Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C03894g3.165ON47547523380.0
SAKL0C07414g3.165ON48249112611e-170
Ecym_52393.165ON46447512361e-167
Kwal_33.141823.165ON46749011861e-159
KLTH0F06534g3.165ON46648811841e-159
ZYRO0B04840g3.165ON47648611801e-158
TDEL0D045803.165ON48249211801e-158
CAGL0C05203g3.165ON47549011681e-156
Kpol_1045.443.165ON46948811631e-156
NCAS0C035803.165ON49150411581e-155
TBLA0F008403.165ON48149111421e-152
TPHA0P006603.165ON47348011381e-152
YOL062C (APM4)3.165ON49149411391e-152
Smik_15.963.165ON49149411351e-151
NDAI0G029203.165ON48648911211e-149
Skud_15.913.165ON49149411211e-149
Suva_15.1033.165ON49149411201e-149
ADR315W3.165ON49244210521e-139
KNAG0K011503.165ON47448010081e-132
KAFR0C010203.165ON4284808621e-111
ADL017C7.127ON4434885283e-61
Ecym_83507.127ON4454845284e-61
KLTH0F12584g7.127ON4414835275e-61
SAKL0F05346g7.127ON4474835266e-61
KLLA0D14311g7.127ON4434885181e-59
NDAI0E036807.127ON4444825152e-59
Kwal_55.208437.127ON4414875127e-59
KAFR0L004707.127ON4654935138e-59
Suva_16.457.127ON4785025131e-58
KNAG0L009507.127ON4614875093e-58
Smik_6.4667.127ON4765005103e-58
NCAS0E021407.127ON4814855042e-57
Skud_16.197.127ON4765035007e-57
YPL259C (APM1)7.127ON4755024963e-56
TBLA0A009507.127ON4694934945e-56
TDEL0H028907.127ON4424834803e-54
CAGL0K00539g7.127ON4564814813e-54
Kpol_1062.567.127ON4504854786e-54
TPHA0C043207.127ON4544804743e-53
ZYRO0C05236g7.127ON4474844734e-53
SAKL0D13090g2.555ON4995183176e-31
Kwal_26.81462.555ON5055373161e-30
KLTH0D07502g2.555ON5045293114e-30
KLLA0F25432g2.555ON5074802947e-28
ABR047W2.555ON4984922726e-25
Ecym_45912.555ON5015452663e-24
KAFR0A020602.555ON5403492655e-24
TDEL0B064302.555ON5255572488e-22
Kpol_1056.132.555ON5415662425e-21
ZYRO0E05874g2.555ON5493332363e-20
CAGL0K03223g2.555ON5983692177e-18
TPHA0I023902.555ON5593542151e-17
KNAG0C055502.555ON5823542123e-17
Skud_8.262.555ON5963602123e-17
Suva_8.332.555ON5963692052e-16
Smik_8.232.555ON6033642033e-16
YHL019C (APM2)2.555ON6053642025e-16
NCAS0A126502.555ON5883592025e-16
Kwal_26.79572.522ON4563131846e-14
TBLA0B067602.555ON6572381793e-13
KLTH0D06556g2.522ON4563191686e-12
NDAI0B016102.555ON6722691624e-11
TDEL0A029702.522ON4963281553e-10
KAFR0D035602.522ON4551421472e-09
KLLA0E18789g2.522ON4971441402e-08
AGL061W2.522ON4113141347e-08
SAKL0A09218g2.522ON4731401322e-07
TBLA0I006202.522ON6091631251e-06
Kpol_1018.422.522ON5751551205e-06
ZYRO0B01738g2.522ON4921561124e-05
NCAS0A048702.522ON4891641107e-05
Suva_4.5482.522ON4841411072e-04
Smik_2.4302.522ON4841401062e-04
CAGL0L02145g2.522ON5432251053e-04
TPHA0C041302.522ON5331631010.001
YBR288C (APM3)2.522ON4831391000.001
KNAG0A069702.522ON505150890.024
Ecym_72662.522ON517200890.029
KNAG0D025308.76ON18779810.11
YHR064C (SSZ1)5.335ON53858780.61
KAFR0B017808.76ON19069731.2
Smik_8.1355.335ON53858741.7
NCAS0A036208.76ON23168704.0
Smik_12.5314.315ON128555706.0
NCAS0J022904.375ON1639127696.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C03894g
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   905   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   490   e-170
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   480   e-167
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   461   e-159
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   460   e-159
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   459   e-158
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   459   e-158
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   454   e-156
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   452   e-156
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   450   e-155
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   444   e-152
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   442   e-152
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   443   e-152
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   441   e-151
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   436   e-149
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   436   e-149
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   436   e-149
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   409   e-139
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   392   e-132
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   336   e-111
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   207   3e-61
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   207   4e-61
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   207   5e-61
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   207   6e-61
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   204   1e-59
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   202   2e-59
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   201   7e-59
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   202   8e-59
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   202   1e-58
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   200   3e-58
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   201   3e-58
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   198   2e-57
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   197   7e-57
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   195   3e-56
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   194   5e-56
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   189   3e-54
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   189   3e-54
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   188   6e-54
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   187   3e-53
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   186   4e-53
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   126   6e-31
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   126   1e-30
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   124   4e-30
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   117   7e-28
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   109   6e-25
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   107   3e-24
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   106   5e-24
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   100   8e-22
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    98   5e-21
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    96   3e-20
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    88   7e-18
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    87   1e-17
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    86   3e-17
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    86   3e-17
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    84   2e-16
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    83   3e-16
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    82   5e-16
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    82   5e-16
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    75   6e-14
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    74   3e-13
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    69   6e-12
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    67   4e-11
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    64   3e-10
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    61   2e-09
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    59   2e-08
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    56   7e-08
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    55   2e-07
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    53   1e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    51   5e-06
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    48   4e-05
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    47   7e-05
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    46   2e-04
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    45   2e-04
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    45   3e-04
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    44   0.001
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    43   0.001
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    39   0.024
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    39   0.029
KNAG0D02530 Chr4 complement(444969..445532) [564 bp, 187 aa] {ON...    36   0.11 
YHR064C Chr8 complement(225525..227141) [1617 bp, 538 aa] {ON}  ...    35   0.61 
KAFR0B01780 Chr2 (348976..349548) [573 bp, 190 aa] {ON} Anc_8.76...    33   1.2  
Smik_8.135 Chr8 complement(200821..202437) [1617 bp, 538 aa] {ON...    33   1.7  
NCAS0A03620 Chr1 (722990..723685) [696 bp, 231 aa] {ON} Anc_8.76...    32   4.0  
Smik_12.531 Chr12 complement(936396..940253) [3858 bp, 1285 aa] ...    32   6.0  
NCAS0J02290 Chr10 (438857..443776) [4920 bp, 1639 aa] {ON} Anc_4...    31   6.7  

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/475 (93%), Positives = 443/475 (93%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
           SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120

Query: 121 NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXXXXXX 180
           NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNI                   
Sbjct: 121 NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSIALSSL 180

Query: 181 XECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGL 240
            ECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGL
Sbjct: 181 SECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGL 240

Query: 241 NDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHV 300
           NDTYSIHGNEKSELSIVEMMSEYD            GSVILEDCKFHQCVQLNKYEANHV
Sbjct: 241 NDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQLNKYEANHV 300

Query: 301 IQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTV 360
           IQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTV
Sbjct: 301 IQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTV 360

Query: 361 KIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSHDLSDL 420
           KIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSHDLSDL
Sbjct: 361 KIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSHDLSDL 420

Query: 421 LRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGAYEIRY 475
           LRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGAYEIRY
Sbjct: 421 LRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGAYEIRY 475

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  490 bits (1261), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 240/491 (48%), Positives = 336/491 (68%), Gaps = 25/491 (5%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           ML+A+F+++ KG+L++SKLI+D +KRS+A++FR QVIN+  VRSP+LTLGSTTF H IR 
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHH-IRS 59

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
           SS+   +W+VAV+RSN DS+ IWE+L+K   L+EA+G+N E+ LK+EFM  YE+L++ LE
Sbjct: 60  SSN---LWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE 116

Query: 121 NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFL--SGSNIXXXXXXXXXXXXXXXXX 178
           NG+P  T+L+ +  ++SR+P+   ++  +P  D+ L  + +N+                 
Sbjct: 117 NGVPVDTELSSVASKMSRRPVV--SLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSS 174

Query: 179 XXXE-----------C--PWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVD 225
                          C  PWR SG+KYKKNE++LD+NE+I ILV KDGSI+KS+VDGSVD
Sbjct: 175 SSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234

Query: 226 CVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCK 285
             +HLSG PLCQ GLND+ S+ G   S    ++ +SEY+            GSV LEDCK
Sbjct: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSR--DLDFISEYEVKNKKAIPKAAAGSVQLEDCK 292

Query: 286 FHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEI-VKNSTLNYKVT 344
           FHQCVQLN++  + +I+FVPPDG F+LM+Y V DN+N+PF + P   +   N  + Y+V 
Sbjct: 293 FHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVA 352

Query: 345 LRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTL 404
           L+SLFPS ++AKDV ++IPVPP T+ C  N S G+C++   E  ++WK+ KY+G TENTL
Sbjct: 353 LKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTL 412

Query: 405 SGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
           S  + +P  +    +L +WSRPP+S+ FEI+MFSNSGLVVR  K  E   +Y  VKW+KY
Sbjct: 413 SA-LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471

Query: 465 ISHSGAYEIRY 475
           IS SGAYE+RY
Sbjct: 472 ISRSGAYEVRY 482

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  480 bits (1236), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 242/475 (50%), Positives = 318/475 (66%), Gaps = 11/475 (2%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+SA+F+Y+ +GDL+ISKLIKD++K  ++++FR QVIN+  VRSPILTLGSTTF H+   
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHI--- 57

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
              N  +WLV VSR N DS+ IWE+L+   +L+E + IN ED L+ +FML YEIL++ L+
Sbjct: 58  -RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD 116

Query: 121 NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXXXXXX 180
           NGIP+ T+L  I+P +S+KP+  N +      DD L+  +                    
Sbjct: 117 NGIPRDTELTHIMPYISKKPLSENLLGS----DDILNTPSWLVKAGARGMSSENLGLTSK 172

Query: 181 XECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGL 240
             C WR  G++YKKNEVYLD+ E I+ILV KDG+I+KS+VDGSV CV+HLSGMP+CQ G 
Sbjct: 173 DMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGF 232

Query: 241 NDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHV 300
           ND  S   N +S  S  +  +E +            GSVILEDCKFHQCVQL+K++   V
Sbjct: 233 NDYLSPSSNTQS--SGNDGWAE-EENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERV 289

Query: 301 IQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTV 360
           I+FVPPDG F+LM+Y V DN+N+PF V P V  +K  ++ Y++TL+SLFPS + AKDV +
Sbjct: 290 IRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVEL 349

Query: 361 KIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSHDLSDL 420
            IP PP T+    NVS GK K+   E  +VWK +KY G TEN  S  +      +D  +L
Sbjct: 350 YIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNL 409

Query: 421 LRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGAYEIRY 475
            +WSRPPIS+ FEI MFSNSGLVVR+LK  E  LNY  VKW+KYIS SGAYE+RY
Sbjct: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  461 bits (1186), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 230/490 (46%), Positives = 334/490 (68%), Gaps = 38/490 (7%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           ML+A+FIY+ +G+LLISK +K  V++S++++FR QVIN+  VRSP+LTLGSTTF H+  +
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHI--K 58

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
           S+ NL  W+VAVSRSN DS+ IWE+L++L +L+EAF +  E+ LK+ FM+ YE+L++ LE
Sbjct: 59  SAKNL--WIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLE 116

Query: 121 NGIPQTTDLAQIIPRVSRKP---IEN-NTISKSPD--------LDDFLSGSNIXXXXXXX 168
           +G+P  T+L+ +  ++S KP   ++N N  +++          +  FL G          
Sbjct: 117 DGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGR-------PS 169

Query: 169 XXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVS 228
                          PWR +G+KYKKNEV+L++NE+I+ILV KDGSI+KS+VDG+V+  +
Sbjct: 170 AGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATT 229

Query: 229 HLSGMPLCQLGLNDTYSI---HGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCK 285
           HLSGMP+C+ GLND  S+    G++           EY             GSV+LEDCK
Sbjct: 230 HLSGMPVCRFGLNDALSVSTPFGDD----------DEYQVTNKKAIPKAAAGSVMLEDCK 279

Query: 286 FHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTL 345
           FHQCVQL+K+++   I F+ PDG F+LM+Y V +N+N+PF V P V +V++++++Y++T+
Sbjct: 280 FHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITI 339

Query: 346 RSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLS 405
           +SLFPS ++AKDV ++IPVPP T+ C  + S GKCK+   E  +VWK++KY+G TEN++S
Sbjct: 340 KSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSIS 399

Query: 406 GKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYI 465
              A+P     L ++ +W RPPIS+ FEIVMFSNSGLVVR     E   NY+ VKWIKY+
Sbjct: 400 A-TAVPMKDSTL-NIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYL 457

Query: 466 SHSGAYEIRY 475
           S SGAYE+RY
Sbjct: 458 SKSGAYEVRY 467

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  460 bits (1184), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 227/488 (46%), Positives = 333/488 (68%), Gaps = 35/488 (7%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           MLSA+FI++ +G+LLISK ++  V +S++++FR QVIN+  VRSP+LTLGSTTF HV  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHV--K 58

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
           S  NL  W+VAVSRSN DS+ IWE+L+KL  L+EAFG++ E+ LK++FM  YE+L++ LE
Sbjct: 59  SPGNL--WIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLE 116

Query: 121 NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXXXXXX 180
           +G+P  T+L+ +  ++S KP      + +  ++ F+   N                    
Sbjct: 117 DGVPVDTELSSVASKMSVKPS-----ASAERINTFIESGNGGTNRILPVAQFLRARSSSS 171

Query: 181 ----------XECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHL 230
                        PWR +G+KYKKNEV+L++NE+I+ILV KDGSI+KS+VDG+V+  +HL
Sbjct: 172 NLHDSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231

Query: 231 SGMPLCQLGLNDTYSIH---GNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFH 287
           SGMP+C+ GLND+ S+    G+ +S  +  + + +              GSV+LEDCKFH
Sbjct: 232 SGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPK-----------AAAGSVMLEDCKFH 280

Query: 288 QCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRS 347
           QCVQL+K+++   I F+PPDG F+LM+Y V +N+N+PF + P V + K ++++Y+VT++S
Sbjct: 281 QCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKS 340

Query: 348 LFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGK 407
           LFPS ++AKDV ++IPVPP T+ C  + S G+CK+   E  ++WK++KY+G TEN+LS  
Sbjct: 341 LFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSA- 399

Query: 408 VAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISH 467
            A+P     L ++ +WS+PP+S+ FEIVMFSNSGLVVR     E   NY+ VKWIKY+S 
Sbjct: 400 TAVPMKDSAL-NIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSK 458

Query: 468 SGAYEIRY 475
           SGAYE+RY
Sbjct: 459 SGAYEVRY 466

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  459 bits (1180), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 228/486 (46%), Positives = 320/486 (65%), Gaps = 21/486 (4%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M++AIFIY+ +G+L++SKL  + +KRS++D+FR QVIN+  VRSPILTLGSTTF H+   
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTL- 119
            SD+L  W+V VSR+N +S  IWE+L+K   +++A+ +  E+ LK++FM+ YEIL++ + 
Sbjct: 61  GSDSL--WIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIG 118

Query: 120 ENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDF--LSGSNIXXXXXXXXXXXXXXXX 177
             GIP  T+L  I  ++S KP ++   S  P         GSN+                
Sbjct: 119 AGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNR 178

Query: 178 XXXXEC--------PWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSH 229
               +         PWRP+G+KYKKNEV+L +NEKI ILV +DGSI+K++VDG++D  +H
Sbjct: 179 SMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTH 238

Query: 230 LSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQC 289
           LSG P+CQ GLND+ S+   +   L   E  ++              GSV+LEDCKFHQC
Sbjct: 239 LSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNK------KAVPKAAAGSVMLEDCKFHQC 292

Query: 290 VQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLF 349
           V L+K+    +I+FVPPDG  +LM+Y V DN+N+PF + P V     ST+ Y++TL+SLF
Sbjct: 293 VSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC-GSTVEYRITLKSLF 351

Query: 350 PSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVA 409
           P+ +SAKDV + IPVPP T+ C  N+S GKCK+++ E  MVW++NKY G TENTLS  V 
Sbjct: 352 PNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA-VT 410

Query: 410 IPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG 469
           +P +      L +W RPP+S+GFEI+MFSNSGLVVR+ +  +    Y+ VKWIKYIS SG
Sbjct: 411 VPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSG 470

Query: 470 AYEIRY 475
           +YE+RY
Sbjct: 471 SYEVRY 476

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  459 bits (1180), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 239/492 (48%), Positives = 326/492 (66%), Gaps = 27/492 (5%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+SAI I++++G+L+++K +K  +K+S++D+FR QVIN+  VRSPILTLGSTTF H+  +
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
            SD+L  WLVAVSRSN +S  IWE+L+KL  +M+ +G+  E  LK+ FM  YEIL+  LE
Sbjct: 61  GSDSL--WLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLE 118

Query: 121 -NGIPQTTDLAQIIPRVSRKP---IENNTISKSPDLDDFLS--------GSNIXXXXXXX 168
             GIP  T+L  +I +++ KP   I  N + + PDL    S         S+        
Sbjct: 119 EGGIPVDTELNSVISKMTVKPPKQISGNLLDR-PDLLTMSSLNLSTPGDSSSTLSMPKFL 177

Query: 169 XXXXXXXXXXXXXECP----WRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSV 224
                          P    WRP G+KYKKNEV L++NEKI+ILV +DGSI+KS+VDG++
Sbjct: 178 TRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTI 237

Query: 225 DCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDC 284
           D  +HLSGMP+CQ GLND+ S+   + S +S VE     D            G V+LEDC
Sbjct: 238 DLTTHLSGMPICQFGLNDSLSVEFGDDS-ISEVE-----DFANKKAIPKAAAGRVMLEDC 291

Query: 285 KFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEV-EIVKNSTLNYKV 343
           KFHQCV L+K+  + VI+FVPPDG  +LM+Y V DN+N+PF V P V  I + +T++Y+V
Sbjct: 292 KFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRV 351

Query: 344 TLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENT 403
           TL+SLFP  +SAKDV+++IPVPP T+ C+ NVS GKCK+   E  M+WK+ KY G TENT
Sbjct: 352 TLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENT 411

Query: 404 LSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIK 463
           LS  V +P++      + +W RPP+S+ FEI+MFSNSGLVVR+ K  +    Y+  KWIK
Sbjct: 412 LSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIK 470

Query: 464 YISHSGAYEIRY 475
           YIS SG+YEIRY
Sbjct: 471 YISKSGSYEIRY 482

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  454 bits (1168), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 232/490 (47%), Positives = 329/490 (67%), Gaps = 30/490 (6%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+SA+ +++++G+L++SK  K+++KRS++D+FR QVIN+  VRSPILTLGSTTFQH IR 
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQH-IRS 59

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTL- 119
           +     +WLV+V+RSN++   +WE+L+K   ++E +G+N+E+ LK+EFM+ YE+L++ L 
Sbjct: 60  NVHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLG 119

Query: 120 ENGIPQTTDLAQIIPRVSRKP----IENNTISKS------PDLDDFLSGSNIXXXXXXXX 169
           ENG P  TD A +I ++S KP    IEN  IS        P +  FL  ++         
Sbjct: 120 ENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTS--SFLNQES 177

Query: 170 XXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSH 229
                       E PWRP G+ +KKNE++L +NEKI+ILV K+GSI+KS+VDG++D V+H
Sbjct: 178 SNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTH 237

Query: 230 LSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXX-XXXXGSVILEDCKFHQ 288
           LSG P+CQ GLND+ S+  ++  +         +D             GSV+LEDCKFHQ
Sbjct: 238 LSGTPVCQFGLNDSLSVKNDDYGD--------SFDYIKNKKAIPKAAAGSVLLEDCKFHQ 289

Query: 289 CVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNST-LNYKVTLRS 347
           CV L K++ + +I+FVPPDG  +LM+Y V  NIN+PF V P V    + T + Y++TL+S
Sbjct: 290 CVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKS 349

Query: 348 LFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGK 407
           LFPS ++AK+VT+KIPVPP T+ C  +VS G CK+   EK M+W +NKY G TENTLS  
Sbjct: 350 LFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLS-- 407

Query: 408 VAIPATSHDLSDL--LRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYI 465
            A+  TS D   L   +W +PPIS+ FEI+MFSNSGLVVR+   +E +  Y+ VKWI+Y+
Sbjct: 408 -AVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYV 465

Query: 466 SHSGAYEIRY 475
           S SG+YEIRY
Sbjct: 466 SKSGSYEIRY 475

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  452 bits (1163), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 231/488 (47%), Positives = 325/488 (66%), Gaps = 32/488 (6%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M++ + +Y  KG+L++SK  K + KRS++D+FR QVIN+  VRSPILTLGSTTF H+   
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
           S D+L  WLVAV+RSN +S  IWE+L+K   L+ AFG+++E  LK+EFM  YE+L+L L 
Sbjct: 61  SRDHL--WLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLN 118

Query: 121 -NGIPQTTDLAQIIPRVSRKPIEN---------NTISKSPDLDDFLSGSNIXXXXXXXXX 170
            +G+P  T+L+ +  ++S KP+ +         +  S    +  FL+ +N          
Sbjct: 119 VDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNN--------RS 170

Query: 171 XXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHL 230
                        PWRP+G+KYKKNE++L+INEKI+ILV KD +I+K++VDG+VD  SHL
Sbjct: 171 MSVDTMNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHL 230

Query: 231 SGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCV 290
           SG P CQ GLND+ S+  +E +  +      +              G+V+LEDCKFH+CV
Sbjct: 231 SGTPTCQFGLNDSLSV--DEPNYYN----SDDNGFRNQQNIPRATAGTVVLEDCKFHECV 284

Query: 291 QLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNST-LNYKVTLRSLF 349
            L+K+  + +I+FVPPDG  +LM+Y V DNIN+PF V P V   ++ T L+Y++TL+SLF
Sbjct: 285 SLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLF 344

Query: 350 PSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVA 409
           PS +SA DV +KIPVP +T+ C  NVS GKC++   E C++WK+ KY G TEN LS   A
Sbjct: 345 PSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLS---A 401

Query: 410 IPATSHDLSDLL--RWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISH 467
           +  +S+D + L+  +W+RPPIS+ FEI+MFSNSGLVVR+LK  E    Y+ VKWIKYIS 
Sbjct: 402 VTVSSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISR 461

Query: 468 SGAYEIRY 475
           SG+YE+RY
Sbjct: 462 SGSYEVRY 469

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  450 bits (1158), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 233/504 (46%), Positives = 323/504 (64%), Gaps = 42/504 (8%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M++A+ I+ A+G+L++SKL K  +KRS+AD+FR QVIN+  VRSPILTLGSTTF H+   
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTL- 119
             DNL  W+VAVSR+NVDS+ IWE+L+KL  L++++G+N E+ LK+EFM+++E+L++ + 
Sbjct: 61  RGDNL--WIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMC 118

Query: 120 -ENGIPQTTDLAQIIPRVSRKPIEN-----------------NTISKSPDLDDFLSGSNI 161
              GIP  T+ + +I R+S KP ++                 N  +  PDL   +SG  +
Sbjct: 119 GSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDL--LMSGPKL 176

Query: 162 XXXXXXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVD 221
                               +  WRP G+ +KKNEV L +NE+I ILV KDGS++K++VD
Sbjct: 177 LRRNSASLSQDLSILT----DFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVD 232

Query: 222 GSVDCVSHLSGMPLCQLGLNDTYSIHG---------NEKSELSIVEMMSEYDXXXXXXXX 272
           GS+D  +HLSG P+CQ GLND+ S+ G         N       V     +D        
Sbjct: 233 GSIDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDV----NFDKTDKKQLS 288

Query: 273 XXXXGSVILEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVE 332
               GSVILEDCKFHQCV L+K++ + +I+FVPPDG  +LM+Y V DN+N+PF V P V 
Sbjct: 289 MASVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVT 348

Query: 333 IVKNST-LNYKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVW 391
             +N T L Y++T++SLFP  +SAK+V + IPVPP T+ C  NV+ G CK+   E  M+W
Sbjct: 349 NTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIW 408

Query: 392 KYNKYKGSTENTLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQE 451
           ++NK+ G TENTLS  V IP   +    L +WS+PP+S+ FEI+MFSNSGLVVR+    E
Sbjct: 409 RFNKFNGLTENTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITE 467

Query: 452 PQLNYQPVKWIKYISHSGAYEIRY 475
               Y+ VKWIKYIS SG+YEIRY
Sbjct: 468 RDQKYKAVKWIKYISRSGSYEIRY 491

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  444 bits (1142), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 215/491 (43%), Positives = 324/491 (65%), Gaps = 26/491 (5%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M++A+ I+  +G+LL+ K+ K  VKR+++D+FR QVIN+ ++RSPILTLGSTTF H IR 
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTF-HFIRT 59

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
           ++ +  +WLVAV+RSN DS  IWEYL+KL  LME +G+  ED+LKDEF++ +E+L++TL 
Sbjct: 60  TAGS-KLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLG 118

Query: 121 -NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGS--------------NIXXXX 165
            NG+P  T+L+ +I +++ KP +   ++ S D  D L+ S                    
Sbjct: 119 MNGLPMDTELSSVIGKMTLKPAQ--VLTSSADRSDILASSVTTLGHNSTPISMPKFLSRN 176

Query: 166 XXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVD 225
                             PWR   +KYKKNE+ +++ EKI +LVGKD +I++++VDG++D
Sbjct: 177 SNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTID 236

Query: 226 CVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCK 285
             +HLSGMP+CQ+G+ND  +I G E +  +  +  S  D              VILE  K
Sbjct: 237 ITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRD-----AMPDVSGDRVILEGSK 291

Query: 286 FHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNST-LNYKVT 344
           FHQCV L+KY  ++VI F+PPDG F+LM+Y V +N+N+PF + P+V +  + T L+Y + 
Sbjct: 292 FHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIK 351

Query: 345 LRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTL 404
           L+SLFP  +SA++V ++IPVPP T+ C  N S GKCK+   E CMVW ++++ GSTEN L
Sbjct: 352 LKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHL 411

Query: 405 SGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
           + +  +P  S     + +W+RPP+S+ F+++MFSN+GL+VR+LK QE  ++Y  +KWIKY
Sbjct: 412 NAQ-TVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKY 470

Query: 465 ISHSGAYEIRY 475
           IS +G+YE+RY
Sbjct: 471 ISAAGSYEVRY 481

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  442 bits (1138), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 224/480 (46%), Positives = 324/480 (67%), Gaps = 12/480 (2%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M++ + IY+++GDL++  L+K  +KR+++D+F+ QVIN   ++SPILTLGSTTF H IR 
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHH-IRS 59

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTL- 119
           SS++  +W+VA++RSN +S +IWE+L+KL  ++ A+ +N+E+ L ++FM+ YE++++ L 
Sbjct: 60  SSES-KLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLT 118

Query: 120 ENGIPQTTDLAQIIPRVS-RKPIENNTISKSP-DLDDFLSGSNI-XXXXXXXXXXXXXXX 176
            N +P  T+L+ I  ++S R P    TIS SP +  +  +G +I                
Sbjct: 119 SNAMPINTELSSIASKISYRLP---KTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFS 175

Query: 177 XXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLC 236
                + PWRP+G+KYKKNEV+L +NEKI ILV KD +I+K++VDGS+D VSHLSG P+C
Sbjct: 176 NITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPIC 235

Query: 237 QLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYE 296
           Q GLND  S+ GN  S     E   ++              SV +EDC FHQCV L+K+ 
Sbjct: 236 QFGLNDYLSMTGNNISNRG-DEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLDKFN 294

Query: 297 ANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNS-TLNYKVTLRSLFPSNVSA 355
              +I FVPPDG F+LM+Y V D++NIPF V P V I  +  ++ YK+ L+SLFP+++SA
Sbjct: 295 DERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYKIILKSLFPTSLSA 354

Query: 356 KDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSH 415
            D  +KIP+PP T+ C  N S GKC +   + C +WK+NKYKG TEN L  +  +P++S 
Sbjct: 355 ADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILE-TVPSSST 413

Query: 416 DLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGAYEIRY 475
           D+  L +W+RPP+SM FEI+MFSNSGLVV++LK  E    Y+PVKWIKY+S SG+YEIRY
Sbjct: 414 DILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSGSYEIRY 473

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  443 bits (1139), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 221/494 (44%), Positives = 325/494 (65%), Gaps = 22/494 (4%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+S + +Y+++G+L+++K  K+ +KRS++D+FR QVIN+  VRSP+LTLGSTTF H+   
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
             DNL  WLV ++RSN +S+ IWE+L+KL  +M A+ ++ E+ LK+EFM+++E+L++ L 
Sbjct: 61  HGDNL--WLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLG 118

Query: 121 -NGIPQTTDLAQIIPRVSRKPIEN-NTISKSPDLDDFLSGSN---------------IXX 163
            NGIP  T+L  +I ++S KP+ N   +  SPD +D LS S+                  
Sbjct: 119 GNGIPIDTELNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLTKR 178

Query: 164 XXXXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGS 223
                             +  WRP G+ +KK+EV+L +NE+I ILV +DGSI+KS+VDG+
Sbjct: 179 SSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGT 238

Query: 224 VDCVSHLSGMPLCQLGLNDTYSIHG-NEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILE 282
           +D  +HLSG P+C+ GLND+  +   +EK  L+  +  S  D            GSV+LE
Sbjct: 239 IDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGSVLLE 298

Query: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEV-EIVKNSTLNY 341
           DCKFH+CV L+K+  NH+I+FVPPDG  +LM+Y V DNIN+PF V P V    +++ ++Y
Sbjct: 299 DCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNEIDY 358

Query: 342 KVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTE 401
           ++TL+SLFP  +SAKDV + IPVPP+T+ C  +VS G CK+   E  M+W++NKY G TE
Sbjct: 359 RITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTE 418

Query: 402 NTLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKW 461
           NTLS  V +  +     +L +W+RPPIS+ FE++MFSNSGLVVR+         ++ VKW
Sbjct: 419 NTLSA-VTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAVKW 477

Query: 462 IKYISHSGAYEIRY 475
           IKYIS +G+YE+RY
Sbjct: 478 IKYISKAGSYEVRY 491

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  441 bits (1135), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 220/494 (44%), Positives = 325/494 (65%), Gaps = 22/494 (4%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+S + IY+++G+L+++K  K+ +KRS++D+FR QVIN+  VRSP+LTLGSTTF H+   
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
             DNL  WLV ++RSN +S+ IWE+L+KL  +M A+ ++ E+ LK+EFM+++E+L++ L 
Sbjct: 61  HGDNL--WLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLG 118

Query: 121 -NGIPQTTDLAQIIPRVSRKPIEN-NTISKSPDLDDFLSGSNI---------------XX 163
            NGIP  T+L  +I ++S KP+ N   +  SPD +D LS S+                  
Sbjct: 119 GNGIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPKFLKKS 178

Query: 164 XXXXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGS 223
                             +  WRP G+ +KK+EV+L +NE++ ILV +DGSI+KS+VDG+
Sbjct: 179 SSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGT 238

Query: 224 VDCVSHLSGMPLCQLGLNDTYSIHG-NEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILE 282
           +D  +HLSG P+C+ GLND+  +   +EK  L+  +  S  +            GSV+LE
Sbjct: 239 IDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLE 298

Query: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEV-EIVKNSTLNY 341
           DCKFH+CV L+K+  NH I+FVPPDG  +LM+Y V DNIN+PF + P V    +++ ++Y
Sbjct: 299 DCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDY 358

Query: 342 KVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTE 401
           ++TL+SLFP  +SAKDVT+ IPVPP+T+ C  +VS G CK+   E  M+W++NKY G TE
Sbjct: 359 RITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTE 418

Query: 402 NTLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKW 461
           NTLS  V +  +     +L +W+RPP+S+ FE++MFSNSGLVVR+         ++ VKW
Sbjct: 419 NTLSA-VTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKW 477

Query: 462 IKYISHSGAYEIRY 475
           IKYIS SG+YE+RY
Sbjct: 478 IKYISRSGSYEVRY 491

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  436 bits (1121), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 224/489 (45%), Positives = 322/489 (65%), Gaps = 17/489 (3%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M++ I IY+ +G+L++SKL K  +KRS+AD+FR QVIN+  VRSPILTLGSTTF H IR 
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHH-IRS 59

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
           S D+  +WLVA +R+N +S+ IWE+L+KL  ++  +G+N E+ LK+EFM+++E+L++ L 
Sbjct: 60  SKDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLG 119

Query: 121 N-GIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLS--GSN---IXXXXXXXXXXXXX 174
           + GIP  T+ +++I ++S KP + +  + S  LD  L   G+N   +             
Sbjct: 120 SCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSH 179

Query: 175 XXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMP 234
                  +  WRP  +K+KKNEV L +NEKI ILV KDGSI+K++VDGS+D  + LSG P
Sbjct: 180 DSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTP 239

Query: 235 LCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXX-------XXXXXXXXGSVILEDCKFH 287
           +CQ GLND+ ++ G+  SE S     +  +                   G+VILEDCKFH
Sbjct: 240 VCQFGLNDSLTL-GSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFH 298

Query: 288 QCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEV-EIVKNSTLNYKVTLR 346
           QCV L+K++   +I+FVPPDG  +LM+Y + +N+N+PF + P V   V    L+Y++ L+
Sbjct: 299 QCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALK 358

Query: 347 SLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSG 406
           SLFP  +SAK V + IPVPP  + C+ +VS G CK+   E  MVWK+NKY G TENTLS 
Sbjct: 359 SLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA 418

Query: 407 KVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYIS 466
            V +P+   + + L +W+RPP+S+ FEI+MFSNSGLVVR+    E   NY+ VKWIKY+S
Sbjct: 419 -VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVS 477

Query: 467 HSGAYEIRY 475
            SG+YE+R+
Sbjct: 478 KSGSYEVRF 486

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  436 bits (1121), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 213/494 (43%), Positives = 322/494 (65%), Gaps = 22/494 (4%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+S + +Y+++G+L+++K  K+ +KRS++D+FR QVIN+  VRSP+LTLGSTTF H+  +
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
             DNL  WLV ++RSN +S+ IWE+L+KL  +M A+ ++ E+ LK+EFM+++E+L++ L 
Sbjct: 61  HGDNL--WLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLG 118

Query: 121 -NGIPQTTDLAQIIPRVSRKPIEN-NTISKSPDLDDFL--------SGSNI-------XX 163
            NGIP  T+L  ++ R+S KP+ N   +    D  D L        +G  +         
Sbjct: 119 GNGIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLKKS 178

Query: 164 XXXXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGS 223
                             +  WR +G+ +KK+EV+L +NE++ ILV +DGSI+KS+VDG+
Sbjct: 179 SSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGT 238

Query: 224 VDCVSHLSGMPLCQLGLNDTYSIHG-NEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILE 282
           +D V+HL+G P+C+ GLND+  +   +EK+ L+     S  D            GSV+LE
Sbjct: 239 IDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVLLE 298

Query: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEV-EIVKNSTLNY 341
           DCKFH+CV + K+  NH+I+F+PPDG  +LM+Y V DNIN+PF + P V    +++ ++Y
Sbjct: 299 DCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEIDY 358

Query: 342 KVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTE 401
           ++TL+SLFP  +SAKDV + IPVPP+T+ C  +VS G CK+   E  M+W++NKY G TE
Sbjct: 359 RITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTE 418

Query: 402 NTLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKW 461
           NTLS      + +  LS   +W+RPP+S+ FE++MFSNSGLVVR+         ++ VKW
Sbjct: 419 NTLSAATVSTSDTTQLS-FQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAVKW 477

Query: 462 IKYISHSGAYEIRY 475
           IKYIS SG+YE+RY
Sbjct: 478 IKYISKSGSYEVRY 491

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  436 bits (1120), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 217/494 (43%), Positives = 323/494 (65%), Gaps = 22/494 (4%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+S + +Y+++G+L+++K  K+ +KRS++D+FR QVIN+  VRSP+LTLGSTTF H+   
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
             DNL  WLV ++RSN +S+ IWE+L+KL  +M A+ ++ E+ LK+EFM+++E+L++ L 
Sbjct: 61  RGDNL--WLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLG 118

Query: 121 -NGIPQTTDLAQIIPRVSRKPIEN-NTISKSPDLDDFLS--------GSNI-------XX 163
            NGIP  T+L  +I ++S KPI N   + +SPD  D LS        G  +         
Sbjct: 119 GNGIPIDTELNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFLKKR 178

Query: 164 XXXXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGS 223
                             +  WRP G+ +KK+EV+L +NE++ ILV +DGSI+KS+VDG+
Sbjct: 179 SSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGT 238

Query: 224 VDCVSHLSGMPLCQLGLNDTYSIHGNEKSE-LSIVEMMSEYDXXXXXXXXXXXXGSVILE 282
           +D  +HLSG P+C+ GLND+  +   ++   LS  +  S               GSV+LE
Sbjct: 239 IDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGSVLLE 298

Query: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEV-EIVKNSTLNY 341
           DCKFH+CV ++K+  NH+I+FVPPDG  +LM+Y V DNIN+PF + P V    +++ ++Y
Sbjct: 299 DCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNEVDY 358

Query: 342 KVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTE 401
           ++TL+SLFP  +SAKDV + IPVPP+T+ C  +VS G CK+   E  M+W++NK+ G TE
Sbjct: 359 RITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGLTE 418

Query: 402 NTLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKW 461
           NTLS      + +  LS L +W+RPP+S+ FE++MFSNSGLVVR+         ++ VKW
Sbjct: 419 NTLSAVTVSTSDTTQLS-LQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAVKW 477

Query: 462 IKYISHSGAYEIRY 475
           IKYIS SG+YE+RY
Sbjct: 478 IKYISKSGSYEVRY 491

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  409 bits (1052), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 202/442 (45%), Positives = 279/442 (63%), Gaps = 20/442 (4%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+ A F++  +G L++SKLI    K SL++VFR QVIN   +RSP+LTLGSTTFQH IR 
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQH-IRT 59

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
           S     +W+V V R N DS+ IWE+L+ + +L++A+ IN E+ L D+FML YE+L++ L+
Sbjct: 60  SGG---LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD 116

Query: 121 NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXXXXXX 180
           +G+PQ T+L+ I+P +SRKP    + S     DDFL+ + +                   
Sbjct: 117 SGLPQDTELSHIVPLLSRKPATGESASG----DDFLNSARLRRTGTKNVSVETLDHFSRD 172

Query: 181 XECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGL 240
             CPWR  G+KYKKNEVYLD+ EK+++LV +DG+I+K++VDG+V C +HLSGMPLC  G 
Sbjct: 173 V-CPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGF 231

Query: 241 NDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHV 300
           ND+ S+            +    +             SV+LEDCKFHQCVQLNK++   V
Sbjct: 232 NDSQSLRQRSPRRQYAPRVFGTDERE-----------SVVLEDCKFHQCVQLNKFDQERV 280

Query: 301 IQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTV 360
           I+FVPPDG F+LM+Y + D++  PF V P V  V   ++ Y++TL+SLFP+ +SAKDV +
Sbjct: 281 IRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVEL 340

Query: 361 KIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSHDLSDL 420
            IP PP TI    NVS GKCK+   E  ++WK +K+ G TENTLS         H    L
Sbjct: 341 YIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVL 400

Query: 421 LRWSRPPISMGFEIVMFSNSGL 442
            +W RPPISM  EI+MFS + L
Sbjct: 401 DQWPRPPISMKLEIMMFSTAAL 422

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  392 bits (1008), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 298/480 (62%), Gaps = 11/480 (2%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M++A+ +Y+A+G+L++SK+ K  +KRS+ D+FR QVIN   VRSPILTLGSTTF H +R 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTF-HYVRT 59

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120
             + L  W+V+VSR+N +S+  WE+L+K   ++ A+ ++ E+VLK+EFML +E+L+  +E
Sbjct: 60  PGEGL--WVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVE 117

Query: 121 NG-IPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXXXXX 179
            G IP  TD  +II  +S KP  +    ++       + S                    
Sbjct: 118 GGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNPGG 177

Query: 180 XXECPWRPS-GLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQL 238
               P     G + K+NE+ + + E I+ILV KDGSI+K++VDG +D  + L G  +CQ 
Sbjct: 178 ISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVCQF 237

Query: 239 GLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEAN 298
           GLND+ S   +  S+     + S+              G+V+L DCKFHQCV L +++ +
Sbjct: 238 GLNDSLSTDNSSNSKWD--PLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVSLERFDRD 295

Query: 299 HVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDV 358
            +I+F PP+G  +LM+Y V DN+N+PF V   V    N+  +Y+VT++SLFP  +SAK+V
Sbjct: 296 RIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLFPGKLSAKNV 355

Query: 359 TVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSHDLS 418
           T++IPVPP T+ C  NVS G CK+   E  MVWK++KY G TEN LS  + +P       
Sbjct: 356 TMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPTRDTTQL 414

Query: 419 DLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLN---YQPVKWIKYISHSGAYEIRY 475
            L +WSRPPIS+ FEI+M+SN+GLVVR+    +   N   ++ VKWIKY+SHSG+YE+RY
Sbjct: 415 ALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSGSYEVRY 474

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  336 bits (862), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/480 (39%), Positives = 286/480 (59%), Gaps = 57/480 (11%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+SAI IY  +G+L++SKL ++++KRS++++FR QVIN+ +VRSPILTLGSTTF H+   
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  SSD--NLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILE-L 117
           ++D  +  +WLV V+R+N +S+ IWE+L KL  +++ +GI  E  LKDEFM ++EIL+ +
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 118 TLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXXX 177
            L  GI Q TDL  I+ ++S KPI     + S     FL   N                 
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTG-FLKRRNTILTTPGANFSLIPTNR 179

Query: 178 XXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQ 237
                         +KKNE++  +NE + +LV KDGSI+K++VDG ++  SHL+G P CQ
Sbjct: 180 HDA-----------HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQ 228

Query: 238 LGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEA 297
             L D       ++++++                           D KF QC++  K ++
Sbjct: 229 FELVD-------DQTKIT---------------------------DFKFDQCIE--KVQS 252

Query: 298 NHVIQFVPPDGPFQLMQYRVIDN-INIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAK 356
              ++    DG  +++ Y V D+ INIPF + P V  VK+ T++Y+++L+SLFP N+SA 
Sbjct: 253 -RTVRVAATDGELEIVNYHVRDDKINIPFKITPIVSTVKD-TVDYRISLKSLFPKNLSAT 310

Query: 357 DVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSHD 416
           DV + IPVPP TI C  NVS G CK+ A +  ++W +NK+ GSTENTLS  + I A    
Sbjct: 311 DVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSA-ITI-ADGRQ 368

Query: 417 LSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEP-QLNYQPVKWIKYISHSGAYEIRY 475
           + +L  W+RP I + FEI M+S SGL++R+L   +  +  Y+  +WIKYIS +G+YE+R+
Sbjct: 369 IMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAGSYEMRF 428

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  207 bits (528), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/488 (28%), Positives = 243/488 (49%), Gaps = 60/488 (12%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57
           M S I+  ++KG LL+S+  KD +  +  + F   +I    +  V  P  +      Q++
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGV--QYL 58

Query: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEIL 115
             + +D   ++++ +++S +++ + ++ YLHKL +++E +  + +E+ +KD F+++YE+L
Sbjct: 59  FIQHND---LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELL 115

Query: 116 ELTLENGIPQTTD---LAQIIPRVSRKPI-----ENNTISKSPDLDDFLSGSNIXXXXXX 167
           +  +++GIPQ TD   L Q I + S K I     + N +     L + +S          
Sbjct: 116 DEMMDHGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVS---------- 165

Query: 168 XXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCV 227
                            WRP G+ YKKNE +LD+ E I +L+ + G +++S + G V   
Sbjct: 166 -----------------WRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVK 208

Query: 228 SHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFH 287
           S LSGMP  +LGLND             I     + D             ++ LED KFH
Sbjct: 209 SRLSGMPDLKLGLNDK-----------GIFAQGDDDDDEEGASGGTKKKSNIELEDLKFH 257

Query: 288 QCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRS 347
           QCV+L K+E   +I F+PPDG F+LM YR+   I        ++++   S +      ++
Sbjct: 258 QCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKA 317

Query: 348 LFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGK 407
                 +A +V + IPVP       F  S G  K+   +  ++WK   + G  + +++ +
Sbjct: 318 QIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAE 377

Query: 408 VAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISH 467
           + +P+ S +    L   + P+ + F+I  F+ SG+ VR+LK  EP++ Y    W++YI+ 
Sbjct: 378 MGLPSVSDNSDHKL---KRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQ 434

Query: 468 SG-AYEIR 474
           SG  Y IR
Sbjct: 435 SGDDYTIR 442

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  207 bits (528), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 140/484 (28%), Positives = 244/484 (50%), Gaps = 50/484 (10%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57
           M S I+  +AKG LL+S+  KD +  S  + F   +I    + +V  P  +      Q++
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGV--QYL 58

Query: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEIL 115
             + +D   ++++ ++RS   + + ++ +LH L  +++ +  + +E+ +KD F+++YE+L
Sbjct: 59  FIQHND---LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELL 115

Query: 116 ELTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXX 172
           +  +++GIPQ TD   L Q I + S K I +    K+                       
Sbjct: 116 DEVMDSGIPQITDTKMLRQYITQKSFKLIRSAKKKKN----------------------V 153

Query: 173 XXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSG 232
                       WRP G+KYKKNE +LD+ E I +++ + G +++S + G V   S LSG
Sbjct: 154 VRPPSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSG 213

Query: 233 MPLCQLGLNDT-YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQ 291
           MP  +LGLND       NE+ E          D             ++ LED KFHQCV+
Sbjct: 214 MPDLKLGLNDKGIFTQSNEEEE----------DEPSSQPSITRKKSNIELEDLKFHQCVR 263

Query: 292 LNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPS 351
           L+K+E   +I F+PPDG F+LM YR+   I        ++++   S +      ++   +
Sbjct: 264 LSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKA 323

Query: 352 NVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIP 411
             +A +V + IPVP       F  S G  K+   +  ++WK   + G  + +++ ++ +P
Sbjct: 324 KSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLP 383

Query: 412 ATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGA- 470
           +  +D++D   + R P+ + F+I  F+ SG+ VR+LK  EP+L Y    W++YI+ SG  
Sbjct: 384 SV-NDIAD-YNFKR-PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGED 440

Query: 471 YEIR 474
           Y IR
Sbjct: 441 YIIR 444

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  207 bits (527), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 139/483 (28%), Positives = 241/483 (49%), Gaps = 53/483 (10%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57
           M S I+  + KG +++S+  +D V  S  + F + ++    +  +  P LT      Q++
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGV--QYL 58

Query: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQ-LMEAFGINDEDVLKDEFMLLYEIL 115
             + +D   ++++ +SRS +++ + ++ +L+KL + L E     +E+ ++D F+++YE+L
Sbjct: 59  FIQHND---IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELL 115

Query: 116 ELTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXX 172
           +  L+ GIPQ T+   L Q I + S K I++   SK+                       
Sbjct: 116 DEMLDYGIPQITETKMLKQYITQKSYKLIKSAKKSKN----------------------V 153

Query: 173 XXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSG 232
                       WRP G+ YKKNE +LD+ E I +L+   G +++S + G V+  S LSG
Sbjct: 154 IRPPSQLTKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVNVRSRLSG 213

Query: 233 MPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQL 292
           MP  +LGLND                + +  +             ++ LED KFHQCV+L
Sbjct: 214 MPDLKLGLNDK--------------GIFTSVESASSSEATEGKKSNIELEDLKFHQCVRL 259

Query: 293 NKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSN 352
           +K+E   +I F+PPDG F+LM YR+   I        ++++   S +      ++     
Sbjct: 260 SKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKK 319

Query: 353 VSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPA 412
            +A +V + IPVP       F  S G  KY   +  ++WK   + G  E + + ++ +P+
Sbjct: 320 STANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPS 379

Query: 413 TSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AY 471
            +   +++ R  R PI + F+I  F+ SG+ VR+LK  EP+L YQ   W++YI+ SG  Y
Sbjct: 380 MTD--AEVPRAKR-PIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGDDY 436

Query: 472 EIR 474
            IR
Sbjct: 437 TIR 439

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  207 bits (526), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 136/483 (28%), Positives = 241/483 (49%), Gaps = 47/483 (9%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL-TLGSTTFQHVIR 59
           M S I+  ++KG  ++S+  KD +  +  D F   ++      S I   L     Q++  
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 60  ESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQ-LMEAFGINDEDVLKDEFMLLYEILEL 117
           + +D   ++++ ++RS + + + ++ +L+K+ + L E   + +E+ ++D F+++YE+L+ 
Sbjct: 61  QHND---LYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDE 117

Query: 118 TLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXX 174
            ++ GIPQ T+   L Q I + S K +++   SK+                         
Sbjct: 118 MMDYGIPQITETKMLKQYITQKSFKLMKSAKKSKN----------------------VIR 155

Query: 175 XXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMP 234
                     WRP G+ YKKNE +LD+ E I +L+ + G +++S + G V   SHLSGMP
Sbjct: 156 PPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMP 215

Query: 235 LCQLGLNDT--YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQL 292
             +LGLND   +S H +   E          D             ++ LED KFHQCV+L
Sbjct: 216 DLKLGLNDKGIFSNHVSGGVE----------DEADDLSATGKKKANIELEDLKFHQCVRL 265

Query: 293 NKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSN 352
           +K+E   +I F+PPDG F+LM YR+   I        ++++   S +      ++     
Sbjct: 266 SKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKK 325

Query: 353 VSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPA 412
            +A +V + IPVP       F  S G  K+   +  ++WK   + G  E +++ ++ +P+
Sbjct: 326 STANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPS 385

Query: 413 TSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AY 471
            S     +++    P+ + F+I  F+ SG+ VR+LK  EP++ YQ   W++YI+ SG  Y
Sbjct: 386 VSDFEEPVMKR---PVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDY 442

Query: 472 EIR 474
            IR
Sbjct: 443 TIR 445

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  204 bits (518), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 133/488 (27%), Positives = 249/488 (51%), Gaps = 60/488 (12%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57
           M S +   ++KG  L+S+  +D V +S  + F+  ++    +  V  P        + +V
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAFGIN-DEDVLKDEFMLLYEIL 115
             + +D   ++++A++RS +V+++ ++ +++KL  ++E +    +E+ ++D ++++YE+L
Sbjct: 61  --QYND---VYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELL 115

Query: 116 ELTLENGIPQTTD---LAQIIP----RVSRKPIENNTISKSP-DLDDFLSGSNIXXXXXX 167
           +  ++ G+PQ T+   L Q I     +++R   +   +++ P +L + +S          
Sbjct: 116 DEMMDKGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVS---------- 165

Query: 168 XXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCV 227
                            WRP G+KYKKNE +LD+ E I +L+ + G +++S + G+V   
Sbjct: 166 -----------------WRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVR 208

Query: 228 SHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFH 287
           S LSGMP  +LGLND      N++            D             ++ LED KFH
Sbjct: 209 SRLSGMPDLKLGLNDKGIFTTNDQE-----------DSPEPVVSSKKKNSNIELEDLKFH 257

Query: 288 QCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRS 347
           QCV+L+K+E   +I F+PPDG F LM YR+   I        +V++   S +      ++
Sbjct: 258 QCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKA 317

Query: 348 LFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGK 407
                  A +V + IP+P       F  S G  K+   +  ++WK++ ++G  E +++ +
Sbjct: 318 QIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQ 377

Query: 408 VAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISH 467
           + +P+ S      L+    P+ + F+I  F+ SG+ VR+LK +EP+L Y    W++YI+ 
Sbjct: 378 LGLPSVSDAEPPKLKR---PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQ 434

Query: 468 SG-AYEIR 474
           SG  Y IR
Sbjct: 435 SGDDYTIR 442

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  202 bits (515), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 139/482 (28%), Positives = 240/482 (49%), Gaps = 48/482 (9%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVIN---DPHVRSPILTLGSTTFQHV 57
           M SAI+  + KG  L+S+  +D +  +  D F + + +   +  V  P LT  +T  Q++
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNT--QYL 58

Query: 58  IRESSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFG----INDEDVLKDEFMLLYE 113
             + SD   ++LVA++  N+  + I E    LY++++  G      +E+ ++D ++++YE
Sbjct: 59  FIQHSD---IYLVAIT--NLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYE 113

Query: 114 ILELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXX 173
           +L+  ++ GIPQ T+   +   +++K  +                               
Sbjct: 114 LLDELMDYGIPQITETKMLKQYITQKSFK-------------------LVKAAKKKQNAA 154

Query: 174 XXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGM 233
                      WR  G+KYKKNE +LDI E I +L+ + G I++S + G V   S LSGM
Sbjct: 155 RPPSALTDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGM 214

Query: 234 PLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLN 293
           P  +LG+ND        K   S  + ++E D              + LED KFHQCV+L+
Sbjct: 215 PDLKLGIND--------KGIFS--KQLTEDD--TNNNATSKKQNKIELEDLKFHQCVRLS 262

Query: 294 KYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNV 353
           K+E   +I F+PPDG F+LM YR+  +I         V++  NS +      ++      
Sbjct: 263 KFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKS 322

Query: 354 SAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPAT 413
           +A +V + IPVP      +F  S G  K+   +  ++WK   + G  E +++ ++ +P+T
Sbjct: 323 TATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPST 382

Query: 414 SHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AYE 472
           S    ++   ++ P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W++YI+ SG  Y 
Sbjct: 383 SSKSEEV--QNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 440

Query: 473 IR 474
           IR
Sbjct: 441 IR 442

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  201 bits (512), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 139/487 (28%), Positives = 239/487 (49%), Gaps = 61/487 (12%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57
           M S I+  +  G +++S+  +D V  S  + F   ++    +  V  P LT      Q++
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLT--HNGLQYM 58

Query: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQ-LMEAFGINDEDVLKDEFMLLYEIL 115
             + +D   ++++ +SRS +++ + ++ +L+KL + L E     +E+ ++D F+++YE+L
Sbjct: 59  FIQHND---IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELL 115

Query: 116 ELTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXX 172
           +  L+ GIPQ T+   L Q I + S K I++   SK+                       
Sbjct: 116 DEMLDYGIPQITETKMLKQYITQKSYKLIKSVKKSKN----------------------V 153

Query: 173 XXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSG 232
                       WRP G+ YKKNE +LD+ E I +L+   G +++S + G V   S LSG
Sbjct: 154 VRPPAQLTKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSG 213

Query: 233 MPLCQLGLNDT---YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQC 289
           MP  +LGLND     S  G   +E                        ++ LED +FHQC
Sbjct: 214 MPDLKLGLNDKGIFTSEEGGNNAE-----------------GGSGKKSNIELEDLQFHQC 256

Query: 290 VQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLF 349
           V+L+K+E   +I F+PPDG F LM YR+   I        ++++   S +      ++  
Sbjct: 257 VRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQI 316

Query: 350 PSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVA 409
               +A +V + IPVP       F  S G  KY   +  ++W+   + G  E + + ++ 
Sbjct: 317 KKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLG 376

Query: 410 IPATSHDLSDL-LRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHS 468
           +P+    ++D+ +  ++ PI + F+I  F+ SG+ VR+LK  EP+L YQ   W++YI+ S
Sbjct: 377 LPS----MTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQS 432

Query: 469 G-AYEIR 474
           G  Y IR
Sbjct: 433 GDDYTIR 439

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  202 bits (513), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 143/493 (29%), Positives = 248/493 (50%), Gaps = 48/493 (9%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58
           M SA++  + KG  L+S+  +D +  S  D F + +++D    S +L   +     Q++ 
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKF-SSLLSDKEEESNLLPPCISHNGIQYMF 59

Query: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116
            + +D   ++L A++ S   + S+I+ +LHK+  +++ +    +E+ ++D F+++YE+L+
Sbjct: 60  IQHND---LYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLD 116

Query: 117 LTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXX 176
             ++ G+PQ T+   +   ++ K  +     K                            
Sbjct: 117 EMMDYGLPQITETKMLKKYITTKSFKLEKAHKK-------------------KRNAARPP 157

Query: 177 XXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLC 236
                   WRP G+KYKKNE +LDI E I +L+ + G +++S + G+V   S LSGMP  
Sbjct: 158 TELTNSVSWRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDL 217

Query: 237 QLGLND----TYSIHGNEKSELSIVEMMSEYDX-XXXXXXXXXXXGS------VILEDCK 285
           +LG+ND    T  + GN    + I +   + D             GS      + LED K
Sbjct: 218 KLGINDRGIFTKYLEGN---NIGIAKNGDDEDADDTNNESSIVSEGSNKRKTNIELEDLK 274

Query: 286 FHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTL 345
           FHQCV+L+K+E   +I F+PPDG F LM YR+  +I  P  +  +V I +   +      
Sbjct: 275 FHQCVRLSKFENEKIISFIPPDGEFDLMNYRLSTSIK-PL-IWCDVSI-QTYRIEIHCKA 331

Query: 346 RSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLS 405
           ++       A +V + IPVP       F  S GK KY   +  ++WK + + G  E +++
Sbjct: 332 KAQIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMA 391

Query: 406 GKVAIPATS--HDLSDLL-RWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWI 462
            ++ +P+ S   DL+  +   S+ P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W+
Sbjct: 392 AQMGLPSISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWV 451

Query: 463 KYISHSG-AYEIR 474
           +YI+ SG  Y IR
Sbjct: 452 RYITQSGDDYTIR 464

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  202 bits (513), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 142/502 (28%), Positives = 252/502 (50%), Gaps = 54/502 (10%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58
           M SA++  +  G  L+S+  +D +  S  D F T +++D   +S ++   L     +++ 
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116
            + +D   ++LVA++ S + +++ I+ +LHKL +++  +    +E+ ++D F+++YE+L+
Sbjct: 60  IQHND---LYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116

Query: 117 LTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXX 173
             ++ GIPQ T+   L Q I + S K +++    ++                        
Sbjct: 117 EVMDYGIPQITETKMLKQYITQKSFKLVKSAKKKRN----------------------AT 154

Query: 174 XXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGM 233
                      WRP G+ +KKNE +LDI E I +L+ + G +++S + G V   S LSGM
Sbjct: 155 RPPVALTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214

Query: 234 PLCQLGLNDT--YSIHGNEKSEL------SIVEMMSEYDXXXXXXXXXXXXGS-----VI 280
           P  +LG+ND   +S + ++ S L      +  +  ++ D             S     + 
Sbjct: 215 PDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIE 274

Query: 281 LEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLN 340
           LED KFHQCV+L+K+E   +I F+PPDG F LM YR+   I         V++  NS + 
Sbjct: 275 LEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIE 334

Query: 341 YKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGST 400
                ++      +A +V + IPVP       F  S G  KY   +  ++WK   + G  
Sbjct: 335 IHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGK 394

Query: 401 ENTLSGKVAIPATS--HDLSDLLRWS-----RPPISMGFEIVMFSNSGLVVRHLKCQEPQ 453
           E ++S ++ +P+ S  +D S  +  +     + P+ + F+I  F+ SG+ VR+LK  EP+
Sbjct: 395 EYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPK 454

Query: 454 LNYQPVKWIKYISHSG-AYEIR 474
           L Y+   W++YI+ SG  Y IR
Sbjct: 455 LQYKSYPWVRYITQSGDDYTIR 476

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  200 bits (509), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 141/487 (28%), Positives = 239/487 (49%), Gaps = 41/487 (8%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58
           M SA++  + KG  L+S+  KD V  S  D F T ++ D    S ++   +     +++ 
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFST-LLTDLEDESAVIPPCINHNGIEYLF 59

Query: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLM-EAFGINDEDVLKDEFMLLYEILE 116
            + +D   +++VA++ S  V+ + ++ +LHKL  ++ E     +E+ ++D F+++YE+++
Sbjct: 60  IQHND---LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMD 116

Query: 117 LTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXX 176
             ++ GIPQ T+     PR+ +K I   +                               
Sbjct: 117 EMMDYGIPQITE-----PRMLKKYITQKSFK--------------LEKAHKKKRNAARPP 157

Query: 177 XXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLC 236
                   WR  G+KYKKNE +LDI E I +L+ + G +++S + G+V   S LSGMP  
Sbjct: 158 SELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDL 217

Query: 237 QLGLND----TYSIHGNEKSELSI---VEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQC 289
           +LG+ND    T  + GN    ++I    E  S                ++ LED KFHQC
Sbjct: 218 KLGINDRGIFTKYLEGNNIG-VNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQC 276

Query: 290 VQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLF 349
           V+L+K+E   +I F+PPDG F LM YR+  +I         +++   S +  +   ++  
Sbjct: 277 VRLSKFENEKIITFIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQI 336

Query: 350 PSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVA 409
                A +V + IPVP       F  S G  KY   +  ++WK   + G  E  +  ++ 
Sbjct: 337 KKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMG 396

Query: 410 IPAT-SHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHS 468
           +P+  S++   + R    P+ + FEI  F+ SG+ VR+LK  EP+L Y+   W++YI+ S
Sbjct: 397 LPSMDSYEEPKVKR----PVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQS 452

Query: 469 G-AYEIR 474
           G  Y IR
Sbjct: 453 GDDYTIR 459

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  201 bits (510), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 143/500 (28%), Positives = 249/500 (49%), Gaps = 52/500 (10%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58
           M SA++  +  G  L+S+  +D V  S  D F T +++D   +S ++   L     +++ 
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116
            + +D   ++LVA+  S   +++ I+ +LHKL +++  +    +E+ ++D F+++YE+L+
Sbjct: 60  IQHND---LYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116

Query: 117 LTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXX 173
             ++ GIPQ T+   L Q I + S K +++    ++         +++            
Sbjct: 117 EVMDYGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVS----------- 165

Query: 174 XXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGM 233
                      WRP G+ +KKNE +LDI E I +L+ + G +++S + G V   S LSGM
Sbjct: 166 -----------WRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214

Query: 234 PLCQLGLNDT--YSIHGNEKSELSIVEMMSEYDXXXXXXXX---------XXXXGSVILE 282
           P  +LG+ND   +S + +  S +      +  D                      ++ LE
Sbjct: 215 PDLKLGINDKGIFSKYLDNDSNIPSAVSAATSDNNTDTDKKPSITSSSTTSKRKVNIELE 274

Query: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYK 342
           D KFHQCV+L+K+E   +I F+PPDG F LM YR+   I         V++  NS +   
Sbjct: 275 DLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIH 334

Query: 343 VTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTEN 402
              ++      +A +V + IPVP       F  S G  KY   +  ++WK   + G  E 
Sbjct: 335 CKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEY 394

Query: 403 TLSGKVAIP--ATSHDLSDLLRWS-----RPPISMGFEIVMFSNSGLVVRHLKCQEPQLN 455
           ++S ++ +P  +TS D S  +  S     + P+ + F+I  F+ SG+ VR+LK  EP+L 
Sbjct: 395 SMSAELGLPSISTSKDGSRTIPKSNAKLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQ 454

Query: 456 YQPVKWIKYISHSG-AYEIR 474
           Y+   W++YI+ SG  Y IR
Sbjct: 455 YKSYPWVRYITQSGDDYTIR 474

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  198 bits (504), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 136/485 (28%), Positives = 250/485 (51%), Gaps = 48/485 (9%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58
           M SA++  ++KG  L+++  +D +  S  + F T +++D    + ++   L     Q++ 
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90

Query: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116
            + +D   ++LVA++ S + +++ I+ +L+KL  ++  +    +E+ ++D F+++YE+L+
Sbjct: 91  IQHND---VYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147

Query: 117 LTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLD-DFLSGSNIXXXXXXXXXXX 172
            T++ GIPQ T+   L Q I + S K ++     ++     + L+ S             
Sbjct: 148 ETMDYGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNS------------- 194

Query: 173 XXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSG 232
                       WR + +KYKKNE +LDI E I +L+ + G I++S + G V   S LSG
Sbjct: 195 ----------VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSG 244

Query: 233 MPLCQLGLNDT--YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCV 290
           MP  +LG+ND   +S H ++ S       ++                ++ LED KFHQCV
Sbjct: 245 MPDLKLGINDKGIFSKHMDDDS-------LNNEGASVASSTTDKKKNNIELEDLKFHQCV 297

Query: 291 QLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFP 350
           +L+K+E   +I F+PPDG F+LM YR+  +I         +++   S +      ++   
Sbjct: 298 RLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIK 357

Query: 351 SNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAI 410
              +A +V + IPVP      +F  S G  KY   +  ++WK   + G  E ++S ++ +
Sbjct: 358 KKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQL 417

Query: 411 PATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG- 469
           P+  +        ++ P+ + F+I  F+ SG+ V++LK  EP+L Y+   W++YI+ SG 
Sbjct: 418 PSIGNIEE---HKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGD 474

Query: 470 AYEIR 474
            Y IR
Sbjct: 475 DYTIR 479

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  197 bits (500), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 140/503 (27%), Positives = 253/503 (50%), Gaps = 58/503 (11%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58
           M SA++  +  G  L+S+  +D +  S  D F T +++D   +S ++   L     +++ 
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116
            + +D   ++LVA+  S   +++ I+ +LHKL +++  +    +E+ ++D F+++YE+L+
Sbjct: 60  IQHND---LYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116

Query: 117 LTLENGIPQ---TTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXX 173
             ++ GIPQ   T  L Q I + S K +++    ++         +++            
Sbjct: 117 EVMDYGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVS----------- 165

Query: 174 XXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGM 233
                      WRP G+ +KKNE +LDI E I +L+ + G +++S + G V   S LSGM
Sbjct: 166 -----------WRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214

Query: 234 PLCQLGLNDT--YSIHGNEKS------ELSIVEMMSEYDXXXXXXXXXXXXGSVI---LE 282
           P  +LG+ND   +S + ++ S        +  + +++ D               +   LE
Sbjct: 215 PDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNITDTDKKPSITSSSTTSKRKVNIELE 274

Query: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYK 342
           D KFHQCV+L+K+E   +I F+PPDG F LM YR+   I         V++  NS +   
Sbjct: 275 DLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIH 334

Query: 343 VTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTEN 402
              ++      +A +V + IPVP       F  S G  KY   +  ++WK   + G  E 
Sbjct: 335 CKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEY 394

Query: 403 TLSGKVAIPATSHDL----------SDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEP 452
           ++S ++ +P+ S+D+          +++L+    P+ + F+I  F+ SG+ VR+LK  EP
Sbjct: 395 SMSAELGLPSISNDIEGHRAIPKSNAEILKG---PVQIKFQIPYFTTSGIQVRYLKINEP 451

Query: 453 QLNYQPVKWIKYISHSG-AYEIR 474
           +L Y+   W++YI+ SG  Y IR
Sbjct: 452 KLQYKSYPWVRYITQSGDDYTIR 474

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  195 bits (496), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 136/502 (27%), Positives = 250/502 (49%), Gaps = 57/502 (11%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58
           M SA++  +  G  L+S+  +D +  S  D F   +++D   +S ++   L     +++ 
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116
            + +D   +++VA+  S + +++ I+ +LHKL +++  +    +E+ ++D F+++YE+L+
Sbjct: 60  IQHND---LYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116

Query: 117 LTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXX 173
             ++ GIPQ T+   L Q I + S K +++    ++         +++            
Sbjct: 117 EVMDYGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVS----------- 165

Query: 174 XXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGM 233
                      WRP G+ +KKNE +LDI E I +L+ + G +++S + G V   S LSGM
Sbjct: 166 -----------WRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214

Query: 234 PLCQLGLNDT--YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVI--------LED 283
           P  +LG+ND   +S + ++ + +      +  +             S          LED
Sbjct: 215 PDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELED 274

Query: 284 CKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKV 343
            KFHQCV+L+K+E   +I F+PPDG F LM YR+   I         V++  NS +    
Sbjct: 275 LKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHC 334

Query: 344 TLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENT 403
             ++      +A +V + IPVP       F  S G  KY   +  ++WK   + G  E +
Sbjct: 335 KAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYS 394

Query: 404 LSGKVAIPATSHDL----------SDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQ 453
           +S ++ +P+ S++           +++L+    P+ + F+I  F+ SG+ VR+LK  EP+
Sbjct: 395 MSAELGLPSISNNEDGNRTMPKSNAEILKG---PVQIKFQIPYFTTSGIQVRYLKINEPK 451

Query: 454 LNYQPVKWIKYISHSG-AYEIR 474
           L Y+   W++YI+ SG  Y IR
Sbjct: 452 LQYKSYPWVRYITQSGDDYTIR 473

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  194 bits (494), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 132/493 (26%), Positives = 239/493 (48%), Gaps = 46/493 (9%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVIN---DPHVRSPILTLGSTTFQHV 57
           M+S+I   ++KG  L+S+  +D +  +  D F T ++    +  V  P LT       ++
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLT--HNGIHYL 58

Query: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAFGIN-DEDVLKDEFMLLYEIL 115
             + +D   +++VA++ S + ++S ++ +LHKL ++M  +  + +E+ ++D F+++YE+L
Sbjct: 59  FIQHND---LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELL 115

Query: 116 ELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXX 175
           +  ++ GIPQ T+   +   +++K  +                                 
Sbjct: 116 DEMMDYGIPQITETKMLKQYITQKSFK-------------------LVKAAKKKRNAARP 156

Query: 176 XXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPL 235
                    WRP G+KYKKNE +LDI E I +L+ + G +++S + G V   S LSGMP 
Sbjct: 157 PQALTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPD 216

Query: 236 CQLGLND-------------TYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILE 282
            +LG+ND               + + +  +E++  +  +                +V LE
Sbjct: 217 LKLGINDKGIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELE 276

Query: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYK 342
           D KFHQCV+L+K+E   +I F+PPDG F+LM YR+   I         + +   S +   
Sbjct: 277 DLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIH 336

Query: 343 VTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTEN 402
              ++       A +V + IPVP       F  S G  K+   +  ++WK   + G  E 
Sbjct: 337 CRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEY 396

Query: 403 TLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWI 462
           +++ ++ +P+   +    L+    P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W+
Sbjct: 397 SMAAQLGLPSIDDNEKPKLKR---PVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWV 453

Query: 463 KYISHSG-AYEIR 474
           +YI+ SG  Y IR
Sbjct: 454 RYITQSGDDYTIR 466

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  189 bits (480), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 136/483 (28%), Positives = 238/483 (49%), Gaps = 52/483 (10%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58
           M+S I+  + KG  ++S+  +D +  S  D F   ++ D    S ++   L     Q++ 
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYLF 59

Query: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQ-LMEAFGINDEDVLKDEFMLLYEILE 116
            E  D   +++VA+S S   +++ ++ +LHKL + L +     +E+ ++D F+++YE+L+
Sbjct: 60  IEHED---LYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLD 116

Query: 117 LTLENGIPQTTD---LAQIIPRVSRKPIEN-NTISKSPDLDDFLSGSNIXXXXXXXXXXX 172
             ++ GIPQ T+   L Q I + S K I+    +  +      L+ S             
Sbjct: 117 EMMDYGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNS------------- 163

Query: 173 XXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSG 232
                       WR  G+ YKKNE +LDI E I +++ + G +++S + G V   S LSG
Sbjct: 164 ----------VSWRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIGQVIVRSRLSG 213

Query: 233 MPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQL 292
           MP  +LG+ND      + ++  S V    +               S  LED KFHQCV+L
Sbjct: 214 MPDLKLGINDKGIFTRDPETGESQVTAGKK-------------KSSAELEDLKFHQCVRL 260

Query: 293 NKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSN 352
           +K+E   +I F+PPDG F+LM YR+   +         V++   S +      ++     
Sbjct: 261 SKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKK 320

Query: 353 VSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPA 412
             A +V + IPVP       F  S G  K+   +  ++WK   + G  E +++ ++ +P+
Sbjct: 321 SVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPS 380

Query: 413 TSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AY 471
            +    +  ++ R P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W++YI+ +G  Y
Sbjct: 381 ING--VEKPKFKR-PVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDY 437

Query: 472 EIR 474
            IR
Sbjct: 438 TIR 440

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  189 bits (481), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 133/481 (27%), Positives = 238/481 (49%), Gaps = 34/481 (7%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVIN---DPHVRSPILTLGSTTFQHV 57
           M SAI+  + KG  L+S+  +D +  S  D F   + N   + ++  P +      F  +
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLM-EAFGINDEDVLKDEFMLLYEIL 115
             + +D   ++LVA++ S + ++++I+ +LHK+ +++ E     +E+ ++D F+++YE+L
Sbjct: 61  --QHND---LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELL 115

Query: 116 ELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXX 175
           +  ++ GIPQ T+     P++ ++ I   +                              
Sbjct: 116 DEMMDYGIPQITE-----PKMLKQYITQKSFKLK--------------KAAKKKRNAARP 156

Query: 176 XXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPL 235
                    WRP G+K+KKNE +LDI E I +L+ + G +++S + G V   S LSGMP 
Sbjct: 157 PTSLTNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPD 216

Query: 236 CQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKY 295
            +LG+ND        + + + V +  +               ++ LED KFHQCV+L+K+
Sbjct: 217 LKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKF 276

Query: 296 EANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSA 355
           E    I F+PPDG F+LM YR+   I         ++    S +      ++      +A
Sbjct: 277 ENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTA 336

Query: 356 KDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPAT-S 414
            +V + IPVP       F  S G  KY   +  ++WK   + G  E +++ ++ +P+T +
Sbjct: 337 TNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNA 396

Query: 415 HDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AYEI 473
            + S+ L+    P+ + F+I  F+ SG+ VR+LK +E  L Y+   W++YI+ SG  Y I
Sbjct: 397 GEESEKLKR---PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTI 453

Query: 474 R 474
           R
Sbjct: 454 R 454

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  188 bits (478), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 136/485 (28%), Positives = 247/485 (50%), Gaps = 46/485 (9%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58
           M+S ++  +A G  ++S+  +D +  S  D F +Q++ +    S ++   L      ++ 
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKF-SQILLEHEEESSVVPPCLLYQGIHYLF 59

Query: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAFGIN-DEDVLKDEFMLLYEILE 116
            + SD   +++VA++ S   + + I+ +LH+L  ++  +  + +E+ ++D F+++YE+L+
Sbjct: 60  IQHSD---IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLD 116

Query: 117 LTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXX 173
             ++ GIPQ T+   L Q I + S K I+     ++         +++            
Sbjct: 117 EMMDYGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVS----------- 165

Query: 174 XXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGM 233
                      WR  G+KYKKNE YLDI E I +L+ + G +++S + G V   S LSGM
Sbjct: 166 -----------WRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGM 214

Query: 234 PLCQLGLNDT--YSIH-GNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCV 290
           P  +LG+ND   +S +  NE+     V+++++               ++ LED KFHQCV
Sbjct: 215 PDLKLGINDKGIFSKYLENEEDFSKPVQIIND------DSTTNGKKSNIELEDLKFHQCV 268

Query: 291 QLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFP 350
           +L+K+E   +I F+PPDG F+LM YR+   I         +++   S +      ++   
Sbjct: 269 RLSKFENEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIK 328

Query: 351 SNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAI 410
               A +V + IPVP       F  S G  K+   +  ++WK   + G  E +++ ++ +
Sbjct: 329 KKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGL 388

Query: 411 PATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG- 469
           P+   D  +  +  R P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W++YI+ SG 
Sbjct: 389 PSV--DGIEPPKVKR-PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGD 445

Query: 470 AYEIR 474
            Y IR
Sbjct: 446 DYTIR 450

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  187 bits (474), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 133/480 (27%), Positives = 229/480 (47%), Gaps = 35/480 (7%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRT---QVINDPHVRSPILTLGSTTFQHV 57
           M+S I+  +  G  ++++  +D +  +  D F     Q+  +  V  P +        ++
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIM--HKGIHYL 58

Query: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEIL 115
             + SD   +++VA++ S   + + I+ +LH+L +++E +  I  E+ ++D F+++YE+L
Sbjct: 59  FIKHSD---IYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELL 115

Query: 116 ELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXX 175
           +  ++ GIPQ T+   +   +++K                 S   I              
Sbjct: 116 DEMMDFGIPQITETKMLKKYITQK-----------------SFKLIKTSTSKKKKNAARP 158

Query: 176 XXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPL 235
                    WRP G+ YKKNE +LDI E I +LV + G +++S + G+V   S LSGMP 
Sbjct: 159 PAELTNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPD 218

Query: 236 CQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKY 295
            +LG+ND   I  N   E ++    S                 + LED KFHQCV+L+K+
Sbjct: 219 LKLGINDR-GIFSNYLEENNVDGSSSS---TPIPEGVEDKKPQIELEDLKFHQCVRLSKF 274

Query: 296 EANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSA 355
           E   +I F+PPDG F LM YR+   I         +++   S +      ++       A
Sbjct: 275 ENEKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIA 334

Query: 356 KDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSH 415
            +V + IPVP       F  S G  K+   +  ++WK   + G  E ++S ++ +P+   
Sbjct: 335 NNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDG 394

Query: 416 DLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGA-YEIR 474
                +R    P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W++YI+ SG  Y IR
Sbjct: 395 VEPPKVRR---PVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  186 bits (473), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 134/484 (27%), Positives = 238/484 (49%), Gaps = 61/484 (12%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFR---TQVINDPHVRSPILTLGSTTFQHV 57
           M+SA++  + KG  ++S+  +D +  S  D F     Q+  +  V  P L+      Q++
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLS--HDGIQYL 58

Query: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAFGIN-DEDVLKDEFMLLYEIL 115
             + +D   +++VA++ S   + + ++ +LHKL +++E +  + +E+ ++D F+++YE+L
Sbjct: 59  FIQHND---LYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELL 115

Query: 116 ELTLENGIPQTTD---LAQIIPRVSRKPIENNTISKS-PDLDDFLSGSNIXXXXXXXXXX 171
           +  ++ GIPQ T+   L Q I + S K ++    SK+ P     ++ S            
Sbjct: 116 DEMMDYGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNS------------ 163

Query: 172 XXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLS 231
                        WR   + +KKNE +LDI E I +L+ + G +++S + G +   S LS
Sbjct: 164 -----------VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLS 212

Query: 232 GMPLCQLGLNDTYSIHGNEKSELSIVEMMSEY-----DXXXXXXXXXXXXGSVILEDCKF 286
           GMP  +LG+ND                + S+Y     D             ++ LED KF
Sbjct: 213 GMPDLKLGINDK--------------GIFSKYVEGDSDPVTTAVTEGKKKTNIELEDLKF 258

Query: 287 HQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLR 346
           HQCV+L+K+E   +I F+PPDG F+LM YR+   +         V++   S +      R
Sbjct: 259 HQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRAR 318

Query: 347 SLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSG 406
           +       A  V + IPVP       F  + G  K+   +  ++WK   + G  E ++S 
Sbjct: 319 AQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSA 378

Query: 407 KVAIPA-TSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYI 465
           ++ +P+  + D   + R    P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W++YI
Sbjct: 379 QMGLPSINALDKPKVKR----PVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYI 434

Query: 466 SHSG 469
           + SG
Sbjct: 435 TQSG 438

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  126 bits (317), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 125/518 (24%), Positives = 211/518 (40%), Gaps = 117/518 (22%)

Query: 10  AKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRESSDNLPMWL 69
           + G+  I    + H K  +  VF  + I+  ++R       S     ++ E+S+      
Sbjct: 24  SNGEESIELFQQAHSKHPMVPVFHYKGIHFVYIRRDGFYFISAV--ELVAEASN------ 75

Query: 70  VAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLK----DEFMLLYEILELTLENGIPQ 125
               +S+ +   I  YL   Y L++ +  N + + +    D F L+YE+L+ +L+ G+PQ
Sbjct: 76  ---KKSHFNVMAILTYLENFYTLLKRY-FNSQKLNRWLIVDNFHLIYELLDESLDFGVPQ 131

Query: 126 TTDLAQIIPRVSRK-------PIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXXXX 178
            TD   I   +  +          +  ISK  DL  F    +                  
Sbjct: 132 LTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMNSFIARTTTSA----- 186

Query: 179 XXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGS-IVKSFVDGSVDCVSHLSGMPLCQ 237
                 WRP G+ Y KNE +LD+ E+I   +  + S I K+FV G + C S+LSGMP  +
Sbjct: 187 ----ISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLSGMPKLK 242

Query: 238 LGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEA 297
           +GL+   S    E+ +                           + + KFHQCV L   + 
Sbjct: 243 IGLSKITSSLPKEREQF--------------------------MNNAKFHQCVSLEDLQK 276

Query: 298 NHVIQFVPPDGPFQLMQYRVIDNINIP-------FNVIPEVEIVKNSTLNYKVTLRSLFP 350
           N ++ F+PPDG FQL +Y++  ++  P       F+V  E +  K   +   +T+ + F 
Sbjct: 277 N-IVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEK--KRPKILISLTITTDFK 333

Query: 351 SNVSAKDVTVKIPV------------PPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKG 398
           S  S   + ++IP+             P   KCD     G   ++  +  ++W+    KG
Sbjct: 334 SQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCD----QGNVLFNLTDDLLLWEVGSIKG 389

Query: 399 ---STENTLSGKVAI---PATSHDLSDLLRWSRPP------------------------- 427
               TE+++  +  +         L +L     PP                         
Sbjct: 390 GHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSR 449

Query: 428 -ISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
            +SM FEI  ++ SGL V++LK +E QL Y    W++Y
Sbjct: 450 LVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRY 487

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  126 bits (316), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 129/537 (24%), Positives = 230/537 (42%), Gaps = 117/537 (21%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFR-TQVINDPHVRSPILTLGSTTFQHVIR 59
           M S+IF+ + + + LI K  K  V+   A  +R  +V    +V  P++      F  + R
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS-VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISICR 57

Query: 60  ESSDNLPMWLVAVS----RSNVDSSMIWEYLHKLYQLMEAF-GIN--DEDVLKDEFMLLY 112
           +      ++ V++S    RS++ S+++  YL+  + L++ +  +N  D   + D F L+Y
Sbjct: 58  DG-----LYFVSMSVGSLRSSIMSTLV--YLNDFHMLLKKYLRVNALDRTRIVDNFNLIY 110

Query: 113 EILELTLENGIPQTTDLAQII------------PRVSRKPIENN-TISKSPDLDDFLSGS 159
           E+L+ +L+ GIPQ TD   I             P+++R   +++ +  +  ++ +    S
Sbjct: 111 ELLDESLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKS 170

Query: 160 NIXXXXXXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINE-KITILVGKDGSIVKS 218
           N                        WRP G+ Y KNE+++D+ E +  ++  K   + K+
Sbjct: 171 NKHGFQDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKN 230

Query: 219 FVDGSVDCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGS 278
           F+ G + C S+LSGMP+ ++ +N                +M+ + D              
Sbjct: 231 FIFGRIICRSYLSGMPVVKICIN----------------KMLKDRDQ------------- 261

Query: 279 VILEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNI-NIPFNVIPEVEIV--- 334
             L   KFHQCV L    +   I+F+PPDG FQL +Y++  +I + P   + E ++V   
Sbjct: 262 -FLSSAKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKVVEKP 320

Query: 335 KNSTLNYKVTLRSLFPSNVSAKDVTVKIPVPPT------------TIKCDFNVSGGKCKY 382
           K   L   + ++  F +  SA  + +++P+                 KCDF    G   +
Sbjct: 321 KKHKLQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDF----GSILF 376

Query: 383 DAGEKCMVWKYNKYKGSTENTLSGK----VAIPATSH--DLSDLLRWSRPP--------- 427
           +  +  ++WK N  KG    T            A +H  +  +L     PP         
Sbjct: 377 NLSDGYLLWKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRME 436

Query: 428 --------------------ISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
                               I+  FE+  F++SGL V +LK +E QL YQ   W++Y
Sbjct: 437 ELYALAHEEKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRY 493

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  124 bits (311), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 123/529 (23%), Positives = 221/529 (41%), Gaps = 102/529 (19%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M S +FI + + + LI + +K         ++  +V   P  R P++      + +++R+
Sbjct: 1   MSSCVFILDEQLNPLILRNLKSIAHPEWYALYFKRV--HPQSRGPVIYSKGIIYIYILRD 58

Query: 61  SSDNLPMWLVAVSRSNVDSSM--IWEYLHKLYQLMEAF-GIN--DEDVLKDEFMLLYEIL 115
                 ++ V+VS   +  ++  I  YL+  + L+  +  +N  D   + D F L+YE+ 
Sbjct: 59  G-----LYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELF 113

Query: 116 ELTLENGIPQTTDLAQI---------IPRVSRKPIENNTISKSPDL---DDFLSGSNIXX 163
           + +L+ GIPQ TD   I         +P+V      ++     P++    +    ++I  
Sbjct: 114 DESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHG 173

Query: 164 XXXXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDG 222
                                WRP G+ Y KNE+++DI E+ + L+  K+  + ++FV G
Sbjct: 174 FRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYG 233

Query: 223 SVDCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILE 282
            ++C S+LSGMP+ ++ +N                +M+ + D              + L 
Sbjct: 234 KINCRSYLSGMPIVRVCIN----------------KMLKDKD--------------LFLG 263

Query: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNIN-IPFNVIPEVEI---VKNST 338
             KFHQCV L    +   I+F+PPDG FQL +Y++  +IN  P   + + +I    K   
Sbjct: 264 SSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKINERQKKHR 323

Query: 339 LNYKVTLRSLFPSNVSAKDVTVKIPVPP--TTIKCD------FNVSGGKCKYDAGEKCMV 390
           L+  VT++  F +  SA  + + IP        K D      F    G   ++  ++ ++
Sbjct: 324 LHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLL 383

Query: 391 WKYNKYKGS-TENTLSGKVAIP-----ATSHDLSDLLRWSRPP----------------- 427
           W     KG   E + S  V          +  L  + +   PP                 
Sbjct: 384 WDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKS 443

Query: 428 ------------ISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
                       I+  FE+  +++SGL V +LK  E  L YQ   W++Y
Sbjct: 444 NKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRY 492

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  117 bits (294), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 119/480 (24%), Positives = 193/480 (40%), Gaps = 121/480 (25%)

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAF---GINDEDVLKDEFMLLYEILEL 117
           + DNL   ++    ++V    +  YL ++YQL   F    +N  +V +D F L++E++E 
Sbjct: 59  TRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNV-RDNFHLIFEVIEE 117

Query: 118 TLENGIPQTTDLAQIIPRVSRKPIE-----NNTISKSPDL-----DDFLSGSNIXXXXXX 167
           + + GI Q T+   I   +  + I+      NT S+  +L     D+    S I      
Sbjct: 118 SSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTMTS 177

Query: 168 XXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDC 226
                            WRP G+ Y KNE +LD+ EK+  ++  ++G +  + ++G++ C
Sbjct: 178 A--------------VSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIIC 223

Query: 227 VSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKF 286
            S+LSGMP   +GLN                ++M +                  ++  KF
Sbjct: 224 RSYLSGMPQLSIGLN----------------KLMQK--------------NVHFMKRLKF 253

Query: 287 HQCVQLNKY--EANHVIQFVPPDGPFQLMQYR---------VIDNINIPFNVIPEVEIVK 335
           H+CV L+    E + VI+F+PPDG F+L  Y+         VI   +   +  P      
Sbjct: 254 HECVDLHTLIKEESPVIKFIPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQET 313

Query: 336 NSTLNYKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCD--------FNVSGGKCKYDAGEK 387
              L  K  + + F +  SAK++ +KIP+     K +        F    G   +D    
Sbjct: 314 QDKLLLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAG 373

Query: 388 CMVWKYNKYKGSTENTLSG-----KVAIPATSHDLSDLLRWSRPP--------------- 427
            ++WK N  KG   N   G     ++        L   LR S  P               
Sbjct: 374 SIIWKINNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQ 433

Query: 428 -----------------------ISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
                                  I+M FEI  ++ SGL V + K +EPQLNYQ   W++Y
Sbjct: 434 YHGKTTEYDGNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRY 493

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  109 bits (272), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 114/492 (23%), Positives = 187/492 (38%), Gaps = 110/492 (22%)

Query: 43  RSPILTLGSTTFQHVIRESSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGIN--D 100
           R P+L+     + ++ R   D L    ++     V    ++ YL +LYQL + +     +
Sbjct: 39  RLPVLSHRGYDYIYIQR---DGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLN 95

Query: 101 EDVLKDEFMLLYEILELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSN 160
             ++ D F L+YE+++ +++ GIPQ TD       + R  ++   + ++ D +       
Sbjct: 96  RQLIMDNFHLVYELMDESIDMGIPQLTD-----HNIIRDYVKVQVVRRAEDGEKHAGKHK 150

Query: 161 IXXXXXXXXXXXX------------XXXXXXXXECPWRPSGLKYKKNEVYLDINEKITIL 208
                                               WRP G+ Y KNE +LD+ E++  L
Sbjct: 151 AKRDKAGKEEEEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYL 210

Query: 209 VGKDGSIVK-SFVDGSVDCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXX 267
           +  + + V+ + V G+++C S+LSGMP   +GLN   +   +  S++             
Sbjct: 211 MDFERAQVRLNQVHGAINCRSYLSGMPQLTVGLNKMVAQDRDFTSQV------------- 257

Query: 268 XXXXXXXXXGSVILEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNIN----- 322
                             FHQCV L +   +  I FVPPDG FQL  Y++    N     
Sbjct: 258 -----------------HFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLI 300

Query: 323 ----IPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTVKIPVP------------P 366
                   V P         L   V++ + F    +   + V++P+             P
Sbjct: 301 KLEECRAAVKPRRRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFP 360

Query: 367 TTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGS---------------TENTLSGKVAIP 411
              KCD     G   ++  +  ++W   K KGS                E   S + A  
Sbjct: 361 PRFKCD----AGCVMFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQL 416

Query: 412 ATSHD------------LSDLLRWSRPP-----ISMGFEIVMFSNSGLVVRHLKCQEPQL 454
           +TS D            L +    S P      + + FE+   + SGL V  LK  EPQL
Sbjct: 417 STSMDPLPAHPGQQLEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQL 476

Query: 455 NYQPVKWIKYIS 466
            YQ   WI+Y S
Sbjct: 477 QYQSFPWIRYKS 488

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  107 bits (266), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 134/545 (24%), Positives = 212/545 (38%), Gaps = 116/545 (21%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M+S +FI + +  LL  +L+K  V   L  +     I  P  +SPIL      +  + R 
Sbjct: 1   MISCLFILDEELQLLTVRLLKP-VPSLLEPL--EWFIRHPK-KSPILQNMDYDYIFIQR- 55

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAF-GINDEDVL-KDEFMLLYEILELT 118
             D L    ++   +NV   +++ YL++L+ L + + G N   VL    F L++E+++ +
Sbjct: 56  --DGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLITGNFHLIHELIDES 113

Query: 119 LENGIPQTTDLAQIIPRVSRKPIENNTISKSPD--------------LDDFLSGSNIXXX 164
           +  G PQ TD       + R  I+   +  SP+                           
Sbjct: 114 IFMGTPQLTDY-----NIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDSKKKEEDTE 168

Query: 165 XXXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKS-FVDGS 223
                               WRP G+ Y KNE YLD+ E +  LV      +KS  V G 
Sbjct: 169 ATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGY 228

Query: 224 VDCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILED 283
           + C S+LSGMP+  +GLN   S               +EY                 +  
Sbjct: 229 IQCRSYLSGMPMLTIGLNKLNS--------------ENEY----------------FMRR 258

Query: 284 CKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPE---VEIVKNST-- 338
             FHQCV L++   + +I F PPDG FQL  Y++  N++ P  +  E   V++    T  
Sbjct: 259 ANFHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKD 318

Query: 339 ----LNYKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCD--------FNVSGGKCKYDAGE 386
               L   VT+ + F    S   + +K+P+       D        F    GK  ++  +
Sbjct: 319 GLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITD 378

Query: 387 KCMVWKYNKYKG---------STENTLSGKVAIPATSHDLSDLLRWSRPPISMG------ 431
             ++W+  K KG          +E  L  +         LS+ +     PI  G      
Sbjct: 379 DYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSM--DPKPIRRGPHLEKL 436

Query: 432 --------------------FEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY--ISHS- 468
                               FEI  ++ SGL V  LK +E QL +Q   W++Y  I+H  
Sbjct: 437 YQQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTINHDI 496

Query: 469 GAYEI 473
            AY++
Sbjct: 497 YAYQL 501

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  106 bits (265), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 92/349 (26%), Positives = 146/349 (41%), Gaps = 93/349 (26%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVGKDGSIVK-SFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G++Y KNE +LD+ EK+   +    +I+K + + G + C S LSGMP  ++ LN  
Sbjct: 225 WRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLNKI 284

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHVIQF 303
             I+ +++                             L  CKFHQCV  +  +   V++F
Sbjct: 285 --IYQDKQ----------------------------FLSSCKFHQCVMPDSVDEGKVLEF 314

Query: 304 VPPDGPFQLMQYRVIDNIN-------IPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAK 356
           VPPDG F L +Y +  ++N       I + V P+++  K   L   VT+ S F    S  
Sbjct: 315 VPPDGDFVLCKYELKRHVNDLPLLKLISYEVKPKLDKYK---LKLFVTIESTFKKTNSTT 371

Query: 357 DVTVKIPVPPTTIKCDFNVSG--------GKCKYDAGEKCMVWKYNKYK-GSTENTLSGK 407
            + +KIP+     K D ++S         GK  ++  +  ++W+    K G+++  +   
Sbjct: 372 KLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGAD 431

Query: 408 VAIPATSHDL---SDLLRWSRPP------------------------------------- 427
            A+      L    +L     PP                                     
Sbjct: 432 FALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNL 491

Query: 428 ISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY--ISHSG-AYEI 473
           I M FEI   ++SGL V +LK +EP L YQ   W++Y  IS  G AY +
Sbjct: 492 IKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYAYAV 540

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  100 bits (248), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 129/557 (23%), Positives = 218/557 (39%), Gaps = 137/557 (24%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRT-QVINDPHVRSPILTLGSTTFQHVIR 59
           M S IFI +   + LISK IK     +L  + R  + +  P  + P+++  S  F H+ R
Sbjct: 1   MSSCIFITDENLEPLISKNIK--AIPNLQGILRLFKSVYTPESQ-PVISASSFHFVHIKR 57

Query: 60  ESSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLME---AFGINDEDVLKDEFMLLYEILE 116
            S   L + ++    ++ +  +I  +L + + L++   A    D++++ D  +L+ E+++
Sbjct: 58  SSL--LYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 LTLENGIPQTTDLAQIIP---RVSRKPIENNTI---------------------SKSPDL 152
            +++ G+ Q TD A I+    RV     EN TI                     S  P+L
Sbjct: 116 ESIDFGVIQITD-ASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKPNL 174

Query: 153 DDFLSGSNIXXXXXXXXXXXXXX-----------XXXXXXECPWRPSGLKYKKNEVYLDI 201
             FL G+                                    WR  G+ Y +NE +LD+
Sbjct: 175 YKFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFLDV 234

Query: 202 NEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMM 260
            E++  L+    G I K+ + G + C S+LSGMP  ++  N                  +
Sbjct: 235 VEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFNK-----------------L 277

Query: 261 SEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDN 320
           S+ D                +   KFHQCV          I+F+PPDG F L QY +  +
Sbjct: 278 SQKDEQ-------------FISHSKFHQCVTWPSSNEKE-IEFIPPDGDFVLCQYELKRH 323

Query: 321 IN-------IPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTVKIPVP-------- 365
           +        + F V P+   +K   +    T+ + F +  S   + +KIP+         
Sbjct: 324 VKDQPMLKLVSFGVKPK---LKKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQI 380

Query: 366 ----PTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGS---TENTLSGKVAI-------- 410
               P   K D     GK  ++  +  ++W     KG    T+ +++ + ++        
Sbjct: 381 DLKKPARFKSD----SGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEE 436

Query: 411 ----------PATSHD------LSDLLRWSRPP-------ISMGFEIVMFSNSGLVVRHL 447
                     P    D      L D +   + P       +SM FEI   + SGL V +L
Sbjct: 437 EQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYL 496

Query: 448 KCQEPQLNYQPVKWIKY 464
           K  E QL YQ   W++Y
Sbjct: 497 KIDEEQLQYQSFPWVRY 513

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 97.8 bits (242), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 123/566 (21%), Positives = 216/566 (38%), Gaps = 139/566 (24%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M S +FI +   + LISK +K    R+L  +     +N      P+ T+    +  + R+
Sbjct: 1   MSSCLFILDESLEPLISKNVKS--VRNLTGILEFFKLNYKENGPPVFTVLEWHYVFIKRD 58

Query: 61  SSDNLPMWLVAVSRSNVDS----SMIWEYLHKLYQLMEAFGIN---DEDVLKDEFMLLYE 113
           S     +W +       D       +  YL +LY L++ +      D +++ D  +L+ E
Sbjct: 59  S-----LWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIE 113

Query: 114 ILELTLENGIPQTTDLAQIIPRVSRK---PI-------ENNTISKSPDLDDFLSGSNIXX 163
           +++ +++ GI Q TD + I   +  K   PI       +++T  K   L  ++ G     
Sbjct: 114 LIDESMDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIV 173

Query: 164 XXXXXXXXXXXXXXXXXXE-----------------------CPWRPSGLKYKKNEVYLD 200
                             +                         WR  G+ Y KNE +LD
Sbjct: 174 KLWKGQPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLD 233

Query: 201 INEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEM 259
           + EK+  L+    G I K+ + G + C  +LSGMP  ++ LN    I  +E+        
Sbjct: 234 VIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALNKL--IKNDEQ-------- 283

Query: 260 MSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHV------------IQFVPPD 307
                                + + KFHQCV +N  +                I+F+PPD
Sbjct: 284 --------------------FISNSKFHQCVSINSLKREINNEEEENTYHGKEIEFIPPD 323

Query: 308 GPFQLMQYRVIDNI-NIPFNVIPEVEI---VKNSTLNYKVTLRSLFPSNVSAKDVTVKIP 363
           G F L +Y +  ++ ++P   +  +EI   +K   +   VT+ + F    S   +T+KIP
Sbjct: 324 GEFVLCKYELKRHVRDVPVIKLSNIEIKPKLKKYKIQIHVTIETHFKKQNSTSVLTIKIP 383

Query: 364 VPPT--------TIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVA------ 409
           +           T +  F    G+  ++  +  ++W+    KG    + +  VA      
Sbjct: 384 LRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEFFIFN 443

Query: 410 ----------------------------IPATSHDLSDLLR---WSRPPISMGFEIVMFS 438
                                       I   +HD  D       S+  ++M FE+   +
Sbjct: 444 QEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEVPYST 503

Query: 439 NSGLVVRHLKCQEPQLNYQPVKWIKY 464
            SGL V +LK +E Q+NYQ   W++Y
Sbjct: 504 CSGLKVEYLKIEENQVNYQSFPWVRY 529

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 139/333 (41%), Gaps = 86/333 (25%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ EK+  L   K+  + K+ + G + C S+LSGMP  ++ LN  
Sbjct: 238 WRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALN-- 295

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHVIQF 303
                       +++  +++                 +   KFHQCV L        ++F
Sbjct: 296 -----------KLLQRDAQF-----------------MSHSKFHQCVALETLNEKE-LEF 326

Query: 304 VPPDGPFQLMQYRVIDNIN-IPFNVIPEVEI---VKNSTLNYKVTLRSLFPSNVSAKDVT 359
           +PPDG F L +Y +  ++N  P   I   EI   +K   L   +T+ + F +  S   + 
Sbjct: 327 IPPDGEFILCEYELKRHVNDTPILKITSFEIKPQLKKFKLRILLTIETHFKTRNSTSILN 386

Query: 360 VKIPVPPTTIKCDFNV----------SGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVA 409
           VKIP+    +  D+N+          + G+  ++  +  ++W+  + +G    T    VA
Sbjct: 387 VKIPL--AKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVA 444

Query: 410 ----------------------------------IPATSHDLSD---LLRWSRPP-ISMG 431
                                             + A +H   D   L++  +   + M 
Sbjct: 445 EFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMD 504

Query: 432 FEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
           FEI   + SGL V +LK +E QL YQ   W++Y
Sbjct: 505 FEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRY 537

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 88.2 bits (217), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 91/369 (24%), Positives = 136/369 (36%), Gaps = 122/369 (33%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ EK+  LV  + G + +S + G + C S+LSGMP  ++ LN  
Sbjct: 251 WRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN-- 308

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLN------KYEA 297
             +  N+K  +S V+                           FHQCV L+      KY  
Sbjct: 309 -KLLQNDKQFISQVQ---------------------------FHQCVSLDSIEKVIKYAE 340

Query: 298 NHV----------------IQFVPPDGPFQLMQYRVIDNINIP-------FNVIPEVEIV 334
            H                 I+F+PPDG F L  Y +  +I  P       F + P+    
Sbjct: 341 EHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPK---W 397

Query: 335 KNSTLNYKVTLRSLFPSNVSAKDVTVKIPVPPT--------TIKCDFNVSGGKCKYDAGE 386
           K   L     + + F    S   + VKIP+                F  S G+  Y+  +
Sbjct: 398 KKYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISD 457

Query: 387 KCMVW-----KYNKYKGSTEN--------TLSGKVAI---------------------PA 412
             ++W     K  K  GS E+        T++ +  +                       
Sbjct: 458 DFLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLR 517

Query: 413 TSHDLSDLLRWSRPP-----------------ISMGFEIVMFSNSGLVVRHLKCQEPQLN 455
           T   L D+ + +                    +SM FEI   + SGL V +LK  E QL 
Sbjct: 518 TGPKLEDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQ 577

Query: 456 YQPVKWIKY 464
           YQ   W++Y
Sbjct: 578 YQSFPWVRY 586

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 86/354 (24%), Positives = 130/354 (36%), Gaps = 107/354 (30%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ E +  L+  KD  I ++ + G + C S+LSGMP  ++ LN  
Sbjct: 227 WRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALN-- 284

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHV--- 300
             I  ++K                             L   KFHQCV LN      +   
Sbjct: 285 -KILQDDKQ---------------------------FLGHAKFHQCVSLNSINIKDLEKD 316

Query: 301 -----------------IQFVPPDGPFQLMQYRVIDNINIP-------FNVIPEVEIVKN 336
                            I+F+PPDG F L QY +  ++  P       F++ P     K 
Sbjct: 317 LEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPN---FKK 373

Query: 337 STLNYKVTLRSLFPSNVSAKDVTVKIPVPP--TTIKCD------FNVSGGKCKYDAGEKC 388
             +   + + + F    S   +T+KIP+       K D      F    GK  ++  E  
Sbjct: 374 FRVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDF 433

Query: 389 MVWKYNKYKGSTENTLSGKVA----------------------------------IPATS 414
           ++W+ +  KG       G VA                                  +    
Sbjct: 434 LIWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEM 493

Query: 415 HDLSD----LLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
           H+  D     L+     + M FEI   + SGL V +LK +E  L YQ   W++Y
Sbjct: 494 HENEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRY 547

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 81/354 (22%), Positives = 140/354 (39%), Gaps = 101/354 (28%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVGKDGSIVK-SFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +L++ EK+   +    +++K + + G + C   LSGMP  ++ +N  
Sbjct: 255 WRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSINKI 314

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEA--NHVI 301
                NE  +                           L +CKFHQCV L   E+  +  +
Sbjct: 315 V----NEDKQF--------------------------LANCKFHQCVSLASLESSDHKDV 344

Query: 302 QFVPPDGPFQLMQYRVIDNIN-------IPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVS 354
           +FVPPDG F L +Y +  ++        + F V P+++  K       +T+ + F +  +
Sbjct: 345 EFVPPDGEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKL---LLTIETHFKTTNA 401

Query: 355 AKDVTVKIPVPP------------TTIKCD-----FNVSG--------------GKCKYD 383
              + +++P+                 KCD     FN+S               G+ +  
Sbjct: 402 TSKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLS 461

Query: 384 AGEKCMVWKYNKY-----------------KGSTENTLSGKV----------AIPATSHD 416
            G +  ++   +Y                 +G     L  ++            P   H 
Sbjct: 462 MGVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHR 521

Query: 417 LSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGA 470
           L    R     ++M FE+   ++SGL V +LK +EPQL YQ   W++Y + S A
Sbjct: 522 LQPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 85/360 (23%), Positives = 137/360 (38%), Gaps = 110/360 (30%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ E++  L+  + G I K+ + G + C S+LSGMP  ++ +N  
Sbjct: 255 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN-- 312

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLN---------K 294
                       I+    ++                 + +  FHQCV L+         +
Sbjct: 313 -----------KILNRDPQF-----------------MSNSNFHQCVSLDSINTIEKGQE 344

Query: 295 YEAN----------HVIQFVPPDGPFQLMQYRVIDNI-NIPFNVIPEVEI---VKNSTLN 340
            E N            I+FVPPDG F L QY +  ++ + P   + + EI   +K S + 
Sbjct: 345 KEQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQ 404

Query: 341 YKVTLRSLFPSNVSAKDVTVKIPVPPT--------TIKCDFNVSGGKCKYDAGEKCMVWK 392
               +++ F    S   + VKIP+           + +  F  + GK  ++  +  ++W+
Sbjct: 405 ILTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWE 464

Query: 393 YNKYKGSTENTLSGK---------VAIPATSHDLSDLLRWSR-----------PPISMG- 431
               KG  E   S            A       L +   + R           PP+  G 
Sbjct: 465 IQTMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGP 524

Query: 432 ---------------------------FEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
                                      FEI   + SGL V +LK +EPQL YQ   W++Y
Sbjct: 525 KLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 584

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/369 (23%), Positives = 142/369 (38%), Gaps = 127/369 (34%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ E++  L+  + G I K+ + G + C  +LSGMP  ++ +N  
Sbjct: 254 WRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISINKL 313

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEA------ 297
            +                                   + + KFHQCV L+          
Sbjct: 314 LN------------------------------RDPQFMSNSKFHQCVSLDSINIIEEEGR 343

Query: 298 ------------NHVIQFVPPDGPFQLMQYRVIDNI-NIP------FNVIP-----EVEI 333
                          I+F+PPDG F L QY +  ++ + P      F + P     +++I
Sbjct: 344 DTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKLKKFKIQI 403

Query: 334 VKNSTLNYKVTLRSLFPSNVSAKDVTVKIPVPPT--------TIKCDFNVSGGKCKYDAG 385
           +     N+K       P+N ++K + VKIP+           + +  F  + GK  ++  
Sbjct: 404 ITKIQTNFK-------PTNSTSK-LNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLS 455

Query: 386 EKCMVWKYNKYKGSTE------------NTLSGKVA-IPATSHDLSDLLR------WSRP 426
           +  ++W+    KG  E            +TL+  VA  P  + +  D L+       + P
Sbjct: 456 DDFLLWEIGTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPP 515

Query: 427 PISMG-------------------------------FEIVMFSNSGLVVRHLKCQEPQLN 455
           P+  G                               FEI   + SGL V +LK +EPQL 
Sbjct: 516 PLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQ 575

Query: 456 YQPVKWIKY 464
           YQ   W++Y
Sbjct: 576 YQSFPWVRY 584

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 66/132 (50%), Gaps = 8/132 (6%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVK-RSLADVFRTQVINDPHVRSPILTLGSTTFQHVIR 59
           M S++FI +   + L+SK I+      S+   F+     D     PIL+     F H+ R
Sbjct: 1   MSSSLFILDEDLEPLVSKNIRAIPNLSSILSSFKQCYHRD---SPPILSQNGWFFIHLKR 57

Query: 60  ESSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEA-FGIN--DEDVLKDEFMLLYEILE 116
           +    + + + A  + N+D   I  +L + Y L++  F IN   ++++ D  +L+ E+++
Sbjct: 58  DFLHFISV-IHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLELVD 116

Query: 117 LTLENGIPQTTD 128
             ++ GI Q TD
Sbjct: 117 ECIDFGIVQVTD 128

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 82/364 (22%), Positives = 140/364 (38%), Gaps = 110/364 (30%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ E++  L+  + G I K+ + G + C  +LSGMP  ++ +N  
Sbjct: 262 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISINKI 321

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLN------KYEA 297
            +                                +  L +  FHQCV L+      K E 
Sbjct: 322 LN------------------------------RDAQFLSNSSFHQCVSLDSIKTIEKREE 351

Query: 298 NH-------------VIQFVPPDGPFQLMQYRVIDNI-NIPFNVIPEVEI---VKNSTLN 340
                           ++FVPPDG F L QY +  ++ + P   + + +I   +K   + 
Sbjct: 352 KEDDDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQ 411

Query: 341 YKVTLRSLFPSNVSAKDVTVKIPVPPT--------TIKCDFNVSGGKCKYDAGEKCMVWK 392
            +  +++ F    S   + VKIP+           + +  F  + GK  ++  +  ++W+
Sbjct: 412 IETKIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWE 471

Query: 393 YNKYKGSTE-------------NTLSGKVA-IPATSHDLSDLLRWSR------PPISMG- 431
               KG  E             +  +  VA  P  + +  D L+  +      PP+  G 
Sbjct: 472 IQAMKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGP 531

Query: 432 ---------------------------FEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
                                      FEI   + SGL + +LK +EPQL YQ   W++Y
Sbjct: 532 RLEELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRY 591

Query: 465 ISHS 468
            + S
Sbjct: 592 KTTS 595

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 64/131 (48%), Gaps = 6/131 (4%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60
           M S++FI +   +LL+SK I+     S       Q  +D     PIL+     F H+ R+
Sbjct: 1   MSSSLFILDENLELLVSKNIRALPSLSSVLSSFKQCYHDE--APPILSQNDWFFIHLKRD 58

Query: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAF---GINDEDVLKDEFMLLYEILEL 117
               + + +    + N+D   I  +L + Y L++ +    +  +DV+ D  +L+ E+++ 
Sbjct: 59  FLHFVSV-IHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTKDVILDNVLLVLELMDE 117

Query: 118 TLENGIPQTTD 128
            ++ GI Q TD
Sbjct: 118 CIDFGIVQVTD 128

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 83/364 (22%), Positives = 137/364 (37%), Gaps = 114/364 (31%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ E++  L+  + G I K+ + G + C  +LSGMP  ++ +N  
Sbjct: 260 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISINKI 319

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKY-------E 296
            +                                   + +  FHQCV L+         E
Sbjct: 320 LN------------------------------RDPQFMSNSSFHQCVSLDSINTIEKDEE 349

Query: 297 AN-------------HVIQFVPPDGPFQLMQYRVIDNI-NIPFNVIPEVEI---VKNSTL 339
            N               I+F+PPDG F L QY +  ++ + P   + + EI   +K   +
Sbjct: 350 KNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKI 409

Query: 340 NYKVTLRSLFPSNVSAKDVTVKIPVPPT--------TIKCDFNVSGGKCKYDAGEKCMVW 391
                +++ F    S   + V+IP+           + +  F  + GK  ++  +  ++W
Sbjct: 410 QIVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLW 469

Query: 392 KYNKYKGSTE----------------NTLSGKVA-IPATSHDLSDLLR------WSRPPI 428
           +    KG  E                NT +  VA  P  + +  D L+       + PP+
Sbjct: 470 EIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPL 529

Query: 429 SMG----------------------------FEIVMFSNSGLVVRHLKCQEPQLNYQPVK 460
             G                            FEI   + SGL V +LK +EPQL YQ   
Sbjct: 530 RTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFP 589

Query: 461 WIKY 464
           W++Y
Sbjct: 590 WVRY 593

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 81/359 (22%), Positives = 138/359 (38%), Gaps = 113/359 (31%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ EK+   +  K G I K+ + G + C S+LSGMP  ++ +N  
Sbjct: 252 WRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN-- 309

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANH---- 299
                       I++   ++                 L + KFHQCV L+   A      
Sbjct: 310 -----------KILKQDVQF-----------------LSNVKFHQCVSLDSIRARSNPPA 341

Query: 300 -------------------VIQFVPPDGPFQLMQYRVIDNINIP-------FNVIPEVEI 333
                               I+F+PPDG F L +Y +  ++          F +IP++  
Sbjct: 342 VEEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLHK 401

Query: 334 VKNSTLNYKVTLRSLFPSNVSAKDVTVKIPVPP--TTIKCD------FNVSGGKCKYDAG 385
            K   +   V + + F +  S   + ++IP+     + + D      F    G   ++  
Sbjct: 402 FK---IKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLS 458

Query: 386 EKCMVWKYNKYKGS-TENTLS--------------------------------------- 405
           +K ++W+     G   ENTLS                                       
Sbjct: 459 DKFLLWEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELY 518

Query: 406 GKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
            K+     S ++S   + +   ++M FE+   + SGL + +LK +E QL YQ   W++Y
Sbjct: 519 KKIHEEGDSDEVS-TRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRY 576

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 58/113 (51%), Gaps = 9/113 (7%)

Query: 45  PILTLGSTTFQHVIRESSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAF---GINDE 101
           PIL      F H+ R   D+L    V  + S  +   ++ YL + Y+L++ +   GI + 
Sbjct: 46  PILNDIDWQFLHIKR---DSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNR 102

Query: 102 DVLKDEFMLLYEILELTLENGIPQTTDLAQIIPRVSRK---PIENNTISKSPD 151
           ++L D F+++ E+++ +L+ G+ Q TD + I   V  K   P  N  ++  PD
Sbjct: 103 NLLIDNFLVVIELIDESLDFGVVQFTDSSLIKDYVRVKVNLPELNPDVASIPD 155

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 126/313 (40%), Gaps = 65/313 (20%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVG---KDGSI--VKSFVDGSVDCVSHLSGMPLCQL 238
           PWR +GLKY  NE+Y+D+ E I +++    K G +  V+  +DG VD  SHL+G P+  L
Sbjct: 187 PWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVAL 246

Query: 239 GLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEAN 298
            LN    +HG++                              L     H C Q     + 
Sbjct: 247 KLN----LHGHD------------------------------LGVPALHPCCQAQYTGSP 272

Query: 299 HVIQFVPPDGPFQLMQYRV-IDNINIPFNVIPEVEIVKNSTLNYKVTLRSL-----FPSN 352
             +QFVPPDG F+LMQY + ++ +     +   + +V   +L+Y V L  L        N
Sbjct: 273 ENLQFVPPDGKFRLMQYTIDLEALQTKSKLFSNMGLV---SLDYFVGLGDLRDEFEIKVN 329

Query: 353 VSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLS----GKV 408
           ++       I     TIK       GK   D   K +   +  ++   EN +      K 
Sbjct: 330 IAGSQHVKLIDDLVVTIKF------GKLTSDCRIKALRSTHGHFENGFENNIGKWSFDKE 383

Query: 409 AIPATSHDLSDLLRWSRPPISMGFEIVM-FSNSGLVVRHLKCQEPQL------NYQPVKW 461
               T       L  + P       + + +SN G +   +K     +      N +P K 
Sbjct: 384 TPTGTVPVFRGCLENATPEQIKTLSLAISYSNKGSLPSGIKVGAVDIISGLPKNTKPFKG 443

Query: 462 IKYISHSGAYEIR 474
           +KY++ +G + +R
Sbjct: 444 VKYVARTGQFNLR 456

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 103/238 (43%), Gaps = 44/238 (18%)

Query: 185 WRPSGLKYKKNEVYLDINEKIT-ILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ EK   I+  K+  I K+ + G + C   LSGMP  ++ LN  
Sbjct: 289 WRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN-- 346

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHVIQF 303
                       +++   ++                 L   +FHQCV L   + N  I+F
Sbjct: 347 -----------KLLQKDQQF-----------------LSQLRFHQCVSLETIQ-NKEIEF 377

Query: 304 VPPDGPFQLMQYRVIDNINIPFNV-IPEVEI---VKNSTLNYKVTLRSLFPSNVSAKDVT 359
           +PPDG F L +Y +  ++  P N+ +   EI   +K   +   +++ + F    S   + 
Sbjct: 378 IPPDGEFILCEYELKRHVKDPPNIKLISFEIKPKLKKFKIQINLSITTFFKVQNSTSILN 437

Query: 360 VKIPVPP--TTIKCD------FNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVA 409
           +KIP+       K D      F  + G+ K++  +  ++W+    KG     +    A
Sbjct: 438 LKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKAMTA 495

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 25/37 (67%)

Query: 428 ISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464
           +++ FEI  ++ SGL V +LK +E QL YQ   W++Y
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRY 645

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 70/134 (52%), Gaps = 11/134 (8%)

Query: 1   MLSAIFIYNAKGDLLISKLIKDHVK-RSLADVFRTQVINDPHVRSPILTLGSTTFQHVIR 59
           MLS IFI +   + LISK I+     +S+ ++FR     +     PI+++    F  + R
Sbjct: 1   MLSCIFILDENLEPLISKNIRAIPNFKSIVELFRKHRSTNT-TELPIVSINDWNFIQIKR 59

Query: 60  ESSDNLPMWLVAVSRSNVDSSMIWE--YLHKLYQLMEAFGIND---EDVLKDEFMLLYEI 114
           +S     ++L A++ ++  S ++    YL K Y L++     D    +++ D  +L+ E+
Sbjct: 60  DSL----IFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIMEL 115

Query: 115 LELTLENGIPQTTD 128
           ++ +++ GI Q TD
Sbjct: 116 IDESIDFGIIQMTD 129

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 133/319 (41%), Gaps = 77/319 (24%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVGKD---GSI--VKSFVDGSVDCVSHLSGMPLCQL 238
           PWR +G+KY  NE+Y+D+ E + +++ K+   G +  V+  +DG VD  SHLSG P+  L
Sbjct: 187 PWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHLSGNPVIAL 246

Query: 239 GLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEAN 298
            L     + G++                              L     HQC  L+ Y+  
Sbjct: 247 NLR----LRGHD------------------------------LGMPALHQCC-LDSYQGR 271

Query: 299 -HVIQFVPPDGPFQLMQYRV-IDNINIPFNVIPEVEIVKNSTLNYKVTLRSL---FPSNV 353
              ++FVPPDG FQLM Y + +D++     +   + +V   + +Y+  L  L   F  N+
Sbjct: 272 PDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGLV---SPDYRTELGDLGDEFEVNL 328

Query: 354 S---------AKDVTVKIPVPPTTIKCDFNV---SGGKCKYDAGEKCMVWKYNKYKGSTE 401
           +           D+ + +   P   +C   V   + G  +  A      W ++K      
Sbjct: 329 NIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDK------ 382

Query: 402 NTLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQL------N 455
            T +G   +P     L +  R     + +    V ++N G +   +K     +      N
Sbjct: 383 ETPTG--TLPVLRGCLENATREQVRALQLS---VSYTNRGELPSGIKVDSVDILSGLSKN 437

Query: 456 YQPVKWIKYISHSGAYEIR 474
            +P K +KYI+ +G + +R
Sbjct: 438 IKPFKGVKYIAKTGDFHLR 456

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 109/269 (40%), Gaps = 75/269 (27%)

Query: 185 WRPSGLKYKKNEVYLDINEKITILVG-KDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDT 243
           WR  G+ Y KNE +LD+ EK+   +  + G I K+ + G + C  +LSGMP  ++ +N  
Sbjct: 297 WRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN-- 354

Query: 244 YSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYE------- 296
                       I++  S++                 L +  FHQCV L+          
Sbjct: 355 -----------KILQNDSQF-----------------LSNAHFHQCVSLDSLHLQSAEDD 386

Query: 297 -----------ANH-------VIQFVPPDGPFQLMQYRVIDNI-NIP------FNVIPEV 331
                       NH        I+F+PPDG F L +Y +  ++ ++P      F++ P++
Sbjct: 387 DGDDNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL 446

Query: 332 EIVKNSTLNYKVTLRSLFPSNVSAKDVTVKIPVP--------PTTIKCDFNVSGGKCKYD 383
              K   L   V + + F +  +   + +KIP+           + +  F    GK  ++
Sbjct: 447 SKYK---LKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFN 503

Query: 384 AGEKCMVWKYNKYKGS-TENTLSGKVAIP 411
             +  ++W+    KG   E T+S     P
Sbjct: 504 LSDNFLIWEIGSMKGGHGEVTMSMMAEFP 532

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 398 GSTENTLSGKVAIPATSHDLSDLLRWSRPP--ISMGFEIVMFSNSGLVVRHLKCQEPQLN 455
           GS E T +          D  DL + +R P  + + FEI  ++ SGL + +LK +EPQL 
Sbjct: 593 GSQEATGTHARKTKEERKD-KDLRKRTRSPNLLKIDFEIPYYTCSGLKIEYLKIEEPQLQ 651

Query: 456 YQPVKWIKY 464
           YQ   W++Y
Sbjct: 652 YQSFPWVRY 660

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 52/85 (61%), Gaps = 12/85 (14%)

Query: 54  FQHVIRESSDNLPMWLVAVSRSNVDSSM--IWEYLHKLYQLMEAFGIN----DEDVLKDE 107
           F H+ R+S     +  V++  +N  +S+  I+ YL + Y+L++++ +N    D+ +L D 
Sbjct: 78  FLHIKRDS-----LIFVSIIENNSMNSLMIIFSYLEEFYKLLKSY-LNVTKLDKGLLIDN 131

Query: 108 FMLLYEILELTLENGIPQTTDLAQI 132
           F+L+ E+L+ +L+ GI Q TD + I
Sbjct: 132 FLLVMELLDESLDFGIVQFTDSSLI 156

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/328 (22%), Positives = 141/328 (42%), Gaps = 81/328 (24%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVGKDG----------SIVKSFVDGSVDCVSHLSGM 233
           PWR +GLKY  NE+Y+D+ E I ++  K G           ++   ++G      +LSG 
Sbjct: 212 PWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSGN 271

Query: 234 PLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLN 293
           P   L L+    + GN+                              L    FH+CV+L+
Sbjct: 272 PTVDLQLD----LAGND------------------------------LGVPAFHECVELD 297

Query: 294 KYE--ANHVIQFVPPDGPFQLMQYRVIDNINIP-------FN------VIPEVEIVKNST 338
            ++  +N  ++F+PPDG F LMQY +  +++ P       FN       I   + + N T
Sbjct: 298 NHQNPSNCDLRFIPPDGRFNLMQYSI--DLDTPRIQQTRRFNHTVGLVTIDFADQLGNKT 355

Query: 339 LNYKVTLRSLFPSNVSA-KDVTVKIPVPPTT---IKCDFNVSGGKCKYDAGEKCMV---- 390
             +++T+       V+  +D+ + + +   T    + DF +   +  +   +  +V    
Sbjct: 356 DEFEITVNISNSREVANIEDLRIDVQLQSNTDEDSETDFKIKVLRNTHGRFDNSVVPGQG 415

Query: 391 -WKYNKYKGSTENTLSGKVAIPATSHDLSD--LLRWSRPPISMGFEIVMFSNSGLVVRHL 447
            W ++K      +T +G + +     + ++  LLR  R  ++  + +     SG+ V+ +
Sbjct: 416 SWIFDK------DTPTGTLPVLRGCVESTEPRLLRVQR--VTASYSLSGQLASGIRVKAI 467

Query: 448 KC-QEPQLNYQPVKWIKYISHSGAYEIR 474
              Q    + +P K +KY + +G +EIR
Sbjct: 468 NIGQLTTKSNRPFKGVKYATKTGDFEIR 495

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 64/142 (45%), Gaps = 46/142 (32%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVGKDG------SIVKSFVDGSVDCVSHLSGMPLCQ 237
           PWR   +K  +NE+Y+D+ E + + + K         ++  +++GSV   S + G+P+ +
Sbjct: 174 PWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLE 233

Query: 238 LGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDC--KFHQCVQLNKY 295
           +                                      G    +D   KFH CV++N++
Sbjct: 234 VSF------------------------------------GGCDFKDIIPKFHDCVEVNEF 257

Query: 296 EAN--HVIQFVPPDGPFQLMQY 315
             N  ++I+F+PPDG FQLM+Y
Sbjct: 258 LTNDGNIIKFIPPDGKFQLMEY 279

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 63/144 (43%), Gaps = 49/144 (34%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQ--LGLN 241
           PWR SG+ Y  NE+++D++E+I  +V K G ++   + G +D  +HLSG PL +  LGL 
Sbjct: 211 PWRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEMKLGLL 269

Query: 242 DTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHV- 300
           D    H N                                    FH+C+  +K  AN + 
Sbjct: 270 DHKLSHLNT----------------------------------TFHRCILEDK--ANSIN 293

Query: 301 ---------IQFVPPDGPFQLMQY 315
                    + FVPPDG  +L QY
Sbjct: 294 DLIAGKFTKLTFVPPDGRTRLCQY 317

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 123/314 (39%), Gaps = 67/314 (21%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVGKDGS---IVKSFVDGSVDCVSHLSGMPLCQLGL 240
           PWR +  +Y  NE+Y+D+ E +   + + GS   ++   + G +D   +LSG P  QL L
Sbjct: 141 PWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKL 200

Query: 241 NDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEANHV 300
             +    G+                               L++   H+CV+L +      
Sbjct: 201 RTS----GHP------------------------------LDNSALHRCVELGE-AGVAT 225

Query: 301 IQFVPPDGPFQLMQYRV-IDNINIPFNVIPEVEIVKNSTLNYKVTLRSLF--------PS 351
           + FVPPDG F L +Y + +  I+     +  + +V  S  +     R  F         +
Sbjct: 226 MNFVPPDGRFTLAEYAIDLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNST 285

Query: 352 NVSA-KDVTVKIPVPPTTIKCDFNV---SGGKCKYDAGEKCMVWKYNKYKG-STENTLSG 406
            V+A +D+ + +  P  +      +   + G  + D      VW ++K     +   L G
Sbjct: 286 QVAAIEDLRITVYFPDISDAAKIKILRTTHGGWESDLSRVRGVWAFDKQTAVGSVPVLRG 345

Query: 407 KVAIP-ATSHDLSDLLRWSRPPISMGFEIVMFSN-----SGLVVRHLKCQEPQLNYQPVK 460
            V  P +T H          PP+      V +S+     SG+ V  +   +     +P K
Sbjct: 346 CVENPESTPH---------APPVFPSHLAVSYSHVGQLPSGIRVDTIALSDLPPGSKPFK 396

Query: 461 WIKYISHSGAYEIR 474
            +KY S +G Y +R
Sbjct: 397 GVKYTSRAGDYIVR 410

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 63/140 (45%), Gaps = 40/140 (28%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVGKDGSI-----VKSFVDGSVDCVSHLSGMPLCQL 238
           PWR +G+KY  NE+Y+D+ E + I++ K  +      +   +DG V    +LS  PL +L
Sbjct: 205 PWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVEL 264

Query: 239 GLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEAN 298
            LN     +G++                              L    FH+CV+    + +
Sbjct: 265 DLN----TNGHD------------------------------LGIPAFHRCVRTEGSDFH 290

Query: 299 -HVIQFVPPDGPFQLMQYRV 317
              ++F+PPDG F LM+Y +
Sbjct: 291 PGTLRFIPPDGDFCLMEYNI 310

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 73/163 (44%), Gaps = 45/163 (27%)

Query: 183 CPWRPSGLKYKKNEVYLDINEKITILVGKDGS------------------IVKSFVDGSV 224
            PWR   +KY  NE+Y+D+ E+I ++  +  S                  ++++ + G +
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 225 DCVSHLSGMPLCQLGLND-TYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILED 283
           +  S+LS  P+ ++ L D  YS      SE  + + ++                   L  
Sbjct: 316 NVRSYLSDNPMVEVTLVDRNYSDQKTGWSENDLFKQLN-------------------LGL 356

Query: 284 CKFHQCVQLNKYEAN-----HVIQFVPPDGPFQLMQYRV-IDN 320
             FH CV+++ YE         I+F+PPDG F LM+Y + +DN
Sbjct: 357 PMFHDCVEID-YEKGINQDFRHIKFIPPDGKFSLMKYNIDLDN 398

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 60/155 (38%), Gaps = 54/155 (34%)

Query: 183 CPWRPSGLKYKKNEVYLDINEKITILVGKD--------------GSIVKSFVDGSVDCVS 228
            PWR   +K+  NE+Y+D+ E + ++                    IV  ++ G+    S
Sbjct: 201 APWRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQS 260

Query: 229 HLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQ 288
            L+G PL +L L     + GN+    S                              FH+
Sbjct: 261 FLNGNPLVELQL----ELSGNDIGHPS------------------------------FHE 286

Query: 289 CVQLNKYEAN------HVIQFVPPDGPFQLMQYRV 317
           CV +++Y  N        ++F+PPDG F LM Y +
Sbjct: 287 CVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTI 321

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 69/156 (44%), Gaps = 40/156 (25%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVG---KDGSI--VKSFVDGSVDCVSHLSGMPLCQL 238
           PWR   LKY  +E+Y+DI E + ++     ++ S+  V   ++G V+  S+LSG P  ++
Sbjct: 193 PWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVEM 252

Query: 239 GLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYEAN 298
            ++    + GNE    S+                              HQCV++ +   +
Sbjct: 253 DMD----LAGNEMYAPSM------------------------------HQCVEMPQGSPS 278

Query: 299 HVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIV 334
            +  F+PPDG   L+ Y +  ++N    V   V +V
Sbjct: 279 SLC-FIPPDGNCNLLNYTIDLDMNPKVKVTSPVGLV 313

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 63/164 (38%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILV-------GKDG--------SIVKSFVDGSVDCVS 228
           PWR +G+K  K E+Y+D+ E++ +         G+DG         +V   + G++D   
Sbjct: 190 PWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVRC 249

Query: 229 HLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQ 288
           +L+G P   L     +   GN+                              L    FH 
Sbjct: 250 YLNGNPTVSL----MFDTMGND------------------------------LGIPSFHA 275

Query: 289 CV-------------QLNKYEANHVIQFVPPDGPFQLMQYRVID 319
           CV             +   ++   +++F+PPDG F+L QY VID
Sbjct: 276 CVEQEDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQY-VID 318

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 42/141 (29%)

Query: 184 PWRPSGL-KYKKNEVYLDINEKITILVGKDGS---IVKSFVDGSVDCVSHLSGMPLCQLG 239
           PWR S   K++ NE+Y+D+ E   +++ K  +   +V   + G+VD  S+L+  PL  + 
Sbjct: 200 PWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSVK 259

Query: 240 LNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLN---KYE 296
           LN      GNE    S+                              H+CV++N   ++ 
Sbjct: 260 LN----TMGNEIGIPSL------------------------------HECVEINDDGEFT 285

Query: 297 ANHVIQFVPPDGPFQLMQYRV 317
            ++ I F+PPDG F+L++Y +
Sbjct: 286 PSN-ITFIPPDGKFRLLEYSI 305

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 62/140 (44%), Gaps = 40/140 (28%)

Query: 184 PWRPS-GLKYKKNEVYLDINEKITILVGKDGS---IVKSFVDGSVDCVSHLSGMPLCQLG 239
           PWR S   K++ NE+YLD+ E   ++  K  S   +V   + G++D  S+L+  PL  + 
Sbjct: 200 PWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLVK 259

Query: 240 LNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNKYE--A 297
           LN      GN+    S+                              H+CV++N     +
Sbjct: 260 LNTM----GNDIGIPSL------------------------------HECVEINDGGVFS 285

Query: 298 NHVIQFVPPDGPFQLMQYRV 317
              I F+PPDG F+L++Y V
Sbjct: 286 PSNITFIPPDGKFRLLEYCV 305

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 77/225 (34%), Gaps = 61/225 (27%)

Query: 183 CPWR-PSGLKYKKNEVYLDINEKITILVGKDGS-------------------IVKSFVDG 222
            PWR    +   +NE+Y D+ E I ++  K  S                    V+  + G
Sbjct: 225 APWRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISG 284

Query: 223 SVDCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILE 282
           SVD    L+G PL ++ L                                    G + + 
Sbjct: 285 SVDMRCFLTGNPLVEIALKQ----------------------------------GGLDIG 310

Query: 283 DCKFHQCV---QLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTL 339
              FH CV    L K E    + F+PPDG F LMQY    NIN+       V +V     
Sbjct: 311 IPGFHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQY----NINLDQGKRHSVGLVHADIE 366

Query: 340 NYKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDA 384
           ++  TL   F   ++    T    +    +   F +S G  K D 
Sbjct: 367 DHLGTLGDEFEVTLNISSSTSVKHIEDMEVMLYFGLSHGNRKKDT 411

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 71/163 (43%), Gaps = 40/163 (24%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVS-HLSGMPLCQLGLND 242
           PWR   + +  NE+YLD+ E I +++ +      S+ + ++  V+ ++ G  L +  LN 
Sbjct: 203 PWRMRNVDHVNNELYLDLVESIHVVL-ETKKRKSSYANSTMKIVTGNIIGKALVKSVLN- 260

Query: 243 TYSIHGNEKSELSIVEM---MSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQL------N 293
                GN      IVEM   M+  D                LE    H+CV+        
Sbjct: 261 -----GN-----PIVEMKIDMAGND----------------LESIFLHECVKSKDVDKDQ 294

Query: 294 KYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKN 336
           ++E   +I+F+PPDG F+L  Y +  N+N   N   E     N
Sbjct: 295 EFENTKLIKFLPPDGSFKLFDYNI--NLNTTENTKKEFNAFNN 335

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 60/139 (43%), Gaps = 39/139 (28%)

Query: 184 PWRPS-GLKYKKNEVYLDINEKITILVGKDGS---IVKSFVDGSVDCVSHLSGMPLCQLG 239
           PWR S   K++ NE+Y+D+ E   ++  K  S   ++   + G VD  S+L+  PL  + 
Sbjct: 200 PWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAVK 259

Query: 240 LNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQLNK-YEAN 298
           LN      GN+    S+                              H CV++N    + 
Sbjct: 260 LNTM----GNDIGIPSL------------------------------HDCVEINDGVFSP 285

Query: 299 HVIQFVPPDGPFQLMQYRV 317
             I F+PPDG F+L++Y V
Sbjct: 286 SNITFIPPDGKFRLLEYSV 304

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 64/150 (42%), Gaps = 50/150 (33%)

Query: 184 PWRPSGLKYKKNEVYLDINEKITILVGKDG------------SIVKSFVDGSVDCVSHLS 231
           PWR + +  ++NE Y+D+ E + ++V +               +V   + G VDC  +LS
Sbjct: 207 PWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCRCYLS 266

Query: 232 GMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQ 291
             P+ ++  N+    HG +                              L     H CV+
Sbjct: 267 RDPIVEVTFNN----HGCD------------------------------LGTPALHDCVE 292

Query: 292 LN---KYEANH-VIQFVPPDGPFQLMQYRV 317
           L+   +  A+H  ++F+PPDG F+LM+Y V
Sbjct: 293 LDGVPEGPADHTTLKFIPPDGKFRLMEYSV 322

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 41/200 (20%), Positives = 74/200 (37%), Gaps = 42/200 (21%)

Query: 123 IPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNIXXXXXXXXXXXXXXXXXXXXE 182
           +P  TDL+ +    ++      TI K+ +  +FL  SN                      
Sbjct: 138 LPLHTDLSTVFSSATKTLTR--TI-KNRESSNFLGSSNSSNINGGPTINRSSDSPLDAQV 194

Query: 183 CPWRPSGLKYKKNEVYLDINEKITILVGKDG----SIVKSFVDGSVDCVSHLSGMPLCQL 238
            PWR   L    NE+Y+D+ E +T+ + +       +    + G +D   +L G P  Q+
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 239 GLNDTYSIHGNEKSELSIVEMMSEYDXXXXXXXXXXXXGSVILEDCKFHQCVQ-LNKYEA 297
            L+   + H  + S L                                H+C+   +    
Sbjct: 255 NLHS--AGHAFKPSAL--------------------------------HRCLDPSSSSFD 280

Query: 298 NHVIQFVPPDGPFQLMQYRV 317
           +  ++F+PPDG F L++Y +
Sbjct: 281 SSSLRFIPPDGKFTLLEYTI 300

>KNAG0D02530 Chr4 complement(444969..445532) [564 bp, 187 aa] {ON}
           Anc_8.76 YPL010W
          Length = 187

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 81  MIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLENGIPQTTDLAQIIPRVSRKP 140
           +++E +    +L+   G  D  V++D+F L+  +++  ++NGI   TD A I  RV+R P
Sbjct: 95  VVFEGIAGALELLLDSGGVDMRVVQDKFDLVCLLVDEAVDNGIVLETDPATIAARVTRPP 154

Query: 141 IENNTISKSPDLDDFLSGS 159
             +  +  S DLD  L G+
Sbjct: 155 TTDPQV--SLDLDKGLLGA 171

>YHR064C Chr8 complement(225525..227141) [1617 bp, 538 aa] {ON}
           SSZ1Hsp70 protein that interacts with Zuo1p (a DnaJ
           homolog) to form a ribosome-associated complex that
           binds the ribosome via the Zuo1p subunit; also involved
           in pleiotropic drug resistance via sequential activation
           of PDR1 and PDR5; binds ATP
          Length = 538

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 31/58 (53%)

Query: 10  AKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRESSDNLPM 67
           A G  L ++LI D+    LA+  +  ++N PH++ PI  +G+    H +  +  + P+
Sbjct: 376 ASGAALQARLISDYDADELAEALQPVIVNTPHLKKPIGLIGAKGEFHPVLLAETSFPV 433

>KAFR0B01780 Chr2 (348976..349548) [573 bp, 190 aa] {ON} Anc_8.76
           YPL010W
          Length = 190

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 45/69 (65%), Gaps = 2/69 (2%)

Query: 91  QLMEAFGINDEDVLKDEFMLLYEILELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSP 150
           +L+   GI++++V  +   L+Y +++  ++NG+   TD A I  RV+++P  ++T++++ 
Sbjct: 108 ELLLNNGIDNKNV-SENCDLVYLLIDEIIDNGVILETDPASIASRVTKQPT-SDTLNQTL 165

Query: 151 DLDDFLSGS 159
           DLD  L G+
Sbjct: 166 DLDKGLLGA 174

>Smik_8.135 Chr8 complement(200821..202437) [1617 bp, 538 aa] {ON}
           YHR064C (REAL)
          Length = 538

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%)

Query: 10  AKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRESSDNLPM 67
           A G  L ++LI D+    LA+  +  +IN PH++  I  LG+    H +  +  + P+
Sbjct: 376 ASGAALQARLISDYDADELAEALQPVIINTPHLKKAIGLLGAKGEFHPVLLAETSFPV 433

>NCAS0A03620 Chr1 (722990..723685) [696 bp, 231 aa] {ON} Anc_8.76
           YPL010W
          Length = 231

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 92  LMEAFGINDEDVLKDEFMLLYEILELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPD 151
           ++ + GI+ +++L+   M+L  I E T +NGI   TD A I  RVS KPI    +    D
Sbjct: 153 VLNSSGIDRKNILEHYDMVLLAIDE-TFDNGIVLETDAAAIASRVS-KPITQEPV--QLD 208

Query: 152 LDDFLSGS 159
           LD  L G+
Sbjct: 209 LDKGLLGA 216

>Smik_12.531 Chr12 complement(936396..940253) [3858 bp, 1285 aa] {ON}
            YLR436C (REAL)
          Length = 1285

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 28/55 (50%)

Query: 31   VFRTQVINDPHVRSPILTLGSTTFQHVIRESSDNLPMWLVAVSRSNVDSSMIWEY 85
              R+ ++   H R P+     TTFQ +   + + L MW   V+ +N+ + M ++Y
Sbjct: 965  ALRSDILTTIHSRLPLDVRRLTTFQPLSMHTDEKLQMWFHIVTWANIFTQMSFKY 1019

>NCAS0J02290 Chr10 (438857..443776) [4920 bp, 1639 aa] {ON}
           Anc_4.375 YJR140C
          Length = 1639

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 49/127 (38%), Gaps = 3/127 (2%)

Query: 88  KLYQLMEAFGINDEDVLKDEFMLLYEILELTLENGIPQTTDLAQIIPRVSRKPIENNTIS 147
           KL+Q++++   NDE+ LKD  +   E+ E++ E     T DL   +P+     +    I 
Sbjct: 219 KLFQVIKSIKTNDENTLKDVELETIELEEMSWEAIAVATEDL---LPKTKMSTLITKGID 275

Query: 148 KSPDLDDFLSGSNIXXXXXXXXXXXXXXXXXXXXECPWRPSGLKYKKNEVYLDINEKITI 207
              +L+  +   NI                         P+  +   NE+  D N K  +
Sbjct: 276 PYTELESSIEAVNIHVAETQTISEENESNLNDKTGTRVTPNATEQAPNEIEDDFNSKKRV 335

Query: 208 LVGKDGS 214
           L   D +
Sbjct: 336 LDSADTT 342

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,259,555
Number of extensions: 2144730
Number of successful extensions: 6145
Number of sequences better than 10.0: 89
Number of HSP's gapped: 6067
Number of HSP's successfully gapped: 167
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)