXXXXXXXXXXXXXXXXD-------ETELLAKEAAKPWLLGSLIDEAN 1149
             DIL R++  K                  D       E EL+ +EA  PWL G+L++EAN
Sbjct: 1098 LDILHRSRYQKLKRSKDEDGKVPQLSEAPDEESNIIEEEELINEEAKNPWLTGNLVEEAN 1157

Query: 1150 NSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLN 1209
            + G++ +R IFNLF NT IY+FFRH  T+YERLLE+K+++ +VT EI  R  V FA DL+
Sbjct: 1158 SQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLD 1217

Query: 1210 LISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKV 1269
            L+S QL++MGL F    AY ++L+LS+RLI GDL+HQWFEESLRQAY N+AFK+YTIDKV
Sbjct: 1218 LLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKV 1277

Query: 1270 VQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEY 1329
             QSLVKHAH+++TD K A +M LF +DR    T+AK QI+YRL+VR+ M  +ENMFRIE+
Sbjct: 1278 TQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEF 1337

Query: 1330 NTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIE 1389
            +  + HVSIQY+A+DDLTLKEP+  ++KW YYVTSY+L HPTEG+  E +  PFL ++IE
Sbjct: 1338 DKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLERLIE 1397

Query: 1390 KEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQS- 1448
               + +D ++ ++KFSPEG+S S LK+ I P TY+L  E GS DVFTRKS NK+P+  + 
Sbjct: 1398 F-GQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVAND 1456

Query: 1449 -------TQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKE-QGKLEIDQTLTITA 1500
                    Q    + +FL+ +   + +L+       + K + LK+   KL +D  + +  
Sbjct: 1457 DTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDTTAKLNVDGQV-VDT 1515

Query: 1501 KIEE 1504
            KIEE
Sbjct: 1516 KIEE 1519

 Score =  183 bits (465), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (95%)

Query: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260
           YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVI+RV+TLF+G+P 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTT 294
           LIQGFNTFLP GY+IECSTNP+DPI+VTTP GTT
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTT 322

 Score =  105 bits (261), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (91%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K  +VEFS AISYVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 414 KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 472

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L++ F  F
Sbjct: 424 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 483

Query: 269 LP 270
           LP
Sbjct: 484 LP 485

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 284

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1029 bits (2660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/954 (55%), Positives = 664/954 (69%), Gaps = 36/954 (3%)

Query: 572  NLPPLGNFSASGQASPAENSHMLPSMHQHIAGGHVIP--------QHVVTQGMSNQDIPV 623
            NLPP+G+FS     S    +H      QH+   H++P         ++V QG+ N++IP+
Sbjct: 564  NLPPIGSFSPPTNGS---TTHEGFQDQQHMQPPHLMPLPSMVQQGPNMVHQGIVNENIPL 620

Query: 624  SEMRSTMNGTYNQVEYIQGAPGYPQ--PLEGVQYMEAPMARPEIDLDPSLXXXXXXXXXX 681
            S++R+++   Y    + Q     P   P+   QY + P+ RPEIDLDPS+          
Sbjct: 621  SDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQYGDVPV-RPEIDLDPSIVPVVPEPTEP 679

Query: 682  XXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKE 741
              D I+L +EVTFFE+ KR+IGNK +Y EFLKILNLYSQD+L   +LV KV+FYL S+KE
Sbjct: 680  IEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKE 739

Query: 742  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCW 801
            LF WFK+FVGYQEK K IEN+VHEKHRLDLDLCEA GPSYK+LPK DTFMPCSGRD+MCW
Sbjct: 740  LFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCW 799

Query: 802  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIA 861
            EVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQ LETI 
Sbjct: 800  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIV 859

Query: 862  NKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVL 921
            NKI NMT  EK NFKLPPGLGHTS+TI             GFEIIDALHEHPAVT P+VL
Sbjct: 860  NKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVL 919

Query: 922  KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSI 981
            KRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEISSI
Sbjct: 920  KRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSI 979

Query: 982  KVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFK 1041
            KVDQTNK+IH LTPKPKSQLDF+  D+++ YDIL L  +F+    +YSN DK +L     
Sbjct: 980  KVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLN 1039

Query: 1042 AFISLFFSYPIKDVNEAVSERSSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDILR 1101
             FISLFFS P++ + EA+    S                     R    E S L  DIL 
Sbjct: 1040 YFISLFFSIPLEKIEEAL---QSYKQNLSDSSGSDDGDSSTPRKRPYQQEMSLL--DILH 1094

Query: 1102 RTKNAKTXXXXXXXXXXXXXXXXXD-------ETELLAKEAAKPWLLGSLIDEANNSGIV 1154
            R+K  K                  D       E EL+ +EA  PWL G+L++EAN+ GI+
Sbjct: 1095 RSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEELINEEAKNPWLTGNLVEEANSQGII 1154

Query: 1155 SDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQ 1214
             +R+IFNLF N+ IY+FFRH  T+YERLLE+K+++ +VT EI  R +V FA DL+L+S+Q
Sbjct: 1155 QNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQ 1214

Query: 1215 LADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLV 1274
            L++MGL F    AY ++L+LS+RLI G+L+HQWFEE LRQAY NKAFK+YTIDKV+Q LV
Sbjct: 1215 LSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLV 1274

Query: 1275 KHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSS 1334
            KHAH+++TD K A +M LF +DR    T+AKDQI+YRL+ R+ M  +ENMFR+E++  + 
Sbjct: 1275 KHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNL 1334

Query: 1335 HVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEY 1394
            HVS+QY+A+DDLTLKEP+  ++KW YYVTSY+L HPTEGI+ E +  PFL ++IE   + 
Sbjct: 1335 HVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEY-GQD 1393

Query: 1395 LDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQSTQPASK 1454
             D  E ++KFSPEG+S S LK+ I P TY+L  E GS DVFTRK+ NK+P+  +     +
Sbjct: 1394 TDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKE 1453

Query: 1455 M--------DKFLNSSKGWKKNLSTEIIGRAESKMKILK-EQGKLEIDQTLTIT 1499
            M         KFL+++   + +L+       + K+  LK    K ++D  +T+ 
Sbjct: 1454 MVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDDKITVA 1507

 Score =  184 bits (468), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 96/110 (87%), Gaps = 1/110 (0%)

Query: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVI+RV+TLF+G+P 
Sbjct: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126

Query: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTG-EVSAGPPTQYQLAP 309
           LIQGFNTFLP GY+IECSTNP+DPI+VTTP GTT    +  PP +  L P
Sbjct: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEP 176

 Score =  105 bits (261), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (91%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K  +VEFS AISYVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 249 KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 307

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 269 LP 270
           LP
Sbjct: 319 LP 320

 Score = 36.6 bits (83), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/855 (58%), Positives = 621/855 (72%), Gaps = 21/855 (2%)

Query: 657  EAPMARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILN 716
            E    RPEIDLDPSL            D + L +E  FF++VK++IGNK +YAEFLK+LN
Sbjct: 826  EENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLN 885

Query: 717  LYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEA 776
            LYS DLL   ELV K+++YL+ ++ELF WFK+FVGY EKPKHIENIVHEKH+LDLDLCEA
Sbjct: 886  LYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEA 945

Query: 777  CGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKV 836
            CGPSYKKLPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   +    ++
Sbjct: 946  CGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRL 1005

Query: 837  EEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXX 896
            +++ HEYDFYIESNLRTIQTLETIA+KIANMT  EK NFKLP GLGHT+ TI        
Sbjct: 1006 KKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKV 1065

Query: 897  XXXXXGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDH 956
                 GFEIIDALHE+PA+ VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDH
Sbjct: 1066 YDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDH 1125

Query: 957  LGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILD 1016
            LGLTFKQADKKLLTTKQL+SEISSIKVDQT+KR+H LTPKPKSQLDF + D+++++DIL 
Sbjct: 1126 LGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILS 1185

Query: 1017 LVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQXXXXXXXX 1076
             V  FV+  ++YSN +K +L  F K F SLFFS P++++ EA+S+R  IT++        
Sbjct: 1186 FVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKR-DITEKNDEKLEDK 1244

Query: 1077 XXXXXXXXXRTLSDEDSYLMKDILRRTKNAKTXXXXXXXXXXXXXXXXXDE-----TELL 1131
                     +  S + +  ++DIL+RTK  +                  D+      ELL
Sbjct: 1245 QKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKLLEEEELL 1304

Query: 1132 AKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAE 1191
             +EA KPWLLG+L++EAN  G +  R+IFN+F+NT +Y+F RHL T+YERL E+K+++ +
Sbjct: 1305 RQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDK 1364

Query: 1192 VTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEES 1251
            V+ EI  RKI +FA DLNLISTQL +MGL F +   Y +LL L KRLI GDL+HQWFEES
Sbjct: 1365 VSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEES 1424

Query: 1252 LRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYR 1311
            LRQA+ NKAFK+YT+DKV Q+LVKHAH+II+D K   +M LFE+DR K  T++KDQILYR
Sbjct: 1425 LRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYR 1484

Query: 1312 LKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPT 1371
            L+ R  M  +ENMFRIEYN  + H+ IQY+A+DDLT+K+ + ++EKW YY+TSY+LSHPT
Sbjct: 1485 LQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPT 1544

Query: 1372 EGITQEDISQPFLGKII----EKEAEYLDDEEQND---KFSPEGVSQSKLKVNIHPETYE 1424
            EGI QE+I  PFL +II      E E  DD++Q     K+SPEG+S S LK+ I P+ Y 
Sbjct: 1545 EGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQNYC 1604

Query: 1425 LTFECGSTDVFTRKSVNKFP------SSQSTQPASK--MDKFLNSSKGWKKNLSTEIIGR 1476
            L  E GS D+F+RKS+N+FP      S   T P  K  ++KFLNS  GWK+ +S + +  
Sbjct: 1605 LNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQMES 1664

Query: 1477 AESKMKILKEQGKLE 1491
             ESK   L   G LE
Sbjct: 1665 IESKWDHLSNNGNLE 1679

 Score =  180 bits (456), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/129 (68%), Positives = 99/129 (76%), Gaps = 10/129 (7%)

Query: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260
           YRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVI RV++LF  +P+
Sbjct: 299 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPS 358

Query: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQNVENQNI 320
           LIQGFNTFLP GY+IECS+NPN PI V TP GTT  VS    T            ENQN 
Sbjct: 359 LIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTT-VSGVLETSV---------TENQNH 408

Query: 321 EMQQQVSQP 329
           ++Q  + QP
Sbjct: 409 QLQHSLPQP 417

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/59 (79%), Positives = 54/59 (91%)

Query: 419 QQKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           Q++T +VEFS AISYVNKIK RFA+QP IYK FLEILQTYQREQKPI+EVY+QVT+LFQ
Sbjct: 537 QRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQ 595

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 42/62 (67%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A+SY+ ++K +F+++P +Y HFL+I++ ++ +      V  +VT LFQ  P+L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 269 LP 270
           LP
Sbjct: 608 LP 609

 Score = 39.3 bits (90), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 32/49 (65%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           A+SY+ ++K +F  +PD+Y  FL+I++ ++ +      V A+V+ LF +
Sbjct: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

 Score = 33.9 bits (76), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     +++  ++K RF     +Y  FL+IL  Y ++    +E+ S+V      + +L +
Sbjct: 543 VEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLE 602

Query: 745 WFKSFV 750
            FK F+
Sbjct: 603 DFKKFL 608

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/865 (58%), Positives = 616/865 (71%), Gaps = 34/865 (3%)

Query: 657  EAPMARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKILN 716
            EAP  RPEIDLDPS+            + I L +E +FFE+VK+FI +K +Y EFLK+LN
Sbjct: 713  EAP-TRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLN 771

Query: 717  LYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEA 776
            LYSQDLL+T+ELV++V++Y+ S+KELFDWFK+FVGY E P  IENI+HEKH+LDLDLCEA
Sbjct: 772  LYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEA 831

Query: 777  CGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKV 836
             GPSYKKLPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+
Sbjct: 832  YGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 891

Query: 837  EEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXXX 896
            EEERHEYDF+IESNLRTIQTLETIANKI NMT EEK NFKLP GLGHTS TI        
Sbjct: 892  EEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKV 951

Query: 897  XXXXXGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDH 956
                 GFEIIDALHEHPA  VPI+L+RLK+KDEEWRRAQREWNKVWRELEQKVYYKSLDH
Sbjct: 952  YDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDH 1011

Query: 957  LGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILD 1016
            LGLTFKQADKKLLTTKQL+SEISSI+VDQ NKRIH LTPKPKSQLDF  ND ++L DILD
Sbjct: 1012 LGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILD 1071

Query: 1017 LVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSIT-DQXXXXXXX 1075
            L   F+   ++YSNS+K +L  F + FI LFFS P  ++++ +S ++    ++       
Sbjct: 1072 LANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSS 1131

Query: 1076 XXXXXXXXXXRTLSDEDSYLMKDILRRTKNAKTXXXXXXXXXXXXXXXXXDET------- 1128
                      R+L  E    + D+LR+ K  K                   +        
Sbjct: 1132 TSNSTPSAKKRSL--ELDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELK 1189

Query: 1129 ----------ELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTL 1178
                       ++ +E  KPWLLGS+ID+ +  G++ +RHIFNLF NT IYVFFRH  T+
Sbjct: 1190 RQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTI 1249

Query: 1179 YERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRL 1238
            YERLLE+K+I+ +VT EI +RK+  FA DL LISTQL  MGL FK + +Y ELL L+KRL
Sbjct: 1250 YERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRL 1309

Query: 1239 ITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRL 1298
            I  D++HQWFEESLRQAY NKAFK+YT DKV+Q+LVKHA+SI+TD K + +M LFE+DRL
Sbjct: 1310 IKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRL 1369

Query: 1299 KRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKW 1358
            +  TT +DQI+YRL+ R  M  +ENMFRIE+N +++HV IQY+AV+DLTLK     KE W
Sbjct: 1370 RSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETW 1429

Query: 1359 DYYVTSYSLSHPTEGITQEDISQPFLGKIIEKE---AEYLDDEEQNDKF----SPEGVSQ 1411
            +YYVTSY+L HPTEG+ QE +  PFL K +  E   A+ LD+E + ++F    SPEG+S 
Sbjct: 1430 EYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGIST 1489

Query: 1412 SKLKVNIHPETYELTFECGSTDVFTRKSVNKFPS------SQSTQPASKMDKFLNSSKGW 1465
            SKLK+ I  ETY L  E GS DVF+RKS+NKFP+      S   + +   +KFL+S +GW
Sbjct: 1490 SKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKKIESSIKEKSEAFNKFLSSKRGW 1549

Query: 1466 KKNLSTEIIGRAESKMKILKEQGKL 1490
                  + +   E   K  +E G+ 
Sbjct: 1550 NNQFKPDQVAGIEEGWKKFQETGEF 1574

 Score =  165 bits (417), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 73/94 (77%), Positives = 84/94 (89%)

Query: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260
           YRPLNVKDALSYLEQVK QF+S+P +YN FLDIMKDFKSQ IDTPGVI+RV+TLF+G+P 
Sbjct: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329

Query: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTT 294
           LIQGFNTFLP GY I CS NP+DP++VTTP GT+
Sbjct: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTS 363

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%)

Query: 424 EVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           EVEFS AI+YVNKIKTR+ADQP IYK FLEILQTYQRE+KPI EVY QVT+LF +
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFND 518

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 41/62 (66%)

Query: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268
           A++Y+ ++K +++ +P +Y HFL+I++ ++ +      V ++VT LF   P+L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 269 LP 270
           LP
Sbjct: 530 LP 531

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 31/48 (64%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F  QP IY QFL+I++ ++ +      V  +V+ LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score =  986 bits (2548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/929 (53%), Positives = 634/929 (68%), Gaps = 40/929 (4%)

Query: 544  PPQ--PYLQQNQSMQGQGFYPQSGVLMQPTNLPPLGNFSAS--GQASPAENSHMLPSMHQ 599
            PP   P++ Q Q  Q      Q GV+    +LP + N + +   QA    +S ++   H 
Sbjct: 478  PPTNGPFVDQTQ--QSANPETQKGVM----SLPSMMNNAEAVKEQAIKQAHSRLISDSHD 531

Query: 600  HIAGGHVIPQHVVTQGMSNQDIPVSEMRSTM-NGTYNQVEYIQGAPGYPQPLEGVQYMEA 658
            H +   V+ Q++     SN DIPVS +R+T+    Y+     Q      Q +    Y+  
Sbjct: 532  HNSQQQVLSQNI----HSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGT 587

Query: 659  P---MARPEIDLDPSLXXXXXXXXXXXXDAIALGDEVTFFERVKRFIGNKQVYAEFLKIL 715
            P   + RPEIDLDPSL            +++ L +E  FFERVK+ IGNKQ+Y EFLKIL
Sbjct: 588  PSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKIL 647

Query: 716  NLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCE 775
            NL+S DLLT  ELV KVE+Y+ ++KELFDWFK FVGYQ+KPK IENIVHEKH+LDLDLCE
Sbjct: 648  NLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCE 707

Query: 776  ACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFK 835
            A GPSYKKLPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK
Sbjct: 708  AYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 767

Query: 836  VEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIXXXXXXX 895
            +EEERHEYD+YIESNLRTIQTLETIANKIANMT+ EK  F+LPPGLGHTS+TI       
Sbjct: 768  IEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRK 827

Query: 896  XXXXXXGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLD 955
                  GFEIIDALH +PA++VPI+L+RLKQKDEEWRRAQREWNK+WR+LEQKVY+KSLD
Sbjct: 828  VYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLD 887

Query: 956  HLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDIL 1015
            HLGLTFKQADKKLLTTKQL+SEI+ IKVDQ +KRIH LTPKPK+QLD++  D ++L+DI+
Sbjct: 888  HLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDII 947

Query: 1016 DLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSER------------- 1062
             L F F      YSN DK ++    + F+S FFS P+K+V++A+  R             
Sbjct: 948  ALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKG 1007

Query: 1063 SSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDILRRTKNAKTXXXXXXXXXXXXXX 1122
            S   DQ                 R   ++ +  M DIL +TK  KT              
Sbjct: 1008 SGKMDQIAEEIGETEQDTSSSKKRPFDNDLN--MSDILHKTKQQKTKMNKEMDGSKSPSE 1065

Query: 1123 XXXDETELLA-------KEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHL 1175
                +  +          E  K WL+G ++D AN    + +R+I+NLF NT IY+FFRHL
Sbjct: 1066 DLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHL 1125

Query: 1176 NTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLS 1235
             TLYERL EVK+I+ E+  EIK+R++  FA DL LISTQL+++GL F  + AY +LL LS
Sbjct: 1126 VTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLS 1185

Query: 1236 KRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQ 1295
            KRLI GD++HQWFEES+RQAY N+AFK+YTIDKVVQS VKHAH++I+D K + +M+LFE 
Sbjct: 1186 KRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFEN 1245

Query: 1296 DRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMK 1355
             R    TT KDQILYR++ R+ M  +ENMFRIEY  +  H SIQY+A+DDLTLK  ++ +
Sbjct: 1246 QRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPE 1305

Query: 1356 EKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLK 1415
            E W+YYVTSYSLS+PTEG+  E++  PFL K+IE + EY  D   N  +S  G+S+S L 
Sbjct: 1306 EAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLH 1365

Query: 1416 VNIHPETYELTFECGSTDVFTRKSVNKFP 1444
            ++I  E Y L  + GS+DV++R ++ K+P
Sbjct: 1366 IDIDREKYNLILQGGSSDVYSRATIQKYP 1394

 Score =  182 bits (462), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 81/103 (78%), Positives = 91/103 (88%)

Query: 200 SYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFP 259
           SYRPLNVKDALSYLEQVKFQF +RPD+YN FLDIMKDFKSQ IDTPGVI+RV++LF+G+P
Sbjct: 184 SYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYP 243

Query: 260 NLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPP 302
           NLIQGFNTFLP GY+IECS NPNDPIKVTTP G++  V    P
Sbjct: 244 NLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAP 286

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/59 (89%), Positives = 56/59 (94%)

Query: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478
           +K  +VEFS AI+YVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN
Sbjct: 332 KKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 390

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 199 SSYRPLNVK--DALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256
           S+ +P +V+   A++Y+ ++K +F+ +PD+Y  FL+I++ ++ +      V  +VT LFQ
Sbjct: 330 SAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 389

Query: 257 GFPNLIQGFNTFLP 270
             P+L+  F  FLP
Sbjct: 390 NAPDLLDDFKKFLP 403

 Score = 36.2 bits (82), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744
           +     +T+  ++K RF     +Y +FL+IL  Y ++     E+ ++V     ++ +L D
Sbjct: 337 VEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLD 396

Query: 745 WFKSFV 750
            FK F+
Sbjct: 397 DFKKFL 402

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 193 ALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  348 bits (893), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 253/798 (31%), Positives = 381/798 (47%), Gaps = 85/798 (10%)

Query: 694  FFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVG-Y 752
            F    +  + ++ +Y EFLK++NL++Q L+  +    +   +  S   L   F + +  Y
Sbjct: 206  FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265

Query: 753  QEKPKHIENIVHEKHRLDL-DLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGH 811
            ++  + ++  +      D+ D     GPSYK+L   +T   C GRD +C EVLNDEWVGH
Sbjct: 266  KDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGH 325

Query: 812  PVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIAN--KIANMTN 869
            PVWASE+ GFIAH+KNQYE+TLFKVEEERHEYDF++ S    I          +++    
Sbjct: 326  PVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDG 385

Query: 870  EEKNNFKLP--PGLGHTSLTIXXXXXXXXXXXXXGFEIIDALHEHPAVTVPIVLKRLKQK 927
              +N    P  P +   S+T              G  +IDA+  +P   VP +LK  K+K
Sbjct: 386  RRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEK 443

Query: 928  DEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTN 987
             ++W  A+ EWNK WRE+EQK YYKSLDHLGL FK A+K+ L  KQLL E  S K D+  
Sbjct: 444  YQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLL 503

Query: 988  KRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLF 1047
            K  +        +  +E  D+ VLYD+ D++   +++N+S S S K      F+AF  L 
Sbjct: 504  KEHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLL 558

Query: 1048 F--SYPIKDV------NEAVSERSSITDQXXXXXXXXXXXXXXXXXRTLSDEDSYLMKDI 1099
            F  S   K +      N A+S  S I++                      D ++  MK I
Sbjct: 559  FEESSFTKHLDFQFCHNPAISSNSQISE---------------------DDVEAMFMKGI 597

Query: 1100 LRRTKNAKTXXXXXXXXXXXXXXXXXDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHI 1159
            L                          E + L +  +    L        N  I  D +I
Sbjct: 598  L--------------------------EEKGLGRWFSNDTELKKEFSNRQNINIFCDINI 631

Query: 1160 FNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEI--KNRKIVQFASDLNLISTQLAD 1217
             +L         F ++ TLYER  +VK  +  +  ++  K R+    A  L L+  QL+D
Sbjct: 632  MSL---------FHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPMQLSD 682

Query: 1218 MGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHA 1277
             GL       Y  +   SK+ ++G+LDHQWFEESLR  ++NKA+K+YTID+V+++++   
Sbjct: 683  NGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNILGVI 742

Query: 1278 HSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVS 1337
             +I   P    ++ L   +  K  TT   Q+ YR KVR  M    +MFR+E   DS+ + 
Sbjct: 743  TTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDSNAIY 802

Query: 1338 IQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDD 1397
             QY+ VDDL   +    K +   Y   Y  +  T+ +  + ++ P+           L  
Sbjct: 803  GQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYS------LNLLKR 856

Query: 1398 EEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQSTQPASKMDK 1457
            EEQN  F    + +  L VNI+P  Y +    GS D+ +   + K  SS  +   ++M  
Sbjct: 857  EEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKLKSSLKSSRKTQMAS 916

Query: 1458 FLNSSKGWKKNLSTEIIG 1475
             ++     +K      IG
Sbjct: 917  LISKIAKNRKQQRARTIG 934

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 698 VKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQ---E 754
           ++ + G K +Y ++LK+LN   QD     + V   +     S ++ ++  + + YQ   E
Sbjct: 77  IQLYTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTE 136

Query: 755 KPKHIENIVHEK 766
           + K+I+N +H K
Sbjct: 137 RKKYIDNFIHSK 148

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 141,056,672
Number of extensions: 6152092
Number of successful extensions: 17072
Number of sequences better than 10.0: 54
Number of HSP's gapped: 17569
Number of HSP's successfully gapped: 157
Length of query: 1519
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1396
Effective length of database: 39,377,481
Effective search space: 54970963476
Effective search space used: 54970963476
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 73 (32.7 bits)