Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C04433gna 1ON36736716360.0
SAKL0C07986gna 1ON3813859761e-130
KLTH0E15862gna 1ON3683748161e-106
Kwal_27.9830na 1ON3693657543e-97
Ecym_5262na 1ON3543616847e-87
KNAG0B033605.585ON407100760.59
Kpol_1023.645.585ON37958712.1
Suva_13.1215.585ON44151703.0
KNAG0C055802.551ON73787703.7
NDAI0C007505.585ON47740694.7
CAGL0E04290g5.585ON45681685.3
Skud_13.1135.585ON44151685.9
TPHA0K002205.585ON40041677.8
Kpol_1004.605.585ON45040669.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C04433g
         (367 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C04433g Chr3 (405523..406626) [1104 bp, 367 aa] {ON} conser...   634   0.0  
SAKL0C07986g Chr3 (742551..743696) [1146 bp, 381 aa] {ON} conser...   380   e-130
KLTH0E15862g Chr5 complement(1406851..1407957) [1107 bp, 368 aa]...   318   e-106
Kwal_27.9830 s27 (76603..77712) [1110 bp, 369 aa] {ON} [contig 4...   295   3e-97
Ecym_5262 Chr5 (544088..545152) [1065 bp, 354 aa] {ON} similar t...   268   7e-87
KNAG0B03360 Chr2 complement(649975..651198) [1224 bp, 407 aa] {O...    34   0.59 
Kpol_1023.64 s1023 complement(147038..148177) [1140 bp, 379 aa] ...    32   2.1  
Suva_13.121 Chr13 complement(192780..194105) [1326 bp, 441 aa] {...    32   3.0  
KNAG0C05580 Chr3 complement(1079810..1082023) [2214 bp, 737 aa] ...    32   3.7  
NDAI0C00750 Chr3 complement(143572..145005) [1434 bp, 477 aa] {O...    31   4.7  
CAGL0E04290g Chr5 (408757..410127) [1371 bp, 456 aa] {ON} simila...    31   5.3  
Skud_13.113 Chr13 complement(189116..190441) [1326 bp, 441 aa] {...    31   5.9  
TPHA0K00220 Chr11 complement(36900..38102) [1203 bp, 400 aa] {ON...    30   7.8  
Kpol_1004.60 s1004 (128824..130176) [1353 bp, 450 aa] {ON} (1288...    30   9.3  

>KLLA0C04433g Chr3 (405523..406626) [1104 bp, 367 aa] {ON} conserved
           hypothetical protein
          Length = 367

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/367 (89%), Positives = 327/367 (89%)

Query: 1   MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL 60
           MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL
Sbjct: 1   MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL 60

Query: 61  MFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIPV 120
           MFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIPV
Sbjct: 61  MFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIPV 120

Query: 121 SIYQMTRGVLILFVALFSVFFLKHKISRFEWLSXXXXXXXXXXXXYSGNVGVTVDVSLVT 180
           SIYQMTRGVLILFVALFSVFFLKHKISRFEWLS            YSGNVGVTVDVSLVT
Sbjct: 121 SIYQMTRGVLILFVALFSVFFLKHKISRFEWLSLFIVVFGVFLVGYSGNVGVTVDVSLVT 180

Query: 181 GVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGASITLLTMLIASVTFAQNK 240
           GVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGASITLLTMLIASVTFAQNK
Sbjct: 181 GVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGASITLLTMLIASVTFAQNK 240

Query: 241 QNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTNSMNATVRSTIDTCRTXX 300
           QNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTNSMNATVRSTIDTCRT  
Sbjct: 241 QNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTNSMNATVRSTIDTCRTLL 300

Query: 301 XXXXXXXXXXESFKLTQXXXXXXXXXXXXXXXXAITIDKKRLPQWLTKDYPGDDRIINVI 360
                     ESFKLTQ                AITIDKKRLPQWLTKDYPGDDRIINVI
Sbjct: 301 VWLVSLSLGWESFKLTQFNGFVLLVLGTLLFNGAITIDKKRLPQWLTKDYPGDDRIINVI 360

Query: 361 DEEVERF 367
           DEEVERF
Sbjct: 361 DEEVERF 367

>SAKL0C07986g Chr3 (742551..743696) [1146 bp, 381 aa] {ON} conserved
           hypothetical protein
          Length = 381

 Score =  380 bits (976), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 246/385 (63%), Gaps = 22/385 (5%)

Query: 1   MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL 60
           M++ LVI  +  LIVTGCINSIA+KYQDNQCVRDCD   PVLFEQPVLQTLQMFIGE S+
Sbjct: 1   MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV 60

Query: 61  MFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIPV 120
            FV+   +  +  G    P   S+ K  LP  +   LALPA+CDIC TTLMN+ALTMIPV
Sbjct: 61  -FVVLLLRVIAGGGS---PRPRSVEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPV 116

Query: 121 SIYQMTRGVLILFVALFSVFFLKHKISRFEWLSXXXXXXXXXXX---------------- 164
           S+YQMTRG LI+FVA+FS+ FL H+ISR EW S                           
Sbjct: 117 SVYQMTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVGCNGGSGSDGGSGGNN 176

Query: 165 -XYSGNVGVTVDVSLVTGVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGAS 223
              S      +  SL  GV LI++AQ+  A+QFV+EEHIMS+W + P  LV FEG++G S
Sbjct: 177 SLLSSVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGS 236

Query: 224 ITLLTMLIASVTFAQNKQNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTN 283
           ITL  ML+  +TFA    +S FN+V +  DMF +PRVLYSS+ IM SIACFNFFGI++TN
Sbjct: 237 ITLAVMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITN 296

Query: 284 SMNATVRSTIDTCRTXXXXXXXXXXXXESFKLTQXXXXXXXXXXXXXXXXAITIDKKRLP 343
           S+NAT RSTIDTCRT            ESFK  Q                AI + ++ LP
Sbjct: 297 SVNATARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLP 356

Query: 344 QWLTKDYPGD-DRIINVIDEEVERF 367
           ++L +DYP D +R+I+V+DEEV+RF
Sbjct: 357 RFLAEDYPQDYERLIDVVDEEVDRF 381

>KLTH0E15862g Chr5 complement(1406851..1407957) [1107 bp, 368 aa]
           {ON} conserved hypothetical protein
          Length = 368

 Score =  318 bits (816), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 171/374 (45%), Positives = 224/374 (59%), Gaps = 13/374 (3%)

Query: 1   MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL 60
           M +  + V  + ++V G +NS+ TKYQDNQCVRDC   SPV F QPVLQTLQMFIGE+S+
Sbjct: 1   MGQLFIPVICIGVVVCGGVNSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSM 60

Query: 61  MFVMFWQ-KYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIP 119
           + + ++Q +   R  +E        NK  +  R    LALPAICDI  TTLMNLAL MIP
Sbjct: 61  LALWWFQLRGTGRQQHEFD------NKPLIKGRSYVLLALPAICDIIATTLMNLALVMIP 114

Query: 120 VSIYQMTRGVLILFVALFSVFFLKHKISRFEWLSXXXXXXXXXXXXYSGNVGVTVD---- 175
           VSIYQM RG ++ FVALFSV FL  ++ R EW              YSG    TV     
Sbjct: 115 VSIYQMVRGAIVFFVALFSVLFLGRQVCRLEWAYLATIVAGVAVVGYSGQSADTVSEQSF 174

Query: 176 -VSLVTGVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGASITLLTMLIASV 234
             SL+ GVLLI+ A +  ATQF++EEH+MS+W + P  L+  EG++G+SIT+  +++ + 
Sbjct: 175 SSSLLVGVLLILFALLFMATQFIVEEHVMSRWAVSPVGLIGHEGLFGSSITVALLVVGNY 234

Query: 235 TFAQNKQNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTNSMNATVRSTID 294
                  NS+FN+  +  DMF  P VL SS +IM+SIA FNFFG+++T +++AT RST+D
Sbjct: 235 MGGYRDVNSTFNMKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITKNVSATSRSTVD 294

Query: 295 TCRTXXXXXXXXXXXXESFKLTQXXXXXXXXXXXXXXXXAITIDKKRLPQWLTKDYPGD- 353
           TCRT            ESFK TQ                AI I  K LP +  +D  G+ 
Sbjct: 295 TCRTLLVWCVSLSLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLPSYFLEDKSGES 354

Query: 354 DRIINVIDEEVERF 367
            R+IN IDEEVERF
Sbjct: 355 QRLINTIDEEVERF 368

>Kwal_27.9830 s27 (76603..77712) [1110 bp, 369 aa] {ON} [contig 43]
           FULL
          Length = 369

 Score =  295 bits (754), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 170/365 (46%), Positives = 220/365 (60%), Gaps = 14/365 (3%)

Query: 11  LSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISLMFVMFWQKYN 70
           + +IV GC+NS+ATKYQDNQCVRDCD  +P+ F QPVLQTLQMFIGE++++  +  Q+ +
Sbjct: 11  VGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMAMLAFLRGQQRS 70

Query: 71  SRNGYEAVPSAESLNKTKLPSRQSYAL-ALPAICDICGTTLMNLALTMIPVSIYQMTRGV 129
                  +P  +        S Q Y L ALPA+CDI  TTLMN AL MIPVSIYQMTRG 
Sbjct: 71  K------LPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPVSIYQMTRGA 124

Query: 130 LILFVALFSVFFLKHKISRFEWLSXXXXXXXXXXXXYSGNVGVT-----VDVSLVTGVLL 184
           ++ FVALFSV FL  +++RFEW S            YSG          +  S V G+ L
Sbjct: 125 IVFFVALFSVVFLHRRVTRFEWASLAIIVAGVAVVGYSGQEDEVLSEEVISTSSVFGISL 184

Query: 185 IVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGASITLLTMLIASVTFAQNKQNSS 244
           I++A    ATQF++EEHI+S+W I P  LV FEG +G SITL  +L+ +V      +NSS
Sbjct: 185 ILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITLAFLLVGNVAGGNRNKNSS 244

Query: 245 FNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTNSMNATVRSTIDTCRTXXXXXX 304
           FN+  +  DM+ +  VL SSIIIMISIA FNF G+++T  ++AT RST+DTCRT      
Sbjct: 245 FNMKQAFMDMYEHSAVLISSIIIMISIALFNFTGVSITKHVSATSRSTVDTCRTLLVWCV 304

Query: 305 XXXXXXESFKLTQXXXXXXXXXXXXXXXXAITIDKKRLPQWLTKDYPGDD--RIINVIDE 362
                 ESFK  Q                AI I  K LP++  +D    +  R+I+ IDE
Sbjct: 305 SLILGWESFKFMQLCGFVLLVLGTLLFNGAIEIPPKYLPRYFKEDSSEGERQRLIDTIDE 364

Query: 363 EVERF 367
           EVERF
Sbjct: 365 EVERF 369

>Ecym_5262 Chr5 (544088..545152) [1065 bp, 354 aa] {ON} similar to
           KLLA0C04433g - Kluyveromyces lactis
          Length = 354

 Score =  268 bits (684), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 151/361 (41%), Positives = 211/361 (58%), Gaps = 13/361 (3%)

Query: 1   MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL 60
           MR+  VI+  L +I+TGCINSIATKYQD QCVR+C + SP L +QPVLQT+QMF+GE S 
Sbjct: 1   MRQSFVILLCLGMIITGCINSIATKYQDKQCVRNCLTDSPELLQQPVLQTVQMFLGEASA 60

Query: 61  MFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIPV 120
           +F  +           A PS  S+ K  L ++ +  L++PA+CDICGTT+M+LALT++PV
Sbjct: 61  LFAFYL--------LGARPST-SVTKFLLQNKNTVLLSIPAVCDICGTTMMHLALTLVPV 111

Query: 121 SIYQMTRGVLILFVALFSVFFLKHKISRFEWLSXXXXXXXXXXXXYSGNVGVTVD---VS 177
           SIYQM RG L++ VA FSV FL  K++R EWLS             +G      D    +
Sbjct: 112 SIYQMVRGSLVIVVATFSVVFLNKKLTRGEWLSLYTVMFGIGIVGLTGFDDWNSDKPAAN 171

Query: 178 LVTGVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGASITLLTMLIASVTFA 237
            + G+ LI++AQ+  A Q+V+EEH++S++      +V FEG++G +ITL  +L+ + T A
Sbjct: 172 TLLGITLILVAQLFMAAQYVIEEHLISRYPFDSLEVVGFEGLFGGAITLFFLLLGTFTIA 231

Query: 238 QNKQNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTNSMNATVRSTIDTCR 297
               +S  N+   L+D+  +  ++ SS  IMISIA +NFFGI +TN MNAT RSTIDT R
Sbjct: 232 WKDPSSPLNLFQGLKDVSYSGNLMVSSFTIMISIAFYNFFGIAITNHMNATSRSTIDTSR 291

Query: 298 TXXXXXXXXXXXXESFKLTQXXXXXXXXXXXXXXXXAITIDKKRLPQWLTKDYPGDDRII 357
           T            E F   Q                AI+    ++PQ    DY G + + 
Sbjct: 292 TLLVWLVSLILGWERFSFLQLIGFALSVVGTLIFNGAISFANYQVPQ-RQHDYYGYEELP 350

Query: 358 N 358
           N
Sbjct: 351 N 351

>KNAG0B03360 Chr2 complement(649975..651198) [1224 bp, 407 aa] {ON}
           Anc_5.585 YML038C
          Length = 407

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 9/100 (9%)

Query: 112 NLALTMIPVSIYQMTRGVLILFVALFSVFFLKHKISRFEW-----LSXXXXXXXXXXXXY 166
           N++   +P+S+Y + +   I FV LFS  F   K+ +F W     +S             
Sbjct: 96  NVSFKFVPLSVYTIVKSSSIAFVLLFSCLF---KLEKFHWKLGAIVSVMFVGVALMVYKP 152

Query: 167 SGNVGVTVDV-SLVTGVLLIVLAQVCTATQFVLEEHIMSK 205
           +   G   D  +LV G LL++++   +  ++V  + I+ K
Sbjct: 153 NSTSGEDTDEGTLVFGALLVLMSAALSGLRWVFTQLILKK 192

>Kpol_1023.64 s1023 complement(147038..148177) [1140 bp, 379 aa]
           {ON} complement(147038..148177) [1140 nt, 380 aa]
          Length = 379

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 95  YALALP-AICDICGTTLMNLALTMIPVSIYQMTRGVLILFVALFSVFFLKHKISRFEW 151
           +   LP AI       L N++   +P++IY + +   I+FV LF   F   +I R+ W
Sbjct: 82  FKFILPTAIASAGDIGLSNVSFKFVPLTIYTILKSASIVFVLLFGCLF---RIERYHW 136

>Suva_13.121 Chr13 complement(192780..194105) [1326 bp, 441 aa] {ON}
           YML038C (REAL)
          Length = 441

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 101 AICDICGTTLMNLALTMIPVSIYQMTRGVLILFVALFSVFFLKHKISRFEW 151
           AI       L N++   +P+++Y + +   I FV LF   F   K+ RF W
Sbjct: 88  AIASAGDVGLSNVSFKYVPLTVYTIIKSSSIAFVLLFGCIF---KLERFHW 135

>KNAG0C05580 Chr3 complement(1079810..1082023) [2214 bp, 737 aa]
           {ON} Anc_2.551 YHL016C
          Length = 737

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 198 LEEHIMSKWIIPPSTLVAFEGIYGASITLLTMLIASVT-FAQNKQNSSFNIVYSLQDMFV 256
           L ++ +S  ++ P+  V   G  GA  TLL + +A  + FA    + S    Y +   ++
Sbjct: 329 LSDYEVSSGLVLPAAAVTVMGKGGAVATLLMIFLAVTSGFAAEVISVSSVFTYDIYRPYI 388

Query: 257 NPRVLYSSIIIMISIACFNFFGITLTN 283
           NP+     +I    +ACF  FG+ ++ 
Sbjct: 389 NPKATGKQLIYSSHLACF-VFGVGMSG 414

>NDAI0C00750 Chr3 complement(143572..145005) [1434 bp, 477 aa] {ON}
           Anc_5.585 YML038C
          Length = 477

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 112 NLALTMIPVSIYQMTRGVLILFVALFSVFFLKHKISRFEW 151
           N++   +P++IY   +   I FV LFS  F   KI +F W
Sbjct: 124 NVSFKFVPLTIYTTIKSSSIAFVLLFSCIF---KIEKFHW 160

>CAGL0E04290g Chr5 (408757..410127) [1371 bp, 456 aa] {ON} similar
           to uniprot|Q03697 Saccharomyces cerevisiae YML038c YMD8
          Length = 456

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 73  NGYEAVPSAESLNKTKLPSRQSY-ALALP-AICDICGTTLMNLALTMIPVSIYQMTRGVL 130
           N  E +   E+L + K   RQ +    LP AI       L N++L  +P++I+ + +   
Sbjct: 81  NNNEPIVDVETLEREK---RQLFWRFILPTAIFSAGDIGLGNMSLRYVPLTIHIIIKSSS 137

Query: 131 ILFVALFSVFFLKHKISRFEW 151
           I FV LFS  F   KI RF W
Sbjct: 138 ITFVLLFSCLF---KIERFHW 155

>Skud_13.113 Chr13 complement(189116..190441) [1326 bp, 441 aa] {ON}
           YML038C (REAL)
          Length = 441

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 101 AICDICGTTLMNLALTMIPVSIYQMTRGVLILFVALFSVFFLKHKISRFEW 151
           AI       L N++L  +P+++Y + +   I FV LF   F   K+ +F W
Sbjct: 88  AIASAGDIGLSNVSLQYVPLTVYTIIKSSSIAFVLLFGCAF---KLEKFHW 135

>TPHA0K00220 Chr11 complement(36900..38102) [1203 bp, 400 aa] {ON}
           Anc_5.585 YML038C
          Length = 400

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 101 AICDICGTTLMNLALTMIPVSIYQMTRGVLILFVALFSVFF 141
           AI         N +L  IP+SI+ + R   ++F+ LFSV F
Sbjct: 101 AIATAGDAGFSNTSLKYIPLSIFTIIRSANVVFILLFSVLF 141

>Kpol_1004.60 s1004 (128824..130176) [1353 bp, 450 aa] {ON}
           (128824..130176) [1353 nt, 451 aa]
          Length = 450

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 112 NLALTMIPVSIYQMTRGVLILFVALFSVFFLKHKISRFEW 151
           N +L  +P+++Y + +   I FV LF   F   K+ RF W
Sbjct: 100 NESLEYVPLTVYTIVKSSSIAFVLLFGCIF---KLERFHW 136

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,154,800
Number of extensions: 1026820
Number of successful extensions: 3230
Number of sequences better than 10.0: 20
Number of HSP's gapped: 3291
Number of HSP's successfully gapped: 20
Length of query: 367
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 256
Effective length of database: 40,753,473
Effective search space: 10432889088
Effective search space used: 10432889088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)