Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C06160g6.30ON1211216393e-87
ACL005C6.30ON1221185631e-75
SAKL0E01562g6.30ON1221225603e-75
Kwal_56.224726.30ON1221225594e-75
KLTH0C10934g6.30ON1221225561e-74
TDEL0G043906.30ON1221225403e-72
ZYRO0C07502g6.30ON1221185309e-71
Smik_15.1656.30ON1201185291e-70
Suva_15.1696.30ON1221185282e-70
Skud_15.1576.30ON1221185282e-70
CAGL0E02453g6.30ON1201185256e-70
YOL005C (RPB11)6.30ON1201185257e-70
KAFR0A051106.30ON1221225152e-68
KNAG0F029106.30ON1221185135e-68
NCAS0D021206.30ON1221185101e-67
TPHA0J004106.30ON1201185091e-67
Kpol_1037.216.30ON1201185082e-67
TBLA0E031506.30ON1181185041e-66
NDAI0C026706.30ON1221224971e-65
NCAS0G025502.163ON150741221e-08
TDEL0F011802.163ON1291021184e-08
YNL113W (RPC19)2.163ON1421021175e-08
Smik_14.2142.163ON1421021168e-08
KAFR0B045702.163ON1311011122e-07
SAKL0E10692g2.163ON1311041113e-07
ZYRO0B09878g2.163ON1301061113e-07
Suva_14.2252.163ON1421041113e-07
Skud_14.2182.163ON1561041124e-07
TBLA0B012902.163ON102811078e-07
CAGL0L03872g2.163ON1371001071e-06
KNAG0I020602.163ON1341011071e-06
Ecym_54232.163ON1271011062e-06
TPHA0B029202.163ON130921018e-06
AFL220C2.163ON1351011001e-05
Kpol_165.22.163ON128921001e-05
KLTH0D09350g2.163ON14673974e-05
NDAI0F027502.163ON14962975e-05
KLLA0F23760g2.163ON12788931e-04
Kwal_26.84732.163ON15073941e-04
Kpol_1033.336.188ON57827651.7
AGR316C5.161ON71385617.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06160g
         (121 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   250   3e-87
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   221   1e-75
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   220   3e-75
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   219   4e-75
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   218   1e-74
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   212   3e-72
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   208   9e-71
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   208   1e-70
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   207   2e-70
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   207   2e-70
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   206   6e-70
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   206   7e-70
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   202   2e-68
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   202   5e-68
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   201   1e-67
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   200   1e-67
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   200   2e-67
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   198   1e-66
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   196   1e-65
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    52   1e-08
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    50   4e-08
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    50   5e-08
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    49   8e-08
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    48   2e-07
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    47   3e-07
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    47   3e-07
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    47   3e-07
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    48   4e-07
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    46   8e-07
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    46   1e-06
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    46   1e-06
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    45   2e-06
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    44   8e-06
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    43   1e-05
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    43   1e-05
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    42   4e-05
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    42   5e-05
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    40   1e-04
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    41   1e-04
Kpol_1033.33 s1033 (91526..93262) [1737 bp, 578 aa] {ON} (91526....    30   1.7  
AGR316C Chr7 complement(1323148..1325289) [2142 bp, 713 aa] {ON}...    28   7.3  

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  250 bits (639), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 121/121 (100%), Positives = 121/121 (100%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATEDYG 120
           YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATEDYG
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATEDYG 120

Query: 121 M 121
           M
Sbjct: 121 M 121

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  221 bits (563), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (96%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLLPEGESKLK+E DTKA++A+I+TFEKEDHTLGN+IRAELLEDE VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHPLFA+F+MRIQT EGYDPK+ALKNACNSIINKLA L+SNFETEWNLQTLA+ED
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASED 118

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  220 bits (560), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 116/122 (95%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLLPEGESKL +E DTKA +A+I+TFEKEDHTLGNLIRAELLED+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLAT-EDY 119
           YKVEHPLFA+FKMRIQTVEGYDPKDALKNACN+II KLAQLQSNFETEW+LQTLA+ E+Y
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 120 GM 121
           G+
Sbjct: 121 GL 122

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  219 bits (559), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLLPEGE+KLK++ DTKA +A+IVTFEKEDHTL NLIRAELLED+GVLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED-Y 119
           YKVEHPLFA+FKMRIQT EGYDPKDALKNACN II+KL QLQSNFETEWNLQTLA+ED Y
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 120 GM 121
            M
Sbjct: 121 AM 122

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  218 bits (556), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLLPEGE+KLK++ DTKA +A+IVTFEKEDHTL NLIR ELLED+GVLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED-Y 119
           YKVEHPLFA+FK+RIQTVEGYDPKDALKNACN II+KL QLQSNFETEWNLQTLA+ED Y
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 120 GM 121
            M
Sbjct: 121 AM 122

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  212 bits (540), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 101/122 (82%), Positives = 113/122 (92%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKLK+E DTKA +A+++TFEKEDHTLGNLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED-Y 119
           YKVEHPLFA+FKMRIQTVEGYDPKDALKNACN IINKLA L++NFETEWNLQTLA++D Y
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 120 GM 121
           G+
Sbjct: 121 GI 122

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  208 bits (530), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 99/118 (83%), Positives = 109/118 (92%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKL+V+ DTKA +AI+VTFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHPLFA+FKMRIQT+EGYDPKDALKNACN IINKL  L++NFETEWNLQTLA++D
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDD 118

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  208 bits (529), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKLK++ DTKA +A+++TFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHP FA+FK+RIQT EGYDPKDALKNACNSIINKL  L++NFETEWNLQTLAT+D
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDD 118

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  207 bits (528), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (90%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKLK+E DTKA +A+++TFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHP FA+FK+RIQT EGYDPKDALKNACNSIINKL  L++NFETEWNLQTLA +D
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  207 bits (528), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (90%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKLK+E DTKA +A+++TFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHP FA+FK+RIQT EGYDPKDALKNACNSIINKL  L++NFETEWNLQTLA +D
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  206 bits (525), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKLK++ DTKA +A+++TFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHP FA+FK+RIQTVEGYDPKDAL+NAC+SIINKL  L+SNFETEWNLQTLA +D
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADD 118

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  206 bits (525), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 107/118 (90%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKLK++ DTKA +A+++TFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHP FA+FK+RIQT EGYDPKDALKNACNSIINKL  L++NFETEWNLQTLA +D
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  202 bits (515), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 112/122 (91%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKLK++ DTK+ +A+++TFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLAT-EDY 119
           YKVEHP FA+FK+R+QT+EGYDPK+ALKNACNSIINKL  L++NFETEWNLQTLA+ E++
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 120 GM 121
           G+
Sbjct: 121 GI 122

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  202 bits (513), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 94/118 (79%), Positives = 106/118 (89%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL +GESKL ++ DTK+ +AI++TF KEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHP FA+FK+RIQTVEGYDPKDALKNACN IINKL  L++NFETEWNLQTLAT+D
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDD 118

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  201 bits (510), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 93/118 (78%), Positives = 107/118 (90%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKL+++ DTKA +A+++TFEKEDHTLGNLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHP FA+FK+RIQTVEGYDPKDALKNACNSII+KL  L+ NFETEWNLQTLA ++
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  200 bits (509), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 93/118 (78%), Positives = 109/118 (92%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EG+SKL++EQDTKA++A+++TFEKEDHTLGNLIR ELL DE VLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHPLFA+FK+RIQT E YDPKDALK ACN+IINKL  L++NF+TEWNLQTLA++D
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDD 118

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  200 bits (508), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 93/118 (78%), Positives = 108/118 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPD+FELFLL EGESKL +E DTKA +A+++TFEKEDHTLGNLIR+ELL D  VLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHPLFA+FK+RIQTVE YDPKDALKNACN+IINKL  L++NFETEWNLQTLA+++
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDE 118

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  198 bits (504), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 92/118 (77%), Positives = 106/118 (89%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFE FLL EGESKL++E DTKA + +++TFEKEDHTLGNLI++ELL D  VLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118
           YKVEHPLFA+FKMRIQTVEGYDPKDAL+ ACNSII KL  L++NFETEWNLQTLA++D
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  196 bits (497), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60
           MNAPDRFELFLL EGESKL ++ DTKA +A+++TF+KEDHTLGNLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLAT-EDY 119
           YKVEHP FA FK+RIQTVEGYDPK ALKNACN+IINKL  L++NFETEWNLQTLA+ E++
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 120 GM 121
           G+
Sbjct: 121 GI 122

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 51.6 bits (122), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 8/74 (10%)

Query: 4   PDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKV 63
           PDR ++ +LPEG S    E  T AS  I+     EDHTLGN +R  ++++  V F  Y +
Sbjct: 50  PDREKVKILPEGAS----EDGTCASFQIV----DEDHTLGNALRYIIMKNPNVEFCGYSI 101

Query: 64  EHPLFAKFKMRIQT 77
            HP      +RIQT
Sbjct: 102 PHPSENFLNVRIQT 115

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 50.1 bits (118), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKV 63
           PDR ++ LLP+  S    E  T AS  I     +EDHTLGN +R  +++++ V F  Y +
Sbjct: 29  PDREKIKLLPQASS----EDGTCASFQIA----EEDHTLGNALRYVIMKNKDVEFCGYSI 80

Query: 64  EHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
            HP      +RIQT       D L+     +++    ++  F
Sbjct: 81  PHPSENLLNLRIQTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 49.7 bits (117), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKV 63
           PDR ++ LL +  S    E  T AS  I+    +EDHTLGN +R  ++++  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
            HP      +RIQT       DAL+     +++    ++S F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 49.3 bits (116), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKV 63
           PDR ++ LL +  S    E  T AS  I+    +EDHTLGN +R  ++++  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
            HP      +RIQT       DAL+     +++    ++S F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 50/101 (49%), Gaps = 8/101 (7%)

Query: 5   DRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKVE 64
           DR ++ +LP+  S    E  T AS  I+    +EDHTLGN +R  ++++  V F  Y + 
Sbjct: 32  DRNKIKILPQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPQVEFCGYSIP 83

Query: 65  HPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
           HP      +RIQT       DALK     +++    ++  F
Sbjct: 84  HPSENLLNIRIQTYGEITAVDALKKGLADLMDLCDVVEETF 124

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 15/104 (14%)

Query: 4   PDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKV 63
           PDR ++ LLP+  S      D   S++  ++  +EDHTLGN +R  ++++  V F  Y +
Sbjct: 31  PDREKIKLLPQATS------DDGTSASFQIS--EEDHTLGNALRYIIMKNPEVEFCGYSI 82

Query: 64  EHPLFAKFKMRIQTVEGYDPKDALK-------NACNSIINKLAQ 100
            HP      +RIQT       +AL+       + C+++ +K  Q
Sbjct: 83  PHPSENLLNVRIQTYGKITAVEALQKGLQDLMDMCDAVEDKFTQ 126

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 15/106 (14%)

Query: 2   NAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAY 61
           + PDR ++ +LP+  S    E  T AS  I     +EDHTLGN +R  ++++  V F  Y
Sbjct: 28  DEPDREKIKILPQATS----EDGTCASFQIA----EEDHTLGNALRYMIMKNPDVEFCGY 79

Query: 62  KVEHPLFAKFKMRIQTVEGYDPKDALKNA-------CNSIINKLAQ 100
            + HP      +R+QT       D L          C+++ +K  Q
Sbjct: 80  SIPHPSENLLNIRVQTYGNVTAVDVLHKGLQDLMDLCDAVEDKFTQ 125

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAY 61
           + PDR ++ LL +  S    E  T AS  I+    +EDHTLGN +R  ++++  V F  Y
Sbjct: 40  DEPDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
            + HP      +RIQT       +AL+     +++    ++S F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 47.8 bits (112), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAY 61
           + PDR ++ LL +  S    E  T AS  I+    +EDHTLGN +R  ++++  V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
            + HP      +RIQT       DAL+     +++    +++ F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 45.8 bits (107), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 35/81 (43%)

Query: 25  TKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKVEHPLFAKFKMRIQTVEGYDPK 84
           T   SA       EDHTLGN +R  L+ +  V F  Y + HP      +R+QT       
Sbjct: 15  TPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYGDITAS 74

Query: 85  DALKNACNSIINKLAQLQSNF 105
           DAL      +++    ++  F
Sbjct: 75  DALAQGLQDLMDLCDVVEDTF 95

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 6   RFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKVEH 65
           + ++ LLP+  S    E  T AS  I     +EDHTLGN +R  ++++  V F  Y + H
Sbjct: 40  KTKIKLLPQATS----EDGTCASFQI----AQEDHTLGNALRYIIMKNPEVEFCGYSIPH 91

Query: 66  PLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
           P      +RIQT       DAL+   + +I+    ++  F
Sbjct: 92  PSEELLNLRIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 48/101 (47%), Gaps = 8/101 (7%)

Query: 5   DRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKVE 64
           DR ++ +LPE  +    E  T AS  I+     EDHTLGN +R  ++++  V F  Y + 
Sbjct: 35  DREKVKILPEATT----EDGTCASFQIL----NEDHTLGNALRYVIMKNPEVEFCGYSIP 86

Query: 65  HPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
           HP      +RIQT       DA K     +++    ++  F
Sbjct: 87  HPSENWLNVRIQTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query: 5   DRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKVE 64
           DR ++ LLPE  S    E  T AS  I      EDHTLGN +R  ++++  V F  Y + 
Sbjct: 28  DRDKIRLLPEAAS----EDGTCASFQI----SDEDHTLGNALRYIIMKNPEVEFCGYSIP 79

Query: 65  HPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
           HP      +RIQT       +AL      +++    ++  F
Sbjct: 80  HPSETVLNLRIQTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 43.5 bits (101), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 16  ESKLKVEQDTKASSAIIVTFE--KEDHTLGNLIRAELLEDEGVLFAAYKVEHPLFAKFKM 73
           E K+K+  +  +      +F+  +EDHTLGN +R  ++++  V F  Y + HP      +
Sbjct: 32  EDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFCGYSIPHPSETLLNL 91

Query: 74  RIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
           RIQT       +AL+     +++    ++  F
Sbjct: 92  RIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 8/101 (7%)

Query: 5   DRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKVE 64
           DR ++ LLP+  S+          +        EDHTLGN +R  ++++  V F  Y + 
Sbjct: 36  DRDKIRLLPQATSE--------DGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIP 87

Query: 65  HPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
           HP      +RIQT       DAL      +++    ++  F
Sbjct: 88  HPSENFLNIRIQTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 16  ESKLKVEQDTKASSAIIVTFE--KEDHTLGNLIRAELLEDEGVLFAAYKVEHPLFAKFKM 73
           E K+K+     +      +F+   EDHTLGN +R  ++++  V F  Y + HP      +
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTVEGYDPKDALKNACNSIINKLAQLQSNF 105
           RIQT       +AL+     +++    ++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 42.0 bits (97), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 35  FEKEDHTLGNLIRAELLEDEGVLFAAYKVEHPLFAKFKMRIQTVEGYDPKDALKNA---- 90
             +EDHTLGN +R  ++++  V F  Y + HP      +RIQT   +   + L+      
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDL 128

Query: 91  ---CNSIINKLAQ 100
              C+++ +K  Q
Sbjct: 129 MDLCDAVEDKFTQ 141

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 42.0 bits (97), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 18  KLKVEQDTKASSAIIVTFE--KEDHTLGNLIRAELLEDEGVLFAAYKVEHPLFAKFKMRI 75
           K+K+ Q   +      +F+  +EDHTLGN +R  ++++  V F  Y + HP      +RI
Sbjct: 53  KIKILQQGASEDGCSASFQILQEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRI 112

Query: 76  QT 77
           QT
Sbjct: 113 QT 114

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%)

Query: 18  KLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAAYKVEHPLFAKFKMRIQT 77
           KL  E  ++  ++       EDHTLGN +R  ++++  V F  Y + HP      +RIQT
Sbjct: 33  KLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQT 92

Query: 78  VEGYDPKDALKNACNSIINKLAQLQSNF 105
                  +AL      +++    ++  F
Sbjct: 93  YGKITAVEALHKGLGDLMDMCDAVEDRF 120

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 35  FEKEDHTLGNLIRAELLEDEGVLFAAYKVEHPLFAKFKMRIQTVEGYDPKDALKNA---- 90
             +EDHTLGN +R  ++++  V F  Y + HP      +RIQT   +   + L+      
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQTYGKHTALEVLQKGLQDL 132

Query: 91  ---CNSIINKLAQ 100
              C+++ +K  Q
Sbjct: 133 MDLCDAVEDKFTQ 145

>Kpol_1033.33 s1033 (91526..93262) [1737 bp, 578 aa] {ON}
           (91526..93262) [1737 nt, 579 aa]
          Length = 578

 Score = 29.6 bits (65), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 22/27 (81%), Gaps = 1/27 (3%)

Query: 13  PEGESKLK-VEQDTKASSAIIVTFEKE 38
           PE ESKLK +E+DTK S A+I ++++E
Sbjct: 402 PEVESKLKSIEEDTKQSEALIQSYKEE 428

>AGR316C Chr7 complement(1323148..1325289) [2142 bp, 713 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL012C
           (VTC4)
          Length = 713

 Score = 28.1 bits (61), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 10  FLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGV-LFAAYKVEHPLF 68
           F LP G++++++  DT+ +      F+  D T GN  R ++  D        + VE+  +
Sbjct: 364 FQLP-GDARVRISLDTELTMVREDDFDGYDRTNGNWRRMDIGVDWPFKQLPEHDVEYFPY 422

Query: 69  AKFKMRIQTVEGYDPKDALKNACNS 93
           A  ++++QT  G +P + ++    S
Sbjct: 423 AVLEVKLQTQLGQEPPEWVRELVGS 447

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,212,963
Number of extensions: 450112
Number of successful extensions: 1379
Number of sequences better than 10.0: 49
Number of HSP's gapped: 1378
Number of HSP's successfully gapped: 49
Length of query: 121
Length of database: 53,481,399
Length adjustment: 90
Effective length of query: 31
Effective length of database: 43,161,459
Effective search space: 1338005229
Effective search space used: 1338005229
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)