Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C05852g6.46ON48248222960.0
SAKL0E01980g6.46ON4654888241e-105
ACL020W6.46ON5394997246e-89
KLTH0C10582g6.46ON4813857196e-89
Ecym_30496.46ON5015176885e-84
Kwal_56.225276.46ON4813856682e-81
NDAI0D008906.46ON5393416575e-79
ZYRO0C07172g6.46ON4503126392e-77
CAGL0J11792g6.46ON5103646163e-73
TDEL0G042406.46ON4443285973e-71
NCAS0H009006.46ON4953325813e-68
Smik_13.1066.46ON5063725656e-66
YML043C (RRN11)6.46ON5074755648e-66
KAFR0L004206.46ON4603605619e-66
Skud_13.1056.46ON5123715526e-64
Suva_13.1176.46ON5133715282e-60
TBLA0B005706.46ON5173294766e-53
KNAG0E009106.46ON4863194738e-53
TPHA0J005106.46ON4374034463e-49
Kpol_1037.116.46ON4013044242e-46
KAFR0I011405.573ON64544704.9
KLTH0E00968g5.706ON1148189696.9
Kpol_1014.442.21ON41436688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05852g
         (482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   889   0.0  
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   322   e-105
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   283   6e-89
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   281   6e-89
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   269   5e-84
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   261   2e-81
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   257   5e-79
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   250   2e-77
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   241   3e-73
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   234   3e-71
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   228   3e-68
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   222   6e-66
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   221   8e-66
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   220   9e-66
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   217   6e-64
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   207   2e-60
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   187   6e-53
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   186   8e-53
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   176   3e-49
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   167   2e-46
KAFR0I01140 Chr9 complement(228557..230494) [1938 bp, 645 aa] {O...    32   4.9  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...    31   6.9  
Kpol_1014.44 s1014 complement(85639..86883) [1245 bp, 414 aa] {O...    31   8.0  

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/482 (90%), Positives = 434/482 (90%)

Query: 1   MFQLPVIDXXXXXXXXXXXXXXXXXSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENX 60
           MFQLPVID                 SLKRKYDQLNYNQSEASVSSEADNVTNGILTPEN 
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 61  XXXXXXXXDLEKKHRRKRRLQSVLGNAXXXXXXXXXXXXXXXXXXXXXXQFYESHIKPQH 120
                   DLEKKHRRKRRLQSVLGNA                      QFYESHIKPQH
Sbjct: 61  ESSEAEAADLEKKHRRKRRLQSVLGNALDSSDEELDGDEDGTDENDPETQFYESHIKPQH 120

Query: 121 TFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDV 180
           TFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDV
Sbjct: 121 TFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDV 180

Query: 181 YPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILN 240
           YPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILN
Sbjct: 181 YPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILN 240

Query: 241 SLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTFVLTWLWTRLFIA 300
           SLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTFVLTWLWTRLFIA
Sbjct: 241 SLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTFVLTWLWTRLFIA 300

Query: 301 TSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDI 360
           TSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDI
Sbjct: 301 TSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDI 360

Query: 361 LLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYTDELSVNC 420
           LLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYTDELSVNC
Sbjct: 361 LLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYTDELSVNC 420

Query: 421 TDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPEVESAEFTVPAPIRFGYE 480
           TDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPEVESAEFTVPAPIRFGYE
Sbjct: 421 TDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPEVESAEFTVPAPIRFGYE 480

Query: 481 SD 482
           SD
Sbjct: 481 SD 482

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  322 bits (824), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/488 (39%), Positives = 272/488 (55%), Gaps = 46/488 (9%)

Query: 1   MFQLPVIDXXXXXXXXXXXXXXXXXSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENX 60
           MF+LPV+                  +L +K++QLN  +            T G+ TPE+ 
Sbjct: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQ-----------TVGLPTPESS 49

Query: 61  XXXXXXXXDLEKKH-----RRKRRLQSVLGNAXXXXXXXXXXXXXXXXXXXXXXQFYESH 115
                   +LE        RRKRRLQS+LG+A                        YE H
Sbjct: 50  AAETSDTDELEDSQSKRTKRRKRRLQSILGHAVSSSDEDDISEEENDNDYEECD--YEKH 107

Query: 116 IK-----PQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMY 170
           +K     PQ T+E+W      R P+    +TY   KK+ KAA + VT+ L+Y +K    +
Sbjct: 108 VKNKYYKPQETYELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAF 167

Query: 171 FQALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRS 230
           F A+  G++ Y   QL   +T H+ +L  LL+ NV+ QNWEIAYRCFSILIRL  VD+RS
Sbjct: 168 FSAIYNGYEPYETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRS 227

Query: 231 LWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTFVL 290
           +W IG  IL  + D + +E +LEW++ VF ++  FNQGTN+++DPVFR GS+THTP FV 
Sbjct: 228 IWGIGVRILKEI-DRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVT 286

Query: 291 TWLWTRLFIATS-----GSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLV 345
           +WLW  L   TS     G+  V+K   LQ L +++ E+VL+PPYMDD +IW+I+ L H+V
Sbjct: 287 SWLWETLMGCTSKDENNGNRDVNK---LQFLTEKISELVLTPPYMDDPKIWFIYALCHIV 343

Query: 346 MASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLV 405
            A  LS +F +++ I  GSR DIARNQVIQHI NAKN LQ C+    ++FP+  IE QL 
Sbjct: 344 EADHLSQQFIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLS 403

Query: 406 QLERSLY--TDELSVNCTDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPE 463
             E  LY  T++L +N  D  + +S+E      +  +D    DV P+    YE EN+  E
Sbjct: 404 NFENRLYQRTEDL-LNNFDSDSSASNE------FNRQD--FQDVNPI---VYEEENVFGE 451

Query: 464 VESAEFTV 471
           +  A+F +
Sbjct: 452 LGDAQFDI 459

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  283 bits (724), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 162/499 (32%), Positives = 263/499 (52%), Gaps = 27/499 (5%)

Query: 1   MFQLPVIDXXXXXXXXXXXXXXXXXSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENX 60
           MF+ P++                   ++RKY+QLN   S++   +  D+      TP+N 
Sbjct: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLN-GLSDSDKQAHIDSAC--FPTPDNS 102

Query: 61  XXXXXXXXDLE--------KKHRRKRRLQSVLGNAXXXXXXXXXXXXXX------XXXXX 106
                    LE        +  R++ RLQS+LG+A                         
Sbjct: 103 AAEASDGDALEGDVDTAARRLKRKRLRLQSILGHATLDAEEGDLGSEEEDDLNGGSTAKD 162

Query: 107 XXXQFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKK 166
              QF+  + KP++T+E+W  +   R PI+RK ++Y A K++E  + + +   L+  TKK
Sbjct: 163 YEKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKK 222

Query: 167 LNMYFQALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226
              Y + ++ G++  PK +++  + +HL HL  LLY+N++++NW  AYRCF++LIR++ V
Sbjct: 223 AAAYHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSV 282

Query: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTP 286
           D+RS+W++GS IL+ L +   +E +LEW+  VF S   F+Q     +DPVFR GSR HTP
Sbjct: 283 DLRSIWNLGSHILSHL-NFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHTP 341

Query: 287 TFVLTWLWTRLFIATSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVM 346
            F+L WLW  L  AT+    +D  + +  L++++ E+VL PPYMDD+EIW+++ + + + 
Sbjct: 342 NFMLAWLWLVLRGATA-DEVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYFIQ 400

Query: 347 ASELSSKFRQSKDILL-GSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLV 405
           A +LS++    + I L GS+ DIA+ QV Q+I + KNCL+ C+   N+ +PE +I+ QL+
Sbjct: 401 ADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERIIQEQLL 460

Query: 406 QLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPEVE 465
           + ER LY          E    +  D  E     ++ N   V   D       N  P+V 
Sbjct: 461 EFERRLY-----AGTHKEQTDGNSFDTYESDTGEQNDNPTMVSETDFHDPNFRNFKPDVA 515

Query: 466 SAEFTVPA--PIRFGYESD 482
             + T     P RF  +SD
Sbjct: 516 EDDDTAFGELPTRFEVDSD 534

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  281 bits (719), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 151/385 (39%), Positives = 216/385 (56%), Gaps = 27/385 (7%)

Query: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169
           +F+  H KPQ TFEVWN +     P+    ++Y+  K++EK A K V+  + + +K  N 
Sbjct: 109 EFFTRHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANF 168

Query: 170 YFQALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVR 229
           +FQA+K G++   +   S    +H+A LN+LL+TN++   W+ AYRCFS+LIRL  +D+R
Sbjct: 169 HFQAMKDGYETVAETPESHH-LVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIR 227

Query: 230 SLWSIGSEILNSLGDTQ----SNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHT 285
           S+W  G+ IL  L        ++E +L WL+ +F SR  FNQ  N+ +DPVFRCGS+TH 
Sbjct: 228 SVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHA 287

Query: 286 PTFVLTWLWTRLFI----ATSGSSAVDKE-KFLQSLIDRLDEMVLSPPYMDDSEIWYIFG 340
             FV+ WLW  LF      T   SA D   + L  L++RL EMVL PPYM+D E+W+IF 
Sbjct: 288 AKFVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFA 347

Query: 341 LTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANS-NYEFPENV 399
           + HLV A +LS +F  +K        DI+RNQV QHI NA  C++ C+A    + FP  +
Sbjct: 348 VCHLVSADQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRI 407

Query: 400 IEHQLVQLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIEN 459
           IE QL   E+ LY +      + ES  S    G E     E+        LDTQ      
Sbjct: 408 IEEQLACFEKRLYQN------SGESTASDLGSGFELDNSPEN--------LDTQNVLGPG 453

Query: 460 LIPEVESAE--FTVPAPIRFGYESD 482
           + P ++  E  F     + FG++SD
Sbjct: 454 MSPMIDEEENFFGSAEQVHFGFDSD 478

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  269 bits (688), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 170/517 (32%), Positives = 265/517 (51%), Gaps = 56/517 (10%)

Query: 1   MFQLPVIDXXXXXXXXXXXXXXXXXSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENX 60
           MF+ P+I                  SLKRKY+ L   Q  +  S++    T+G+ TP N 
Sbjct: 1   MFESPIISYNSKDRKRRKLKYKYINSLKRKYEHLVGTQGGSKGSTKD---TSGLPTPGNS 57

Query: 61  XXXXXXXXDLEKKHRRKRRL-------QSVLGNAXXXXXXXXXXXXXXXXXXXXXXQ--- 110
                     E+    + R        QS+LG+A                      +   
Sbjct: 58  AAEASDGDGREEDELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDDGYEDGY 117

Query: 111 ---------FYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLN 161
                    FY  +  P+ T+EVW  +   R PIQR+ ++Y+  + +EK A K V   L 
Sbjct: 118 LDEKDPEKIFYSKYYVPEETYEVWTTSINNRIPIQRRSMSYHVFRTIEKYAHKKVAASLA 177

Query: 162 YQTKKLNMYFQALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILI 221
             +KKL  +F+ ++ G++  P+ +++  + +HL HL  LLY N+L  +++ AYRCFS+LI
Sbjct: 178 LSSKKLTGFFEVIRSGYETCPRERITNYQKVHLHHLVDLLYINILRGDFDTAYRCFSLLI 237

Query: 222 RLEDVDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGS 281
           R+  VD+RS+W++GS+IL    +    E +LEW++ V  S   F Q +   LDPVFR GS
Sbjct: 238 RMNFVDLRSMWNLGSKILEHY-NLDDQERFLEWMSTVLTSNSAFPQNSKNQLDPVFRSGS 296

Query: 282 RTHTPTFVLTWLWTRLFIATSGSSAVDKEKFLQS------LIDRLDEMVLSPPYMDDSEI 335
           RTH P FVL+WLW  L       +AV KE+   S      L+D++ E+VL PPYMDD+E+
Sbjct: 297 RTHIPNFVLSWLWLVL------ENAV-KERVFSSGHDINWLLDKISELVLRPPYMDDAEV 349

Query: 336 WYIFGLTHLVMASELSSKFRQSKDI--LLGSRADIARNQVIQHINNAKNCLQMCKANSNY 393
           W+I+ + + + A +LS + +Q   +  L GS+ DIARNQVI++I++ KN L++C+    +
Sbjct: 350 WFIYAMCYFIKADKLSLQLKQEGSLNGLKGSQLDIARNQVIENIHHVKNHLRICEEKGGF 409

Query: 394 EFPENVIEHQLVQLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDSNLPD------- 446
           ++P+ VIE QLV+ E+ LY          ES+   +  G E ++P E+S+  D       
Sbjct: 410 QYPKRVIEAQLVEFEKRLYP---------ESSTHINYPGYE-TFPLEESDTEDNLVSINF 459

Query: 447 -VGPLDTQQYEIENLIPEVESAEFTVPAPIRFGYESD 482
                D Q  +  N+   ++     V  P+ FG  SD
Sbjct: 460 LQDRFDAQVIQDFNVQQPIDEDGPFVEQPVHFGMGSD 496

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  261 bits (668), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 144/385 (37%), Positives = 209/385 (54%), Gaps = 27/385 (7%)

Query: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169
           +F+  H KPQ T+E WN +      +    ++Y   K +E  A + V +++ + ++    
Sbjct: 109 EFFSHHEKPQDTYETWNTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIARS 168

Query: 170 YFQALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVR 229
           +F ++K G+++Y +P    Q T H+ HLN+LL+ NV+   WE A+RCFSILIRL  VD+R
Sbjct: 169 HFNSIKRGYEIYSRPSQVHQ-TTHITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIR 227

Query: 230 SLWSIGSEILNSLGDTQSNEA----YLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHT 285
           S+W +G  IL  L  T  N A    +L WL+ ++ SR  FN   N+ +DPVFR GS+ HT
Sbjct: 228 SMWGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPVFRTGSKKHT 287

Query: 286 PTFVLTWLWTRLFIAT-------SGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYI 338
             FV  WLW  LF A           +     K +Q L+++L EMVL PPYM+D EIW+I
Sbjct: 288 AKFVSAWLWEMLFAACPDKLEERQADNGSGNRKLIQ-LLEKLSEMVLIPPYMEDPEIWFI 346

Query: 339 FGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANS-NYEFPE 397
           + L HLV A ELS +F  +         DI+RNQV QHI NA NC++ C+A   ++ FP 
Sbjct: 347 YALCHLVSADELSQRFTFTYSESTELERDISRNQVTQHITNAHNCIRTCEAKGDDFFFPR 406

Query: 398 NVIEHQLVQLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEI 457
            +IE QL   ER LY + +  + T E     +     H++  +D  LP  G   +   E 
Sbjct: 407 RIIEEQLAFFERRLY-EHVGDSTTSEQDSPHEMTFEPHNFDTQD--LPSPGM--SSFVEE 461

Query: 458 ENLIPEVESAEFTVPAPIRFGYESD 482
           EN         F     + FG++SD
Sbjct: 462 ENY--------FGTAERVHFGFDSD 478

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  257 bits (657), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 139/341 (40%), Positives = 200/341 (58%), Gaps = 31/341 (9%)

Query: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169
           +F++ + KPQ TFE+W  N   R PI +  ITY  +KK+EK A + +T  L + +K   +
Sbjct: 129 KFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLLHASKINKL 188

Query: 170 YFQALKFGFD-VYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDV 228
            F+A+  G + V P   +      H+  L  LLY NV  +NW+IAYR F++LIR++ +D+
Sbjct: 189 CFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLLIRIKKLDI 248

Query: 229 RSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTF 288
           RS+W IG  IL+    T++ + +L W+  V+ SR+ F QG NY +DPVF+ GSRTHTP +
Sbjct: 249 RSIWGIGVRILSEKSPTKTLD-FLNWMNSVYSSRLNFIQGINYRMDPVFKSGSRTHTPKY 307

Query: 289 VLTWLWTRLFIATS----------------GSSA-------VDKEKFLQSLIDRLDEMVL 325
            LTWLW  L   ++                GSS+       +D+   L  LI+++ EMVL
Sbjct: 308 TLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSSELDIDINIDRNNLLD-LIEKISEMVL 366

Query: 326 SPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQ 385
            PP+M+DSE+W+I+ L H+V+A +LSSKF     I  GSR DI RNQVIQHI   K+ LQ
Sbjct: 367 IPPFMEDSEVWFIYSLCHMVLADDLSSKFNPL--ISNGSRGDIERNQVIQHIQKTKSYLQ 424

Query: 386 MCKANSNYEFPENVIEHQLVQLERSLYTDELSV---NCTDE 423
                 ++E+PE  I  QL   E+ LY  + +    N TDE
Sbjct: 425 TSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDE 465

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  250 bits (639), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 179/312 (57%), Gaps = 15/312 (4%)

Query: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169
           +FY  + KPQ TFE W  +   RTPIQR +I YN + ++++   + +   L   ++    
Sbjct: 100 KFYRKYEKPQLTFEKWQCDPRKRTPIQRNRINYNRMNRIQRHGLRRMETSLAVASRTNKT 159

Query: 170 YFQALKFGFDVYPKPQLSKQKTMHLAH---LNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226
           +F A   G+ ++  P   +  T  L H   L  LL+ NVL + WE+AY+CF++LIR+  V
Sbjct: 160 FFHATTQGYQLF-DPTYGRANTFQLKHIGTLTSLLHINVLKRKWELAYKCFALLIRIPGV 218

Query: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTP 286
           DVR+LW +G  IL     T+S E +L+W++ V+ +++ F    NY + PVF  GS+THTP
Sbjct: 219 DVRTLWGLGERILAERQPTRSLE-FLQWMSSVYSTKLPFADDVNYRMAPVFTKGSKTHTP 277

Query: 287 TFVLTWLWTRLFIATSG------SSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFG 340
            +  TWLW  L    +G       S    E F QSL+DR+ EMVL PPYMDD E+W+I+ 
Sbjct: 278 KYTTTWLWECLIRYANGLEDLEMDSKSAAENF-QSLMDRISEMVLGPPYMDDPEVWFIYA 336

Query: 341 LTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVI 400
           L H+V A  LS +F      L GS  DIA NQVIQHI N K+ LQ C +   + FP+  I
Sbjct: 337 LCHMVKADTLSQQFDPR---LTGSARDIASNQVIQHIQNTKSHLQQCSSKGGFTFPKRYI 393

Query: 401 EHQLVQLERSLY 412
             QL   E  LY
Sbjct: 394 ARQLAAFEARLY 405

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  241 bits (616), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 203/364 (55%), Gaps = 36/364 (9%)

Query: 111 FYESHIKPQHTFEVW----NVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKK 166
           FY  + KP+H+FEVW    +VNT  +  +++  I Y  + ++E+ A K V K + +    
Sbjct: 112 FYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLV 171

Query: 167 LNMYFQALKFGFDVY-PKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLED 225
              YF     G++V  P   +      H+  L Q+L+++V   NW+IAYR FS+LIR+ +
Sbjct: 172 NKRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPE 231

Query: 226 VDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHT 285
           VD+R++W +G+ IL   G T  +  +L+W++ V+ S+  F Q   +   PVFR GSRTHT
Sbjct: 232 VDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHT 291

Query: 286 PTFVLTWLWTRLFIAT---------------------SGSSAVDKEKFLQSLIDRLDEMV 324
           P + LTWLW  L   T                     S  SA+DK   L  LID++ EMV
Sbjct: 292 PKYALTWLWNCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDK---LTELIDKISEMV 348

Query: 325 LSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCL 384
           L PPY+DD EIW+I+ + H+V A  LS KF   +  L GSR DIARNQV QHI+  K  L
Sbjct: 349 LVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQR--LSGSRRDIARNQVTQHIHYVKTYL 406

Query: 385 QMCKANSNYEFPENVIEHQLVQLERSLYTDE-----LSVNCTDESAKSSDEDGIEHSYPN 439
           Q C    N+E+P+  I+ +L + E+ +Y DE     + +  + ++   S+ED  E+ +  
Sbjct: 407 QNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQI 466

Query: 440 EDSN 443
           ++SN
Sbjct: 467 DESN 470

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  234 bits (597), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 188/328 (57%), Gaps = 16/328 (4%)

Query: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169
           +F  ++  PQ +FE W  + + R PIQR KI++   ++L + A + +   ++  +K+  +
Sbjct: 106 KFLNNYELPQESFEKWQDDPSKRVPIQRSKISFTKYQRLRRHAKRKMNTSIDLASKRNKI 165

Query: 170 YFQALKFGFD----VYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLED 225
           Y   +  GF+    V  KP   + K  H++ L  LL+ +V  + W+ AY CF++LIR+  
Sbjct: 166 YMDTISEGFEMVDPVDGKPDTFQMK--HISILTTLLHLHVSRREWDAAYTCFALLIRVPK 223

Query: 226 VDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHT 285
           VD+R++W IG  IL      +S E +L W++ V+ SR  F +  N+   PVF  GS+TH 
Sbjct: 224 VDIRNIWGIGDLILREREPIKSLE-FLSWMSSVYSSRSAFAEDVNHRTPPVFTKGSKTHV 282

Query: 286 PTFVLTWLWTRLFIATSGS------SAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIF 339
           P F  TW+W  L   T  S        ++    LQ LI+R+ EMVL+PPYMD SE+W+I+
Sbjct: 283 PKFATTWMWESLIQCTKNSLETGELEQIESNDGLQDLIERISEMVLAPPYMDASEVWFIY 342

Query: 340 GLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENV 399
           GL HL+ A  LS++F      L GS  DIA NQVIQHI   K+CLQ C +  ++++P+  
Sbjct: 343 GLCHLIKADILSNQFDGR---LAGSARDIASNQVIQHIQRTKSCLQTCLSKGDFKYPKRY 399

Query: 400 IEHQLVQLERSLYTDELSVNCTDESAKS 427
           IE QL + E+ L   E + + +D   +S
Sbjct: 400 IERQLEEFEKRLDRQEDTPDDSDHEVES 427

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  228 bits (581), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 117/332 (35%), Positives = 196/332 (59%), Gaps = 19/332 (5%)

Query: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169
           +F+++H KPQ ++E+W+ +   R P+Q+K I+++ + K+EK+  + +   L + +K  N+
Sbjct: 102 RFFKTHEKPQESYEIWSTDNNKRMPLQKKFISFSKLNKIEKSTKRRMQGSLLHSSKFNNI 161

Query: 170 YFQALKFGFDVYPKPQLSKQKTM-HLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDV 228
            F+++  G ++       +  T+ H+ +L  LL+ NV+   WE+AY+ F++++R+  VD+
Sbjct: 162 CFESISQGQELVTPLHTPESFTLKHIENLTNLLHINVMKGKWEVAYKIFALMVRIPKVDI 221

Query: 229 RSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTF 288
           RS+W IG +IL+    T + + +L W+  V+ SR+ + QG  + +DPVFR GS+TH+  F
Sbjct: 222 RSIWGIGVKILSQRAATTTLD-FLVWMNSVYSSRINYIQGMTHRVDPVFRSGSKTHSSKF 280

Query: 289 VLTWLWTRLFIATS-----------GSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWY 337
            +TWLW  L   T            G    DK   LQ LI+++ E+VL PP+M+D+E+W+
Sbjct: 281 TITWLWKSLIYCTDTDNDEDIDSDYGGFGRDK---LQILIEKVSELVLIPPFMEDAEVWF 337

Query: 338 IFGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPE 397
           I+ L H+V A +LS  F  ++    GS  DIARN+VIQ+I   K  LQ   +  ++E+PE
Sbjct: 338 IYALCHMVKADQLSLNFNLNQS--NGSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPE 395

Query: 398 NVIEHQLVQLERSLYTDELSVNCTDESAKSSD 429
             I  QL   E  LY+ +   N  D+    SD
Sbjct: 396 RFITRQLNTFEERLYSKD-ETNSKDKDNNESD 426

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  222 bits (565), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 209/372 (56%), Gaps = 24/372 (6%)

Query: 110 QFYESHIKPQHTFEVW-NVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLN 168
           +F++ + KP+ +FEVW  V++  ++PI ++K+TY+  KK+EK + + +   L + TK+  
Sbjct: 126 KFWKKYEKPEESFEVWRTVSSQNKSPINKQKMTYHTFKKIEKNSLRKMEVPLLHCTKESK 185

Query: 169 MYFQALKFGFD-VYPK-PQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226
           ++FQ+L  G + + P   ++   +T H+  L  LL+ NV   NW +AY+ F+ LIR+  V
Sbjct: 186 LHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTNLLHLNVSRHNWSLAYKIFATLIRIPGV 245

Query: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNY-SLDPVFRCGSRTHT 285
            ++S+W IG EILN+  +  ++  +L+W+  ++ S+++F Q TNY S+ P F+ GSRTHT
Sbjct: 246 QIKSIWGIGVEILNNSPNLSTSLDFLQWMCQIYSSKLRFVQSTNYRSIVPPFQTGSRTHT 305

Query: 286 PTFVLTWLWTRLFIATSGSSAVD--------KEKFLQSLIDRLDEMVLSPPYMDDSEIWY 337
             F  T+LW+ L          D        +   LQ LIDR+ E VL+PP+M+D+E+W+
Sbjct: 306 SKFATTYLWSSLITCQKSMELPDINDKRYDMENDLLQDLIDRISEWVLTPPFMEDAEVWF 365

Query: 338 IFGLTHLVMASELSSKFRQSKDI--LLGSRADIARNQVIQHINNAKNCLQMCKANSNYEF 395
           I+   HL+ A  LS +F        L+G   DI  NQVI+HI+  K  LQ C     +  
Sbjct: 366 IYASCHLLKADILSRQFANDNKTSDLIGLDRDIKINQVIKHIHYVKVFLQTCSDKGGFTV 425

Query: 396 PENVIEHQLVQLERSLYTD--ELSVNCTDESAKSSDEDGIEHSYPNE--------DSNLP 445
           P  +IE QL   E  LY +  +L     D+   S D++ + +S+ +         D+ L 
Sbjct: 426 PNRLIESQLKGFESRLYGEAQDLREREMDDDYNSIDDNSVNNSFRDVYETNAEFLDTQLM 485

Query: 446 DVGPLDTQQYEI 457
           D+ P + Q  EI
Sbjct: 486 DLSPENNQLGEI 497

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  221 bits (564), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 143/475 (30%), Positives = 234/475 (49%), Gaps = 51/475 (10%)

Query: 28  KRKYDQLNYNQSEASVSSEADNVTNGILTPENXXXXXXXXXD--------------LEKK 73
           K KY  +NY        S+    T+ + TPEN         +               +KK
Sbjct: 18  KLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEGQNSEAGTYRRSVLQQKK 77

Query: 74  HRRKRRLQSVLGNAXXXXXXXXXXXXXX------------XXXXXXXXQFYESHIKPQHT 121
            RR+R  +SV+G                                    +F++ + KP+ +
Sbjct: 78  RRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKEDSDEERKFWKKYEKPEKS 137

Query: 122 FEVW-NVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDV 180
           FE+W  V++  + PI ++K+TY+  KK+EK   + +   L + TK+  +YFQ++  G + 
Sbjct: 138 FEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEP 197

Query: 181 Y--PKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEI 238
                 ++   +T H+  L  LL+ NV   NW +AY+ F+ LIR+  V ++SLW IG EI
Sbjct: 198 LKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEI 257

Query: 239 LNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNY-SLDPVFRCGSRTHTPTFVLTWLWTRL 297
           L++L ++ S   +L+W+  ++ S+ +F Q  NY S+ P F+ GSRTHT  F +T+LW+ L
Sbjct: 258 LDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSL 317

Query: 298 FIATS----GSSAVDK-----EKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMAS 348
                     S+ +DK        LQ LID++ E VL+PP+M+D+E+W+I+   HL+ A 
Sbjct: 318 INCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKAD 377

Query: 349 ELSSKF--RQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQ 406
            LS +F      + L+G   DI  NQVI+HI+  +  L++C     +  P  +IE+QL  
Sbjct: 378 TLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKS 437

Query: 407 LERSLYTDELSVNCTDESA--KSSDEDGIEHSYPNE--------DSNLPDVGPLD 451
            E  LY +   +   D +    S D   +E+S+ +         D+ L D+ P D
Sbjct: 438 FESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVYETNAEFLDTQLMDLSPED 492

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  220 bits (561), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 137/360 (38%), Positives = 194/360 (53%), Gaps = 22/360 (6%)

Query: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169
           +F++   KPQ T+E W  +   +T IQR  +TY+   K+ +   + +   L + + K   
Sbjct: 99  KFFKKIDKPQETYEHWPSHRK-KTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRY 157

Query: 170 YFQALKFGFDVYPKPQLSKQKT----MHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLED 225
           +F+    G ++     L K  T      +  L  LLY NV   NWEIAY+ F++LIR+  
Sbjct: 158 HFKCKIDGMEIVEP--LHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPK 215

Query: 226 VDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHT 285
           VD+RS+W++G+ IL      +S E +LEW++ V+ +RV F QG NY  DPVFR GS+ HT
Sbjct: 216 VDIRSVWNVGNRILYEKDKLRSLE-FLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHT 274

Query: 286 PTFVLTWLWTRLFIATSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLV 345
           P + L WLW  L   T      D E  +  LID++ EMVL PP+MDD EIW+I+ + H+V
Sbjct: 275 PKYTLQWLWNSLLEYTEQLFENDDEN-IDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMV 333

Query: 346 MASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANS--NYEFPENVIEHQ 403
            A  LSSKF       +GS  DI+ NQVIQHIN+ K  L +CK  S   YE  E +I  Q
Sbjct: 334 KADFLSSKFDTHS---VGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQ 390

Query: 404 LVQLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDS--------NLPDVGPLDTQQY 455
           L   E  LY + +     +      +E+ ++ S   EDS            +  LDTQQY
Sbjct: 391 LKAFEVRLYKEPVFPLEPENDLDGDNEEEVDESNVFEDSANYFEFDDTQEQLNDLDTQQY 450

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  217 bits (552), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/371 (34%), Positives = 204/371 (54%), Gaps = 24/371 (6%)

Query: 110 QFYESHIKPQHTFEVWNVNTAL-RTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLN 168
           +F++ H KP+ +FE+W   +   + PI R+K+TY+  +K++K + + V   L + TK+  
Sbjct: 132 KFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQIPLLHCTKENR 191

Query: 169 MYFQALKFGFDVY--PKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226
           +YF++L  G +    P   +   +T H+  L  LL+ NV   NW +AYR F+ LIR+ +V
Sbjct: 192 LYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYRIFATLIRIPEV 251

Query: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNY-SLDPVFRCGSRTHT 285
            ++S+W  G +IL++L D+ S+  +L+W+  ++ S+ +F Q  N+ S+ P F+ GSRTHT
Sbjct: 252 QMKSIWGFGVKILDNLPDSSSSLDFLQWMCQIYSSKARFVQNINHRSIVPPFQTGSRTHT 311

Query: 286 PTFVLTWLWTRLFIATSG--SSAVDKEKF------LQSLIDRLDEMVLSPPYMDDSEIWY 337
             F  T+LW  L         S ++ + +      LQ LID++ E VL+PP+M+D+E+W+
Sbjct: 312 AKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLTPPFMEDAEVWF 371

Query: 338 IFGLTHLVMASELSSKF--RQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEF 395
           I+   HL+ A  LS +F    +K  L+G   DI  NQVI+HI+  K  LQ C     +  
Sbjct: 372 IYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFLQTCLDKGGFTI 431

Query: 396 PENVIEHQLVQLERSLYTDELS------VNCTDESAKSSDEDGIEHSYPNE----DSNLP 445
           P  +IE QL   E  LY +         V+  DE+  SS E+     Y       D+ L 
Sbjct: 432 PNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFGDVYETNAEFLDTQLM 491

Query: 446 DVGPLDTQQYE 456
           D+ P D +  E
Sbjct: 492 DLSPEDNEMAE 502

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  207 bits (528), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 126/371 (33%), Positives = 209/371 (56%), Gaps = 24/371 (6%)

Query: 110 QFYESHIKPQHTFEVW-NVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLN 168
           +F++ + KP+ +FEVW  V++  ++PI ++KITY+  KK+EK + + +   L + TK+  
Sbjct: 133 KFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNYKKIEKNSLRKMEIPLLHCTKENK 192

Query: 169 MYFQALKFGFDVYPKPQLSKQ--KTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226
           +YFQ L  G +    P  + +  +T H+  L  LL+ NV   NW +AY+ F+ LIR+ +V
Sbjct: 193 LYFQLLAKGLEPLQSPTSAARNYQTRHIITLTNLLHLNVSRHNWPLAYKIFATLIRIPNV 252

Query: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNY-SLDPVFRCGSRTHT 285
            ++S+W IG +IL++  +  S+  +L+W+  V+ S+ +F Q  NY S+ P F+ GSRTHT
Sbjct: 253 QIKSIWGIGVKILDNSPNLSSSLDFLQWMCQVYSSKSRFVQNVNYRSVVPPFQTGSRTHT 312

Query: 286 PTFVLTWLWTRLFI---ATSGSSAVDKE-----KFLQSLIDRLDEMVLSPPYMDDSEIWY 337
             F +T+LW+ L     +   S+A D +       L+ LID++ E VL PP+M+D+E+++
Sbjct: 313 SKFAITYLWSCLISCQKSIESSNATDNQYDMENSRLEELIDQISEWVLIPPFMEDAEVYF 372

Query: 338 IFGLTHLVMASELSSKF--RQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEF 395
           I+   HL+ A  LS +F      + L+G   DI  NQVI++I+  K  LQ C     +  
Sbjct: 373 IYASCHLLKADLLSRQFVNDNRNNDLVGLNKDIKINQVIKNIHYVKVFLQTCLDKGGFTI 432

Query: 396 PENVIEHQLVQLERSLYTDELSV----------NCTDESAKSSDEDGIEHSYPNEDSNLP 445
           P  +IE+QL   E  LY +   +          N  + SA +S  D  E +    D+ L 
Sbjct: 433 PNRLIENQLKSFESRLYGEAQDIHERRMVDDYDNTDNSSADNSFGDVYETNAEFLDTQLM 492

Query: 446 DVGPLDTQQYE 456
           D+ P++ +  E
Sbjct: 493 DLSPVENEMAE 503

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  187 bits (476), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 107/329 (32%), Positives = 180/329 (54%), Gaps = 26/329 (7%)

Query: 110 QFYESHIKPQHTFEVWNVN-------TAL----RTPIQRKKITYNAVKKLEKAATKSVTK 158
           +F+  + +PQ +FEVWN +       T L    R PI R KI++N + +++K   K +  
Sbjct: 103 KFFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKFTNKKLEA 162

Query: 159 KLNYQTKKLNMYFQALKFGFDV-YPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCF 217
           +L + TK+L  + +A+  G++  Y   Q +    +H+ +L  LLY N+  +N+  AY  F
Sbjct: 163 RLQHCTKRLKTHIKAISEGYETSYRDKQTTSFNNIHIENLINLLYYNICEKNFNQAYHIF 222

Query: 218 SILIRLEDVDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVF 277
           S++IRL ++D+R+ W++GS IL      Q +  +L W+  ++ S  ++N   NY   P F
Sbjct: 223 SLIIRLPNIDIRNFWNLGSIILLKKVSIQESLNFLNWIHSIYSSNQKYNNSINYKTAPAF 282

Query: 278 RCGSRTHTPTFVLTWLWTRL-FIATSGSSAVDK--EKFLQSL----------IDRLDEMV 324
              SR HT  F  ++LW  L  I T  S    +  ++ ++ L          +++L EMV
Sbjct: 283 TQSSRNHTGKFTTSFLWMTLSLIHTKFSDLTSRNIKEIVEELNYLKKKLKKFVEKLSEMV 342

Query: 325 LSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCL 384
           L+PP+++DSEIWYI+ L+HL++A  L  + R +         DI +N++I +I + K+ L
Sbjct: 343 LAPPFIEDSEIWYIYSLSHLILARMLMFETRNNDISQTSVEKDITKNEIISNIQHCKSHL 402

Query: 385 QMCKANSN-YEFPENVIEHQLVQLERSLY 412
           Q  + N N Y F    IE +L  +E+ LY
Sbjct: 403 QKVRENQNDYNFKFQKIEIELKDMEKKLY 431

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  186 bits (473), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 105/319 (32%), Positives = 180/319 (56%), Gaps = 18/319 (5%)

Query: 110 QFYESHIKPQHTFEVWNVNTALR-TPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLN 168
           +++++H KP+  +EVW+V T  R  PIQR+ ++YN ++ +E+ A + +   L + ++  +
Sbjct: 111 KYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRS 170

Query: 169 MYFQALKFGFDVYPKP-QLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVD 227
             F A   G+DV  +  + +  +  H+  L  LL+ ++  +NW +AY+ F++LIR+  VD
Sbjct: 171 SEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVD 230

Query: 228 VRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPT 287
           +R++W++G  IL +  D+ +   +LEW+  V+ ++ +F Q  N+ L P FR GSRTHT  
Sbjct: 231 IRAVWNLGVAIL-ARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQ 289

Query: 288 FVLTWLWTRLFIAT--SGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLV 345
           +  TWLW  L  AT  +   A    + L+ L D+  E++L+PPYMDDSE+W+I+   + V
Sbjct: 290 YTTTWLWLSLRAATEQAQEGAPTTLEPLELLTDKTSELLLTPPYMDDSEVWFIYCSCYFV 349

Query: 346 MASELS----SKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMC---------KANSN 392
            A  LS    S    +      S  D+ RN+V+Q I   +  L            +A++ 
Sbjct: 350 KADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAY 409

Query: 393 YEFPENVIEHQLVQLERSL 411
           +E P   I+ QL Q+E+ L
Sbjct: 410 WELPTGYIKRQLQQIEKRL 428

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  176 bits (446), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 200/403 (49%), Gaps = 31/403 (7%)

Query: 30  KYDQLNYNQSEASVSSEADNVTNGILTPENXXXXXXXXXDLE-KKHRRKRRLQSVLGNAX 88
           K+++L+ N+    V+SE D    G    +          D E  + RR RR +S++G A 
Sbjct: 31  KHNELSKNELPTPVTSENDT---GGEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAI 87

Query: 89  XXXXXXXXXXXXXXXX------XXXXXQFYESHIKPQHTFEVWNVNTALRTP-IQRKKIT 141
                                      +++  + KPQ +FE W  N   R   + +  IT
Sbjct: 88  DDDEDDNNHDDDVDNEFEDNGPTDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFIT 147

Query: 142 YNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDVYPKPQLSKQKTM------HLA 195
           Y   KK  K   K    K  +  K +   F+ +  GF+      +S+ + +      HL+
Sbjct: 148 YYRFKKTRKQIDKKYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLS 207

Query: 196 HLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILNSLGDTQSNEAYLEWL 255
            L  L+Y+N+  Q W+IAY+CF+ L+R+ DVD+R +W++GS IL ++ DT     +L+WL
Sbjct: 208 LLTDLMYSNIFKQKWDIAYKCFTFLLRIPDVDIRRVWNLGSIILQNI-DTTKLIDFLQWL 266

Query: 256 AHVFPSRVQ-FNQGTNYSLDPV-FRCGSRTHTPTFVLTWLWTRLFIATSGSSAVDKEKFL 313
           ++V+ ++ + F QG NY  D   F  GSR  TP +  T LW +L +++   +    E  +
Sbjct: 267 SNVYSNKNRSFVQGINYRNDQTNFNGGSRRLTPLYTKTLLWHKLTLSSDSETC---ESEI 323

Query: 314 QSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSSKF----RQSKDI----LLGSR 365
            SLI+++ EMV+ PPY +D+EIWYIF L HLV A  LS K     R++ ++         
Sbjct: 324 DSLIEQIAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYD 383

Query: 366 ADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLE 408
            +I  N++   INN K  L+    + N+++P   IE +L  +E
Sbjct: 384 TEIYNNKITICINNCKKYLRKATQDKNFDYPARTIETKLKTIE 426

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  167 bits (424), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/304 (34%), Positives = 162/304 (53%), Gaps = 10/304 (3%)

Query: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169
           +++  + KP+ +FE W  NT  R  I RK ++Y    KL K + K +   L    +KL  
Sbjct: 98  KYFSRYDKPEDSFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQE 157

Query: 170 YFQALKFGFDVYP-KPQLSKQKTM-HLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVD 227
            F ++  G+++      L +  TM ++  L  L+Y ++  +NW+IAYRCF++LIRL    
Sbjct: 158 NFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTS 217

Query: 228 VRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQ---FNQGTNYSLDPVFRCGSRTH 284
           +R +W++GS I+ +L        +L+   ++  SR +   FNQ  NY   PVF  GSR  
Sbjct: 218 IRKIWNLGSMIIENLEGINKTIEFLKLFNNIH-SRYKKKIFNQTVNYREAPVFNDGSRNK 276

Query: 285 TPTFVLTWLWTRLFIATSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHL 344
           TP ++ T LW  +   ++ S           LI+ L E+ L PP+M+DSEIWYI+G+ HL
Sbjct: 277 TPIYIKTLLWKEITTTSTSSRTSSN---YNELIEYLSELTLIPPFMEDSEIWYIYGIVHL 333

Query: 345 VMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQL 404
             A+ELS       D    S+ DIA N+V+Q+I  A+  L+  K  S  E PE  I   +
Sbjct: 334 QRANELSMNLEHYIDNSSSSK-DIANNEVVQNIKLAQKFLKKAKELSKIEVPERQITLMI 392

Query: 405 VQLE 408
             +E
Sbjct: 393 KNIE 396

>KAFR0I01140 Chr9 complement(228557..230494) [1938 bp, 645 aa] {ON}
           Anc_5.573 YDR456W
          Length = 645

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 416 LSVNCTDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIEN 459
           +   C DE+ +S DE  IE   PN   NLPD+    T  Y  EN
Sbjct: 488 IKTGCIDENDQSDDEFDIEDIRPNLSYNLPDLS--TTHPYSDEN 529

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1148

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 80/189 (42%), Gaps = 26/189 (13%)

Query: 185 QLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLW---SIGSEILN- 240
           Q S Q +  L    Q +Y N++ Q  E+  RC S L   +  D+++LW    + +E++N 
Sbjct: 205 QTSSQTSQALVQKLQDIYRNIVKQEVELQERC-SQLTHSQTTDLKNLWIIYKVNTELINN 263

Query: 241 -------SLGDTQSNEAYLEWLAHVFPSRVQ---FNQGTNYSLDPVFRCGSRTHTPTFVL 290
                  +L  +Q  +  L     V   R++   +  GT   LD V +  S    P    
Sbjct: 264 YVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLD-VLKNFSNFMDPEVCC 322

Query: 291 TWLWTRLFIATSGSSAVDKEKFLQSLIDRLDEM-----VLSPPYMDD----SEIWYIFGL 341
            ++ T +FI+ S       +KF    ++RL ++      L P    D    +E WY   L
Sbjct: 323 QFI-THVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQAL 381

Query: 342 THLVMASEL 350
           +H+    +L
Sbjct: 382 SHIFGHGKL 390

>Kpol_1014.44 s1014 complement(85639..86883) [1245 bp, 414 aa] {ON}
           complement(85639..86883) [1245 nt, 415 aa]
          Length = 414

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 5/36 (13%)

Query: 409 RSLYTDEL-----SVNCTDESAKSSDEDGIEHSYPN 439
            SLYT  L     SVNC D S K+S+  G+ + YPN
Sbjct: 190 ESLYTGPLLELLDSVNCNDTSDKNSEPRGVFYDYPN 225

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,476,528
Number of extensions: 1956447
Number of successful extensions: 7158
Number of sequences better than 10.0: 37
Number of HSP's gapped: 7309
Number of HSP's successfully gapped: 38
Length of query: 482
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 369
Effective length of database: 40,524,141
Effective search space: 14953408029
Effective search space used: 14953408029
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)