Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C03850g3.161ON39139120150.0
SAKL0C07370g3.161ON39139119250.0
Kpol_479.253.161ON39139119100.0
Suva_4.2203.161ON39139119010.0
TDEL0D046103.161ON39139118960.0
YDL029W (ARP2)3.161ON39139118950.0
NCAS0C035503.161ON39239118900.0
Skud_4.2223.161ON39139118880.0
KLTH0F06490g3.161ON39139118880.0
CAGL0K01595g3.161ON39139118880.0
Smik_4.2063.161ON39139118870.0
NDAI0G029003.161ON39139118820.0
TBLA0F008703.161ON39139118740.0
ADR316W3.161ON39139118660.0
TPHA0A009203.161ON39139118650.0
ZYRO0B04928g3.161ON39139118510.0
KNAG0K01130na 1ON39339318510.0
Ecym_52373.161ON39139118490.0
Kwal_33.141773.161ON33733716310.0
KAFR0C01040na 1ON33733716260.0
NDAI0G030408.23ON3753778531e-111
NCAS0C037008.23ON3753778511e-111
Ecym_15208.23ON3763778501e-111
KNAG0L002508.23ON3753778491e-111
KAFR0D009408.23ON3753778491e-111
TPHA0D002508.23ON3753778491e-111
TDEL0C004708.23ON3753778491e-111
CAGL0K12694g8.23ON3753778491e-111
Suva_6.188.23ON3753778491e-111
Smik_6.398.23ON3753778491e-111
YFL039C (ACT1)8.23ON3753778491e-111
ZYRO0F02772g8.23ON3753778491e-111
TBLA0C004408.23ON3753778481e-111
ABR222W8.23ON3763778461e-110
Kpol_1058.158.23ON3753778441e-110
KLTH0G18832g8.23ON3753778431e-110
KLLA0D05357g8.23ON3753778431e-110
SAKL0B00968g8.23ON3753778421e-110
Skud_6.318.23ON3603698201e-107
Kwal_14.11098.23ON3603698151e-106
SAKL0E11814g2.117ON3793866931e-87
AFR051W2.117ON4053866872e-86
Kpol_1023.188.23ON3192906732e-85
Ecym_63852.117ON3773866696e-84
KLLA0E22925g2.117ON3803906652e-83
KLTH0B05940g2.117ON3833886611e-82
ZYRO0G05676g2.117ON3813976374e-79
NCAS0B071302.117ON3813786235e-77
Kwal_33.146422.117ON3833886226e-77
TBLA0B010702.117ON3833786183e-76
KAFR0F005902.117ON3863866132e-75
Suva_15.3262.117ON3843785826e-71
YHR129C (ARP1)2.117ON3843785811e-70
TPHA0I013002.117ON3793885801e-70
Smik_8.2102.117ON3843785741e-69
Skud_8.1902.117ON3843785704e-69
TDEL0B048102.117ON3733785555e-67
NDAI0B044602.117ON3813805461e-65
KNAG0H036502.117ON3873955183e-61
CAGL0H09042g2.117ON3873804521e-51
Kwal_27.99581.514ON4454384518e-51
KLTH0C02508g1.514ON4514444472e-50
TBLA0D036801.514ON4584594456e-50
KNAG0B001701.514ON4534464431e-49
YJR065C (ARP3)1.514ON4494424422e-49
SAKL0D12804g1.514ON4564494394e-49
TDEL0F004701.514ON4614544378e-49
Smik_10.3551.514ON4494424361e-48
Skud_10.2891.514ON4494424361e-48
CAGL0F00517g1.514ON4544474352e-48
KLLA0B13904g1.514ON4564494352e-48
NCAS0A122701.514ON4544474324e-48
Suva_12.1541.514ON4494424324e-48
KAFR0D037001.514ON4494484308e-48
TPHA0O010401.514ON4584514309e-48
AFR419C1.514ON4554484282e-47
NDAI0A039701.514ON4624554263e-47
Ecym_31531.514ON4584514212e-46
Kpol_1056.161.514ON4603654185e-46
ZYRO0G01936g1.514ON4614544082e-44
NCAS0B060601.287ON4972942163e-18
NDAI0G055801.287ON5152992155e-18
Skud_10.1321.287ON4882912084e-17
YJL081C (ARP4)1.287ON4892982059e-17
Suva_6.1541.287ON4892982022e-16
Smik_10.1611.287ON4892981987e-16
KLTH0G13772g8.258ON4203781942e-15
SAKL0H17138g8.258ON4193711932e-15
AFR105C1.287ON4792951915e-15
Kwal_56.238328.258ON4193821897e-15
TDEL0F038508.258ON4193661897e-15
KNAG0B019201.287ON5052061853e-14
ZYRO0C01738g8.258ON4143621825e-14
Ecym_43128.258ON4113691826e-14
Kpol_543.368.258ON4273761826e-14
KAFR0B027008.258ON4203721818e-14
ZYRO0G21428g1.287ON4832971819e-14
KLLA0F19063g8.258ON4153641791e-13
Kpol_282.41.287ON5013021791e-13
KAFR0A015601.287ON4852971782e-13
TPHA0I010301.287ON5031111746e-13
AGR091W8.258ON4103881721e-12
KLTH0H09702g1.287ON4811981712e-12
TPHA0A018308.258ON4213671692e-12
Suva_14.2812.248ON7552341712e-12
CAGL0M03201g1.287ON4932031693e-12
NDAI0B019608.258ON4392441675e-12
TDEL0D015501.287ON4802471659e-12
Skud_14.2722.248ON7552341651e-11
Smik_12.1448.258ON4383861631e-11
TBLA0D053601.287ON5962361642e-11
KLLA0D02288g1.287ON5201921622e-11
Kwal_14.23771.287ON4811851622e-11
NCAS0B049908.258ON4203721613e-11
Smik_14.2672.248ON7552411597e-11
CAGL0L12166g8.258ON4213731542e-10
KNAG0G020108.258ON4243831542e-10
KLTH0G09482g2.248ON7452311516e-10
Ecym_63301.287ON4801851472e-09
Skud_12.1538.258ON4383871462e-09
SAKL0D05874g1.287ON4972821462e-09
YLR085C (ARP6)8.258ON4381801434e-09
Suva_10.1698.258ON4381821425e-09
YNL059C (ARP5)2.248ON7552321428e-09
KAFR0J011602.248ON7512331401e-08
TBLA0H014608.258ON4421881382e-08
NDAI0D010602.248ON7532341383e-08
NCAS0G030502.248ON7432321373e-08
ZYRO0A01584g2.248ON7481391365e-08
Kwal_23.48482.248ON7452851347e-08
TBLA0E038602.248ON7592381348e-08
KLLA0F03421g2.248ON7472021322e-07
SAKL0E08602g2.248ON7472311293e-07
TDEL0C041402.248ON7492331232e-06
TPHA0C031602.248ON7551341232e-06
Kpol_1003.162.248ON7492341142e-05
CAGL0J10054g2.248ON7542311099e-05
Ecym_32852.248ON7461341071e-04
KNAG0I018602.248ON7531441062e-04
ADL253C2.248ON751233970.002
KLLA0F11913g8.251ON25398860.032
SAKL0H17358g8.251ON311250850.054
AFR135W5.477ON791150830.11
Kpol_520.117.448ON488281820.15
Kpol_543.105.477ON876243800.24
NCAS0A147207.448ON485197760.75
TPHA0N01730na 2ON41077750.90
TBLA0H028002.593ON484136741.2
YPR034W (ARP7)7.448ON477191731.6
Suva_16.3647.448ON480191731.6
Ecym_35058.251ON30563712.5
KLLA0F26455g2.618ON863168703.9
SAKL0D00594g8.864ON464165686.4
KAFR0K021507.448ON490115686.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C03850g
         (391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...   780   0.0  
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...   746   0.0  
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...   740   0.0  
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...   736   0.0  
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...   734   0.0  
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...   734   0.0  
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...   732   0.0  
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...   731   0.0  
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...   731   0.0  
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...   731   0.0  
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...   731   0.0  
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...   729   0.0  
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...   726   0.0  
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...   723   0.0  
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...   723   0.0  
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...   717   0.0  
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...   717   0.0  
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...   716   0.0  
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...   632   0.0  
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...   630   0.0  
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   333   e-111
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   332   e-111
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   332   e-111
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   331   e-111
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   331   e-111
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   331   e-111
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   331   e-111
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   331   e-111
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   331   e-111
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   331   e-111
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   331   e-111
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   331   e-111
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   331   e-111
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   330   e-110
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   329   e-110
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   329   e-110
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   329   e-110
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   328   e-110
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   320   e-107
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   318   e-106
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...   271   1e-87
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...   269   2e-86
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...   263   2e-85
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...   262   6e-84
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...   260   2e-83
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...   259   1e-82
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...   249   4e-79
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...   244   5e-77
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...   244   6e-77
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...   242   3e-76
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...   240   2e-75
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...   228   6e-71
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...   228   1e-70
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...   228   1e-70
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...   225   1e-69
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...   224   4e-69
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...   218   5e-67
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...   214   1e-65
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...   204   3e-61
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...   178   1e-51
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...   178   8e-51
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...   176   2e-50
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...   176   6e-50
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...   175   1e-49
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...   174   2e-49
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...   173   4e-49
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...   172   8e-49
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...   172   1e-48
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...   172   1e-48
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...   172   2e-48
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...   172   2e-48
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...   171   4e-48
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...   171   4e-48
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...   170   8e-48
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....   170   9e-48
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...   169   2e-47
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514    168   3e-47
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...   166   2e-46
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....   165   5e-46
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...   161   2e-44
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    88   3e-18
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    87   5e-18
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    85   4e-17
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    84   9e-17
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    82   2e-16
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    81   7e-16
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...    79   2e-15
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...    79   2e-15
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    78   5e-15
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...    77   7e-15
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...    77   7e-15
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    76   3e-14
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...    75   5e-14
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...    75   6e-14
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...    75   6e-14
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...    74   8e-14
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    74   9e-14
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...    74   1e-13
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    74   1e-13
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    73   2e-13
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    72   6e-13
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...    71   1e-12
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    70   2e-12
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...    70   2e-12
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    70   2e-12
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    70   3e-12
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...    69   5e-12
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    68   9e-12
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    68   1e-11
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...    67   1e-11
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    68   2e-11
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    67   2e-11
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    67   2e-11
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...    67   3e-11
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    66   7e-11
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...    64   2e-10
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...    64   2e-10
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    63   6e-10
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    61   2e-09
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...    61   2e-09
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    61   2e-09
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...    60   4e-09
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...    59   5e-09
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    59   8e-09
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    59   1e-08
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...    58   2e-08
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    58   3e-08
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    57   3e-08
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    57   5e-08
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    56   7e-08
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    56   8e-08
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    55   2e-07
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    54   3e-07
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    52   2e-06
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    52   2e-06
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    49   2e-05
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    47   9e-05
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    46   1e-04
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    45   2e-04
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    42   0.002
KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa] ...    38   0.032
SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa] ...    37   0.054
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...    37   0.11 
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    36   0.15 
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...    35   0.24 
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    34   0.75 
TPHA0N01730 Chr14 complement(369871..371103) [1233 bp, 410 aa] {...    33   0.90 
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    33   1.2  
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    33   1.6  
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    33   1.6  
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    32   2.5  
KLLA0F26455g Chr6 (2450871..2453462) [2592 bp, 863 aa] {ON} simi...    32   3.9  
SAKL0D00594g Chr4 complement(48583..49875,50031..50132) [1395 bp...    31   6.4  
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    31   6.9  

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/391 (96%), Positives = 379/391 (96%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE
Sbjct: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGGTYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI
Sbjct: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/391 (90%), Positives = 373/391 (95%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER   +TPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S+VRSYLQISYPMENGII+NWADMELLWDYAF+EQMKLP+TSGGKVLLTEPPMNP++NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTKR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           E+YELPDGRVIKVG ERFEAPECLFQPSLVDVEQPGVGE+LFNT+QAADVD+RT+LY+A+
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           ANIMADKDHMWL+KQEW E+GPAAMSKFGPR
Sbjct: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/391 (90%), Positives = 366/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER   STPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           SEVRSYLQISYPMENGII+NW DMELLWDYAF+EQMKLP+TSGGKVLLTEPPMNP+KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT+LARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           E YELPDGR+IKVG ERFEAPECLFQP+LVDVE  GVGELLFNTIQ+ADVD+R+SLYKAI
Sbjct: 241 EKYELPDGRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL  DP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNKDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           ANIMADKDHMWLSKQEW E GPAAMSKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/391 (90%), Positives = 365/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER   +TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S+VRSYLQISYPMENGII+NW DMELLWDYAFFEQMKL +TS GK+LLTEPPMNP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           ESYELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGELLFNT+Q+ADVDIR+SLYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMADKDHMWLSKQEW E GPAAMSKFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/391 (89%), Positives = 366/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER + STPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S+VRSYLQISYPMENGII+NW DMELLWDYAFF+QMKLPTTS GK+LLTEPPMNP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEK+CYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           E+YELPDGRVIKVG ERFEAPECLFQPSLVDVEQ GVGELLFNTIQ ADVDIR++LY+AI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL ND +RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDASRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           ANIMADKDHMWLSKQEW E GPAAM+KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMAKFGPR 391

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/391 (89%), Positives = 365/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER   +TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           SEVRSYLQISYPMENGII+NW DMELLWDYAFFEQMKLP+TS GK+LLTEPPMNP+KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           ESYELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGELLFNT+Q+ADVDIR+SLYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMADKDHMWLSKQEW E GP+AM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPSAMTKFGPR 391

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/391 (89%), Positives = 365/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER + +TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           SEVRSYLQISYPMENGII+NW DMELLWDYAFFEQMKLPTTS GK+LLTEPPMNP KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLGHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           ESYELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GELLF+T+Q+ADVD+R++LYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMADKDHMWLSKQEW E G A+M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/391 (89%), Positives = 364/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER   +TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S+VRSYLQISYPMENGII+NW DMELLWDYAFFEQMKLP+TS GK+LLTEPPMNP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           ESYELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGELLFNT+Q+ADVDIR+SLY+AI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMADKDHMWLSKQEW E GPAAM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMTKFGPR 391

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/391 (88%), Positives = 369/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MD  TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER +  TPLKDIMIGDEA
Sbjct: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S VRSYLQISYPMENG+I+NW+DMELLWDYAF++QMKLP+TSGGKV+LTEPPMNP++NRE
Sbjct: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           E+YELPDGRVIKVG ERFEAPECLFQP+LVDVEQPGVGE+LFNTIQAADVD+R++LY+AI
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP+RL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           ANIMADKDHMWLSKQEW E+GP+AMSKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/391 (89%), Positives = 365/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER   + PLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S+VRSYLQISYPMENGII+NW DMELLWDYAFF QM+LPTTSGGK+LLTEPPMNP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           E+YELPDGR+IKVG ERFEAPECLFQP+LVDVEQ G+GELLFNTIQ+ADVD+R+SLYKAI
Sbjct: 241 ENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL NDPTRLDKFKVRIEDPPRR+HMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFKVRIEDPPRRRHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMADKDHMWL+KQEW E G AAMSKFGPR
Sbjct: 361 ASIMADKDHMWLTKQEWRESGAAAMSKFGPR 391

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/391 (89%), Positives = 365/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER   +TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S+VRSYLQISYPMENGII+NW DMELLWDYAFFEQMKLP+TS GK+LLTEPPMNP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           ESYELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGELLFNT+Q+ADVDIR+SLYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMADKDHMWLSKQEW E GPA+M+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/391 (89%), Positives = 366/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER + +TPL+DIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S+VRSYLQISYPMENGII+NW DMELLWDYAFF QMKL  TSGGK+LLTEPPMNP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTSGGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           ESYELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGELLFNTIQ+ADVD+R++LYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW+TRVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMADKDHMWLSKQEW+E G AAM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWYEGGAAAMAKFGPR 391

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/391 (88%), Positives = 364/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERG  STPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           SEVRSYLQISYPMENGII+NW DMELLWDYAFF QMKLPTTSGGKVLLTEPPMNP+KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPTTSGGKVLLTEPPMNPVKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFE+YDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 RMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGY+FNRTADFETVRQIKEK+CYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           + YELPDGR+IKVG ERFEAPECLFQP LVDVE PGVGELLFNTIQ+AD+D+R+SLYKAI
Sbjct: 241 QEYELPDGRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLE+ELKQLWFTR+L+ D  RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLERELKQLWFTRILKGDAERLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           ANIMADKDHMWLSKQEW E G AA++KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQENGAAALAKFGPR 391

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/391 (87%), Positives = 367/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDP  PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA+ER + STPLKDIMIGDEA
Sbjct: 1   MDPQKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S+VRSYLQISYPMENGIIR+WADMELLWDYAF+EQMKLP+TSGGKVLLTEPPMNP++NRE
Sbjct: 61  SQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGG YV IQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRD+TR+LIDLLSRRGYAFN+TADFETVRQIKEKLCYVSYDLDLDT+LA+ETTTLV
Sbjct: 181 LDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           E YELPDGRVIKVG ERFEAPECLFQPSLVDVEQPG+GE+LFNTIQ+ADVDI ++LYKAI
Sbjct: 241 EQYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDPTRL+KFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLEKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMADK+HMWL+KQEW E GPA+MSKFGPR
Sbjct: 361 ASIMADKEHMWLTKQEWEESGPASMSKFGPR 391

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/391 (87%), Positives = 366/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEERG+ + PLKD+MIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S VRSYLQISYPMENGII+NW DMELLWDYAF+EQMKLP+TSGGKVLLTEPP+NP+KNRE
Sbjct: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           E+YELPDGRVIKVG ERFEA ECLFQP+LVDVE  GVGELLFNTIQ+AD+D+R+SLYKAI
Sbjct: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMADKDHMWLSKQEW E GPAAM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/391 (87%), Positives = 363/391 (92%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERG  STPLKDIMIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S+VRSYLQISYPMENGIIRNW DME LWDYAF+ QMK P+TSGGK+LLTEPPMNP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTSGGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
            MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 LMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           E+YELPDGRVIKVG ERFEAPECLFQP LVDVEQPG+GELLFNTIQ+ADVDIR+SLY+AI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW+TR+LR D  RLDKFKV+IEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           A+IMA+KDHMWL+K+EWHE GPAAM+KFGPR
Sbjct: 361 ASIMAEKDHMWLTKEEWHESGPAAMAKFGPR 391

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/393 (87%), Positives = 366/393 (93%), Gaps = 2/393 (0%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGH--ASTPLKDIMIGD 58
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER    + TP+KDIM+G+
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 59  EASEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKN 118
           EAS+VRSYLQISYPMENGII++W DMELLWD+AFFE+MKLP+TSGGK+LLTEPPMNP+KN
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 119 REQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLT 178
           RE MC+VMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLT
Sbjct: 121 REMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLT 180

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTT 238
           RRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLD DTKLARETTT
Sbjct: 181 RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTT 240

Query: 239 LVESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYK 298
           LVE+YELPDGR+IKVG ERFEAPECLFQP+LVDVEQPGVGELLFNTIQ+ADVDIR+SLYK
Sbjct: 241 LVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYK 300

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGA 358
           AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDP+RLDKFKVRIEDPPRRKHMVFIGGA
Sbjct: 301 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPSRLDKFKVRIEDPPRRKHMVFIGGA 360

Query: 359 VLANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           VLANIMADKDHMWLSKQEW E G  AM+KFGPR
Sbjct: 361 VLANIMADKDHMWLSKQEWEESGAQAMAKFGPR 393

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/391 (87%), Positives = 364/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60
           MDP+ PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA ER + STPLKDIMIGDEA
Sbjct: 1   MDPYVPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           S VRSYLQISYPMENGII+NWADME LWDYAF++QMK+P+T+G KVLLTEPPMNP+KNRE
Sbjct: 61  SNVRSYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTR+LIDLLSRRGYAFN+TADFETVRQIKEKLCYVSYDLDLDTKLA ETTTLV
Sbjct: 181 LDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLV 240

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
           E+YELPDGRVIKVG ERFEAPECLFQPSLVDVEQ G+GE+LF+TIQ+ADVDI ++LY+AI
Sbjct: 241 ETYELPDGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDP RLDKFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPARLDKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           ANIMADKDHMWL+K+EW E+GPAAMSKFGPR
Sbjct: 361 ANIMADKDHMWLTKKEWEEMGPAAMSKFGPR 391

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/337 (88%), Positives = 318/337 (94%)

Query: 55  MIGDEASEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMN 114
           MIGDEAS VRSYLQISYPMENG+I+NW+DMELLWDYAF++QM+LP+TSGGKV+LTEPPMN
Sbjct: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60

Query: 115 PIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P+KNREQMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180

Query: 235 ETTTLVESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRT 294
           ETTTLVE+YELPDGRVIKVG ERFEAPECLFQPSLVDVEQPGVGE+LFNTIQ+ADVD+R+
Sbjct: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240

Query: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVF 354
           +LY+AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           IGGAVLANIMADKDHMWLSKQEW E+G AAMSKFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/337 (89%), Positives = 315/337 (93%)

Query: 55  MIGDEASEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMN 114
           MIG EASEVRSYLQISYPMENGII+NW DMELLWDYAF+EQMKLP TS GK+LLTEPPMN
Sbjct: 1   MIGGEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPDTSNGKILLTEPPMN 60

Query: 115 PIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           PIKNRE+MCEVMFEKY+FGG YVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234
           NHLTRRLDVAGRDVTR+LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 180

Query: 235 ETTTLVESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRT 294
           ETTTLVESYELPDGRVIKVG ERFEAPECLFQP+LVDVEQ GVGELLFNTIQ+ADVDIR+
Sbjct: 181 ETTTLVESYELPDGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRS 240

Query: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVF 354
           +L+KAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDPTRLDKFKVRIEDPPRRKHMVF
Sbjct: 241 TLFKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPTRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391
           IGGAVLANIMADKDHMWLSKQEW E GPAAM+KFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWEESGPAAMAKFGPR 337

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  333 bits (853), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGGS
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGS 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  332 bits (850), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDCYVGDEAQSKRGI 65

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 124

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 125 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 184

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D D + + A +++ + +SYELP
Sbjct: 185 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDYDQEMQTAAQSSAIEKSYELP 244

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 245 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 304

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 305 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 353

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 354 Q-QMWISKQEYDESGPS 369

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   D+D+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  GV +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ ++   V+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSME---VKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  330 bits (846), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 65

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 124

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 125 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 184

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYELP
Sbjct: 185 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 244

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 245 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 304

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 305 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 353

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 354 Q-QMWISKQEYDESGPS 369

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  329 bits (844), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  329 bits (843), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIL 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYELP
Sbjct: 184 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PSL+ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  329 bits (843), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKNNREKMTQIL 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +L+ RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYELP
Sbjct: 184 DITDYLMKILAERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSAVEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  328 bits (842), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIL 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYELP
Sbjct: 184 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWHEIGPA 383
           +  MW+SKQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  320 bits (820), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 161/369 (43%), Positives = 236/369 (63%), Gaps = 16/369 (4%)

Query: 15  FVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGG 134
           +GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++MFE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIMFETFNVPA 116

Query: 135 TYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 176

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRVIKVG 254
           +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELPDG+VI +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIG 236

Query: 255 PERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPS 314
            ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  LY  IV+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSK 374
           R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   +  MW+SK
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWHEIGPA 383
           QE+ E GP+
Sbjct: 345 QEYDESGPS 353

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  318 bits (815), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 161/369 (43%), Positives = 235/369 (63%), Gaps = 16/369 (4%)

Query: 15  FVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGG 134
           +GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M +++FE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQILFETFNVPA 116

Query: 135 TYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMK 176

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRVIKVG 254
           +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYELPDG+VI +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPDGQVITIG 236

Query: 255 PERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPS 314
            ERF APE LF PSL+ +E  G+ +  +N+I   DVD+R  LY  IV+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSK 374
           R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LA++   +  MW+SK
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWHEIGPA 383
           QE+ E GP+
Sbjct: 345 QEYDESGPS 353

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score =  271 bits (693), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 150/386 (38%), Positives = 223/386 (57%), Gaps = 17/386 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + PIVLD G+G +K G +GE  P     S++G P       G       +  IG++A E+
Sbjct: 9   NQPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLE---GEQFIGNQAQEL 65

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ YP+E+GI++NW+DMEL+W++ F + ++L       VL TE P+NP+KNRE MC
Sbjct: 66  RGLLKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIEEHPVLATEAPLNPLKNREAMC 125

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E++FE ++    YV+IQAVL+LYA G              H VPV++   L    RR+DV
Sbjct: 126 EMLFETFNVPAVYVSIQAVLSLYASGRTTGCVLDCGDGCCHSVPVFDGFSLPSSIRRIDV 185

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
           AGRDVT  L  LL +  G +   +++ E VR IKEK CYV+ D  L  +     T     
Sbjct: 186 AGRDVTEFLQLLLRKTTGVSLLSSSEREIVRIIKEKACYVARD-PLTEEQTYHLTPTSTI 244

Query: 243 YELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVL 302
           ++LPDG+V+ +  E+F APE LFQP L+  E   + E+   +I   D+D+R +L   IVL
Sbjct: 245 FKLPDGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVL 304

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLAN 362
           SGG++M+PG   RL  EL+ L       ++P    + K++I  PP RK+  +IGG++L+ 
Sbjct: 305 SGGTTMFPGFGDRLLTELRNL-------SEP----QTKIKIFAPPERKYSTWIGGSILSG 353

Query: 363 IMADKDHMWLSKQEWHEIGPAAMSKF 388
           +   K  +W++K EW E      S+F
Sbjct: 354 LSTFKK-IWVTKSEWQENPDCVHSRF 378

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score =  269 bits (687), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 145/386 (37%), Positives = 221/386 (57%), Gaps = 17/386 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + P+VLD G+G +K G +GE  P     S++G         G       D  IG++A E+
Sbjct: 35  NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEG---DTFIGNQAQEL 91

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ YP+++GI+ NWADME +W Y F + ++L        L+TE P+NP KNRE+MC
Sbjct: 92  RGLLKLRYPLQHGIVTNWADMEQVWGYVFNKSLQLQNVEDHPNLVTEAPLNPHKNREKMC 151

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E++FE ++    YV++QAVL+LYA G              H VPV++   +    RR+D+
Sbjct: 152 ELLFESFNVPALYVSVQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSVPSSIRRIDI 211

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
           AGRD+T  L  LL +  G +   +++ E VR IKEK C+V+ D  L+ +      +    
Sbjct: 212 AGRDITEFLQLLLRKTTGVSLLSSSEREIVRTIKEKACFVTKDPKLEEQNFPMNPSF-SK 270

Query: 243 YELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVL 302
           ++LPDG+ I++G ER+ APE LFQP L+  E   + ++ + +I   D+D+R+ LY  I+L
Sbjct: 271 FKLPDGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILL 330

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLAN 362
           SGG+SM PG   RL KELK L  +R            K++I  PP RK+  +IGG++L+ 
Sbjct: 331 SGGTSMLPGFGDRLLKELKSLSGSRT-----------KIKIFAPPERKYSTWIGGSILSG 379

Query: 363 IMADKDHMWLSKQEWHEIGPAAMSKF 388
           +   K  +W++K EW E      S+F
Sbjct: 380 LSTFK-KLWVTKSEWEEFPDCIHSRF 404

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score =  263 bits (673), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 186/290 (64%), Gaps = 4/290 (1%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP  +    G      KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQ---KDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++       VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSL 296
           DG+VI +G ERF APE LF PS++ +E  G+ +  +N+I   DVD+R  L
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score =  262 bits (669), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 139/386 (36%), Positives = 221/386 (57%), Gaps = 17/386 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + PIVLD G+G +K G +GE  P     S++G         G       D  IG++A E+
Sbjct: 7   NQPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEG---DTFIGNQAQEL 63

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ +P+E+GI++NW+DME +W Y F + ++L       +L+TE P+NP  NRE+MC
Sbjct: 64  RGLLKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQNVEDHPILITEAPLNPRNNRERMC 123

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E++FE ++    YV+IQAVL+LYA G              H VPV++   +    RR+D+
Sbjct: 124 ELLFESFNVPALYVSIQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSIPSSIRRIDI 183

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
           AGRD+T  L  LL +  G +   +++ E VR IKEK CYV+ D  ++ +         + 
Sbjct: 184 AGRDITEFLQLLLRKTTGVSLLSSSEREVVRIIKEKACYVAKDPHIEEQNFSINPNYTK- 242

Query: 243 YELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVL 302
           ++LPDG+ I +G E+F APE LFQP L+  E   + ++ + +I+  D+D+R+ L+  ++L
Sbjct: 243 FKLPDGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLL 302

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLAN 362
           SGG+S+ PG   RL  ELK L  ++            K++I  PP RK+  +IGG++L+ 
Sbjct: 303 SGGTSILPGFGDRLLSELKSLSDSQT-----------KIKIFAPPERKYSTWIGGSILSG 351

Query: 363 IMADKDHMWLSKQEWHEIGPAAMSKF 388
           +   K  +W+++ EW E      S+F
Sbjct: 352 LSTFK-KLWVTRAEWEEAADCIHSRF 376

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score =  260 bits (665), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 146/390 (37%), Positives = 226/390 (57%), Gaps = 25/390 (6%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + PIVLD G+G +K G  GE+ P     S+VG P       G       +  +G++A E+
Sbjct: 10  NQPIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDG---NTFVGNQAQEI 66

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ +P+E+G++ +W  +E LW + F + ++L +     VL+TE P+NP KNREQMC
Sbjct: 67  RGLLKLRHPLEHGVVTDWNALEQLWGHVFEKGLQLSSLQDHPVLVTEAPLNPKKNREQMC 126

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E++FE +     YV+IQAVL+LYA G             +H VPVY+   L    RR+D+
Sbjct: 127 ELLFETFSVPAVYVSIQAVLSLYASGRTTGCVLDSGDGCSHAVPVYDGYTLPSAIRRIDI 186

Query: 184 AGRDVTRHLIDLLSRR--GYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTL-- 239
           AGRD++  L+ +L R+  G +   +++ E VR IKEK CY++    LD K   +  T+  
Sbjct: 187 AGRDIS-ELLQVLIRKSTGVSLLSSSEREIVRIIKEKACYIA----LDPKEEEKNYTMHG 241

Query: 240 -VESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYK 298
               + LPDG+ I++  E+F APE LF P L+  E   + E+L+ +IQ  D+D+RTSL+ 
Sbjct: 242 KQTMFRLPDGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFS 301

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGA 358
            IV SGG++M PG   R+ KELK       L  +P    + K++I  PP RK+  +IGG+
Sbjct: 302 NIVFSGGTTMIPGFGDRVLKELK-------LSCEP----QTKIKIFAPPERKYSTWIGGS 350

Query: 359 VLANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           +L+ +   K  +W++K+EW E      ++F
Sbjct: 351 ILSGLSTFK-KIWVTKKEWEENPRCVHARF 379

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score =  259 bits (661), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 140/388 (36%), Positives = 224/388 (57%), Gaps = 17/388 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + P+VLD G+G +K G +GE  P     S++G P       G  ++  +  +IG+EA ++
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQ--LIGNEAQKM 66

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ YP+E+G++++W  +E LW + F+  +KL       +L+TE P+NP+KNR +MC
Sbjct: 67  RGLLKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANIEEHPMLITEAPLNPMKNRNKMC 126

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E++FE +     YV+IQAVLALYA G                VPVY+   L    +R+DV
Sbjct: 127 EMLFETFGSPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQRIDV 186

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK--LARETTTLV 240
           AGRD+T  L  LL +  G   + +++ E VR IKEK C+V+ D+  + +      +  L 
Sbjct: 187 AGRDITEFLQLLLRKSSGVTLSSSSEREIVRMIKEKACFVATDVGNEEQNYEGANSAELE 246

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
             ++LPDG+++ +G E+F APE LFQP L+  E   + E+   +I   D+D+R+SLY +I
Sbjct: 247 TRFKLPDGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSI 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+M+ G   RL  E+++           T     K++I  PP RK+  +IGG++L
Sbjct: 307 VLSGGSTMFSGFGDRLLSEIRK-----------TSEPNTKIKIFAPPERKYSTWIGGSIL 355

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           A  ++  + +W+++ EW E      S+F
Sbjct: 356 AG-LSTFEKLWVTRAEWQENPQCIHSRF 382

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score =  249 bits (637), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 140/397 (35%), Positives = 225/397 (56%), Gaps = 25/397 (6%)

Query: 1   MDPHT-----PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKD-I 54
           +DP+      P+VLD G+  +K G +GE+ P +   SIVG P       G+ +   KD  
Sbjct: 2   LDPNAVLYSQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSP-----RHGYVNDSSKDDT 56

Query: 55  MIGDEASEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMN 114
            +G+ A E RS LQ+ +P+++G+++NW DMEL+WDY F +++KL       VL+TE P+N
Sbjct: 57  FVGNLAQERRSILQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKDVDEHPVLITEAPLN 116

Query: 115 PIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P+ NR++MC+++FE +     YVA  AVL+LYA G             +  VPVY+   L
Sbjct: 117 PVSNRDEMCDLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGDGYSCSVPVYQGYTL 176

Query: 175 NHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDL-DTKL 232
               +R+D+ GRD+T  L + L    G +   + + E VR IKEK CYV+ DLD+ + K 
Sbjct: 177 KSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKC 236

Query: 233 ARETTTLVESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDI 292
             E   +   ++LPDG+ I +  +RF+ PE LFQPS++  E   + E+++ ++   D D+
Sbjct: 237 NYEGDQVGLKFKLPDGKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 293 RTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHM 352
           R  ++  I+LSGG++M  G  +RL +EL +L              + +V+I  PP RK+ 
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDKL-----------NQAQSRVKIWAPPERKYT 345

Query: 353 VFIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKFG 389
            +IGG++LA  ++    + ++K +W E      +K G
Sbjct: 346 SWIGGSILAE-LSTFQKIIVTKSQWQEDPSIIHTKCG 381

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  244 bits (623), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 131/378 (34%), Positives = 206/378 (54%), Gaps = 14/378 (3%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + P+VLD G+  +K G +G+N P     +++G P        +A +      IG+ A + 
Sbjct: 8   NQPVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKS 67

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ +PM  GI+ NW DME LW + F + +K+       +L+TE P+NP KNR++MC
Sbjct: 68  RGLLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFDEHPLLITEAPLNPEKNRDKMC 127

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           EV FEK+DF   Y+A  + L+LYA G                VP+YE   L    RR+DV
Sbjct: 128 EVFFEKFDFAAVYIANPSTLSLYASGRTTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDV 187

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
            GRDVT  L   +    G +   +++ E V+ +KEK CYVS D   D  ++      +  
Sbjct: 188 GGRDVTEQLQFQIRKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRC 247

Query: 243 -YELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIV 301
            ++LPDG+ + +   RF APE LF+P ++ +E   V ++ F +I   D+++R  L+ +I+
Sbjct: 248 QFKLPDGKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSII 307

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           L+GGS+M+ G   RL KEL+       +R     L    ++I  PP RK+  +IGG++L 
Sbjct: 308 LNGGSTMFRGFGDRLLKELQ-------IRTGNKNL----IKIIAPPERKYTSWIGGSILT 356

Query: 362 NIMADKDHMWLSKQEWHE 379
            +   K  +W++K EW E
Sbjct: 357 GLSTFK-QLWMTKAEWQE 373

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score =  244 bits (622), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 140/388 (36%), Positives = 229/388 (59%), Gaps = 17/388 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + P+VLD G+G +K G +GE  P     S++G P       G  S+  +  ++G+EA + 
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSS--RGQLVGNEAQKQ 66

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ YP+E+GI+++W+ +E LW + F+  +KL       +L+TE P+NP++NR++MC
Sbjct: 67  RGLLRLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIGDHPMLVTEAPLNPLENRDKMC 126

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E+++E ++    YV+IQAVLALYA G                VPVY+   +    RR+DV
Sbjct: 127 EMLYETFNVPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFSIPSAIRRIDV 186

Query: 184 AGRDVTRHLIDLLSRR-GYAFNRTADFETVRQIKEKLCYVSYDLDLDTK--LARETTTLV 240
           AGRDVT  L  LL +  G     +++ E VR IKEK CYV+ ++  + +   +   +  +
Sbjct: 187 AGRDVTEFLQLLLRKSIGVTLLSSSEREIVRMIKEKACYVAPEVAAEEQKYASSRGSEEL 246

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
             ++LPDG+++ +G E+F APE LFQP L+  E   + ++ F +I   D+D+R+SLY ++
Sbjct: 247 TKFKLPDGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSL 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+++ G   RL  EL+        R +P      K++I  PP RK+ V+IGG++L
Sbjct: 307 VLSGGSTLFAGFGDRLLNELRS-------RCEPN----VKIKIFAPPERKYSVWIGGSIL 355

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           A  ++  + +W+++ EW E      S+F
Sbjct: 356 AG-LSTFEKIWVTRSEWQENPQCVHSRF 382

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score =  242 bits (618), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 136/378 (35%), Positives = 206/378 (54%), Gaps = 21/378 (5%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + PIVLD G+  +K G  G++ P     S++G P       G      K   +G+ A E 
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVE---KGKFVGNLAQEY 67

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ YPM++GII NW  ME +WD+ F + +K+       +++TE P+NP  NRE+MC
Sbjct: 68  RGLLKLRYPMDHGIIENWEHMETVWDHIFKDCLKVSNLGEHPLVVTEAPLNPKPNREKMC 127

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E +FE ++    Y+A  AVL+LYA G                VP+YE   L    RR+D+
Sbjct: 128 ETLFESFNIPALYIANPAVLSLYASGRTTGCVVEAGDGYCSSVPIYEGFALTPSIRRIDI 187

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK---LARETTTL 239
            GRD+T+HL + L    G     +++ E VR IKE  CY+  +   + +   L +E  ++
Sbjct: 188 GGRDITKHLQLQLRKSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSI 247

Query: 240 VESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKA 299
             S++LPDG+ + +GP RF APE LF P L+  E   + +++  +I   D+D+R+ L   
Sbjct: 248 --SFKLPDGKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNN 305

Query: 300 IVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAV 359
           I LSGGS+M+ G   RL  EL           D +     KVRI  PP RK+  FIGG++
Sbjct: 306 ITLSGGSTMFQGFCDRLITEL-----------DFSVDKTTKVRILAPPERKYSAFIGGSI 354

Query: 360 LANIMADKDHMWLSKQEW 377
           LAN+   ++ MW++K +W
Sbjct: 355 LANLSTFRN-MWVTKDQW 371

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score =  240 bits (613), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 211/386 (54%), Gaps = 16/386 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + PIV+D GT  +K G  GE  P     SIVG P  + ++   ++    D  IG++A + 
Sbjct: 12  NQPIVIDNGTNVIKGGFTGETKPRCLEYSIVGTP--KYDKIMQSNGIESDSFIGNKAQKY 69

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ +PM  G+++NW DME +W Y F + + L   +   +L+TEPP+N + NR++MC
Sbjct: 70  RGILKLRHPMLRGVVQNWDDMETIWQYVFDDTLYLENLNEHPILITEPPLNNMANRQKMC 129

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E +FE + F   Y+++  VL+LYA G                +PVY    L    +++D+
Sbjct: 130 EALFEIFGFPAVYISVSPVLSLYASGQTTGCAVDCGDGYCTSIPVYNGFSLASSVKKIDI 189

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            G D+T  L   +L   G     +++ E VR IKEK+CY++ D +L+T K       +  
Sbjct: 190 GGCDITEQLQFSILKNTGLFMYSSSEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMAS 249

Query: 242 SYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIV 301
            ++LPDG+++ +   ++ + E LF+P L+  E   + E+ + +I+  D D+R  LY  IV
Sbjct: 250 QFKLPDGKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIV 309

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M PG  SRL KEL+ L          T  D  K+RI  PP RK+  +IGG++L+
Sbjct: 310 LSGGTTMCPGFGSRLLKELQTL----------TGYDT-KIRIIAPPERKYTSWIGGSILS 358

Query: 362 NIMADKDHMWLSKQEWHEIGPAAMSK 387
             ++    +W++K  W E      SK
Sbjct: 359 G-LSTFSKIWVTKSMWEEDNKIIHSK 383

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  228 bits (582), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 122/378 (32%), Positives = 206/378 (54%), Gaps = 17/378 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++        D  +G++A  +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHA---KYDKVMLEGLQGDTFVGNKAQRL 68

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ YP+E+G++ +W  MEL+W +   E ++L       +L+TE PMNP+KNRE M 
Sbjct: 69  RGLLRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           +V+FE ++    YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYVSNPAVLSLYASGRTTGCVIDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDL-DTKLARETTTLVE 241
            GRD+T+ L   L    G +   +++ E VR IKEK+CY++ D+   +    +E+  L  
Sbjct: 189 GGRDITKQLQFQLRKSAGVSLFSSSEREIVRTIKEKVCYLATDIKKEENTYMQESQDLTS 248

Query: 242 SYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIV 301
            ++LPDG+ I++G +R+ APE LF P ++     G+ ++   +I   D+D+RT+L  +I+
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+   FT+            K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGDRMLHDLEA--FTK---------GTSKIKIIAPPERKYTTWVGGSILT 357

Query: 362 NIMADKDHMWLSKQEWHE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score =  228 bits (581), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 122/378 (32%), Positives = 202/378 (53%), Gaps = 17/378 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + P+V+D G+G +K G +GE  P      +VG       ++        D  IG+ A ++
Sbjct: 12  NQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNT---KYDKVMLEGLQGDTFIGNNAQKL 68

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ YP+++G++ +W  MEL+W Y   E ++L       +L+TE PMNP+KNREQM 
Sbjct: 69  RGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMA 128

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           +V+FE +D    YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDL-DTKLARETTTLVE 241
            G D+T  L   L    G +   +++ E VR +KEK+CY++ ++   + K  + T  L+ 
Sbjct: 189 GGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLIS 248

Query: 242 SYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIV 301
           +++LPDGR I+VG +R+ APE LF P ++ +   G+ ++   +I   D+D+R  L  +I+
Sbjct: 249 TFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+      LW    L    +     K++I  P  RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRM------LWDLEALTKGTS-----KIKIIAPSERKYTTWIGGSILT 357

Query: 362 NIMADKDHMWLSKQEWHE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score =  228 bits (580), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 131/388 (33%), Positives = 210/388 (54%), Gaps = 19/388 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIM-IGDEASE 62
           + P+V+D GTG +K+G  G++ P     +IVG P       G     L D M IG++A E
Sbjct: 8   NQPVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIG----GLDDNMYIGNKAQE 63

Query: 63  VRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQM 122
            R  L++ +PME+G +++W +ME +W +     + +       +L+TE P+N  KNRE M
Sbjct: 64  NRGLLRLRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHIEEHPILITEAPLNSSKNREHM 123

Query: 123 CEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLD 182
           CE++FE ++    +V   AVLALY+ G                VP+YE   L    RR+D
Sbjct: 124 CEILFESFNIPAIHVENPAVLALYSGGRTTGCVIDCGEGYCSAVPIYEGFALTPSIRRID 183

Query: 183 VAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLV 240
           + GR++T  L   +    G +   + + E VR IKE+ CYV+ D+  +  K   ++ +  
Sbjct: 184 IGGREITEQLQFQIRKSVGMSLFSSNEKEIVRTIKERACYVADDISKEEHKYILDSESNS 243

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
             ++LPDG+ + +G  RF A E LF P L+  E   V E++F T+   D+D+R  LYK++
Sbjct: 244 SKFKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSL 303

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VL+GG+++ PG  +R+ KEL+ L          T+ D  K+RI   P RK+  +IGG++L
Sbjct: 304 VLNGGTTVLPGFGNRILKELQIL----------TKQDT-KLRIIASPERKYTTWIGGSIL 352

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           A  ++    + ++K  W+E      S F
Sbjct: 353 AG-LSTFQKILVTKSNWNEDRSRVYSSF 379

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  225 bits (574), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 121/378 (32%), Positives = 202/378 (53%), Gaps = 17/378 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++        D  +G++A ++
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEERPKALEYSLVGHT---KYDKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ YPM++G++ +W  MEL+W Y   E ++L       +L+TE PMNP+KNRE + 
Sbjct: 69  RGLLRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIEEHPLLITEAPMNPLKNREMIA 128

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           +VMFE ++    YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVMFETFNLSAIYVSDPAVLSLYASGRTTGCVVDCGEGYCSSVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            G D+T  L   +    G +   +++ E VR IKEK+CY++ D   +  K  + T  L+ 
Sbjct: 189 GGGDITEQLQFQIRKSAGVSLFSSSEREIVRTIKEKVCYLAKDAKKEEDKYLQGTQDLIS 248

Query: 242 SYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIV 301
           +++LPDG+ I+VG +R+ APE LF P ++     G+  +   +I   D+D+R +L  +++
Sbjct: 249 AFKLPDGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVI 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L                K++I  PP RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRMLHDLEAL-----------TKGTSKIKIIAPPERKYTAWIGGSILT 357

Query: 362 NIMADKDHMWLSKQEWHE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  224 bits (570), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 202/378 (53%), Gaps = 17/378 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + PIV+D G+G +K+G +GE  P     S+VG       E+        D  +G++A ++
Sbjct: 12  NQPIVIDNGSGIIKVGFSGEERPKALEYSLVGHV---KYEKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ YPM +G++ +W  MEL+W Y   E ++L       +L+TE PMNP+KNRE M 
Sbjct: 69  RGLLRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           +V+FE ++    Y++  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYISNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            GRD+T  L   L    G +   +++ E VR IKEK+CY++ ++  +  +  +    L  
Sbjct: 189 GGRDITEQLQFQLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRYLQGHHDLGS 248

Query: 242 SYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIV 301
            ++LPDG+ I++G +R+ APE LF P ++     G+ ++   +I   D+D+R +L  +I+
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L                K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGERMLHDLEAL-----------SKGTCKIKIIAPPERKYTTWVGGSILT 357

Query: 362 NIMADKDHMWLSKQEWHE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score =  218 bits (555), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 196/378 (51%), Gaps = 17/378 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + P+V+D G+  VK G  GE  P     S++G         G       D  +G++A  +
Sbjct: 9   NQPVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLEC---DSFVGNKAQRL 65

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R  L++ +PME G++ +W DMELLW +  F+ ++L +     +L+TE P+NP  N+E+M 
Sbjct: 66  RGLLKLKHPMERGVVSDWDDMELLWSHILFDSLQLTSGMEHPLLITEAPLNPESNKEKML 125

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           EV FE ++     V+I  VL+LYA G                VPV E   L    +R+++
Sbjct: 126 EVFFETFNIPAICVSIPGVLSLYASGRTTGCVVDCGEGYCSSVPVCEGYTLASSIKRINL 185

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD-LDLDTKLARETTTLVE 241
            G DVT+ L   L    G     + + E VR +KEK CYVS + L  + K   E   +  
Sbjct: 186 GGIDVTKQLQFQLRKESGVWLFSSGERELVRTMKEKSCYVSLNQLKDEEKFTFEPGKMNT 245

Query: 242 SYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIV 301
           +++LPDG ++ +   RF APE LFQP ++  E+P + E+   +I + DV++R  L   I 
Sbjct: 246 NFKLPDGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRIT 305

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M+ G   R  +EL+            +   K  +RI  PP RK+  +IGG++LA
Sbjct: 306 LSGGTTMFRGFGDRFLQELQ-----------ISTCKKSNIRILAPPERKYTAWIGGSMLA 354

Query: 362 NIMADKDHMWLSKQEWHE 379
            +   +  M  +K +W E
Sbjct: 355 GLTTFR-KMLTTKSDWRE 371

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  214 bits (546), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 202/380 (53%), Gaps = 19/380 (5%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDI--MIGDEAS 61
           + PIV+D G+  +K G + ++ P     ++ G P     ++   +  L+++   IG+ A 
Sbjct: 9   NQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMP---KYDKIMITGQLENLDKYIGNRAQ 65

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
            +R  L++ +PM  G++ NW DMELLW + F + + +       +L+TE P+   K R  
Sbjct: 66  SIRGLLRLQHPMNRGVVDNWDDMELLWWHIFNDTLNVQNIEEHPLLITEAPLTIEKQRHI 125

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
           MCE +FE ++    YVA  +VL+LYA G                 P+YE  VL    R++
Sbjct: 126 MCERLFETFNIPSLYVANPSVLSLYASGNTTGCVVDCGDGYCSSTPIYEGFVLPASIRKM 185

Query: 182 DVAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD-LDTKLARETTTL 239
           +V GRD+T HL   +    G +   + + E VR IKEK+CY+S D +  +         +
Sbjct: 186 EVGGRDITEHLQFQIRKSSGISLYSSNEKEIVRTIKEKVCYISEDFNKSEESYYLRQDEM 245

Query: 240 VESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKA 299
              ++LPDG+ + +  ERF +PE LF P L+ +E   V  + F +I   D+++R  L+  
Sbjct: 246 SCKFKLPDGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSN 305

Query: 300 IVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAV 359
           I+L+GGS+++ G  SRL  +L++L   R            K++I  PP RK+  +IGG++
Sbjct: 306 ILLTGGSTLFKGFGSRLLGDLQELTNNRA-----------KIKILAPPERKYTSWIGGSI 354

Query: 360 LANIMADKDHMWLSKQEWHE 379
           L  +   K+ +W++K +W E
Sbjct: 355 LTGLSTFKN-LWVTKSDWEE 373

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score =  204 bits (518), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 127/395 (32%), Positives = 205/395 (51%), Gaps = 29/395 (7%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKD-IMIGDEASE 62
           + P+VLD G+  +K G +G+  P     ++ G+P  +       +T L+D   +G+EA  
Sbjct: 11  NQPVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKV----MTTGLEDRTFVGNEAQR 66

Query: 63  VRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGG----KVLLTEPPMNPIKN 118
           +R  L +  P+  G + NW DMELLW + F+ +++L   +       +L+TE P+N  KN
Sbjct: 67  LRGLLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGDHPLLITEAPLNSTKN 126

Query: 119 REQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLT 178
           RE MCE+++E ++F   YVA  AVL+LYA G             +   PVY+   L    
Sbjct: 127 RETMCEILYETFNFDALYVAHPAVLSLYATGQTTGCVLECGEGYSASTPVYQGFALPSSI 186

Query: 179 RRLDVAGRDVTRHLIDLLSRR-GYAFNRTADFETVRQIKEKLCYVSYDLDLDTKL----A 233
           RR+D+ GRD+T+ L   + +  G +    ++ E VR IKEK  YV+ D   + +      
Sbjct: 187 RRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEIVRTIKEKANYVALDYKFEEEKFFIHE 246

Query: 234 RETTTLVESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIR 293
           RE T+ V+   LPDG+ +  G  ++   E LFQP L+  E   V E+L  +I   D+D+R
Sbjct: 247 RENTSTVK---LPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLR 303

Query: 294 TSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
           T L + IVLSGG++M  G   R   E K++                KV+I     R ++ 
Sbjct: 304 TQLLENIVLSGGTTMLKGFDQRTMSETKKMLPKHT-----------KVKIRSLAERSYIA 352

Query: 354 FIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           +IGG++L+ +   ++ +WL+++ + E       KF
Sbjct: 353 WIGGSILSGLYGFRN-LWLTREMYEEDPSMVHRKF 386

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score =  178 bits (452), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 111/380 (29%), Positives = 183/380 (48%), Gaps = 20/380 (5%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
           + P++LD G+  +K G AG   PD    + +G P+    ER   +   K+  IG+ A E 
Sbjct: 10  NQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPL---AERSMVTVSNKETYIGNSAYER 66

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           R+ L +  P     I +W  +E LWDY    ++++       V+LT       K  E+MC
Sbjct: 67  RATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEKMC 126

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           EV+FEK+     Y +   +++LY  G               I  V + +++   ++  + 
Sbjct: 127 EVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVSCGHRGIGITTVIDGMIVGGSSQISNT 186

Query: 184 AGRDVTRHLIDLLSRRGYAF-NRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
            G  VT  ++DLL        N     E +R IKE+ C +S D   + +     T+   +
Sbjct: 187 GGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKERCCVLSKDFYNEIRAYELITSKTSN 246

Query: 243 --YELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
             Y LPDG +I++G ERFEAPE +F P      +  + +++ N+I  A +  R+ L ++I
Sbjct: 247 NKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESI 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLD-KFKVRIEDPPRRKHMVFIGGAV 359
           VLSGGSS+  G   RL KE+++             +D   K+ +  P  R+ + +IGG+V
Sbjct: 307 VLSGGSSLIKGFGERLTKEIRK------------EIDGNQKIMLNAPHERRFLPWIGGSV 354

Query: 360 LANIMADKDHMWLSKQEWHE 379
           L+ +   K  +W SK  + E
Sbjct: 355 LSGLSTMK-LLWKSKSAYRE 373

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score =  178 bits (451), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 137/438 (31%), Positives = 209/438 (47%), Gaps = 63/438 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG--RPILRAEER-------------------- 44
           IV+D GTG  K+G AG + P + FP+ +   +P    ++                     
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSTTTKQSGSSGGVGPGSGSIQTQGVGS 68

Query: 45  -------------GHASTPLKDIMIGDEA---SEVRSYLQISYPMENGIIRNWADMELLW 88
                        G   T   D  IGDEA   S+  SY  +SYP+ +G + NW  ME  W
Sbjct: 69  SSLSAALLSNNLAGKRGTEDLDFYIGDEAIAASQGPSY-SLSYPIRHGQVENWDHMERFW 127

Query: 89  DYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQ 148
           + + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+QAVLAL A 
Sbjct: 128 ENSIFKYLRTEPEDH-YFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAAS 186

Query: 149 GLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRG 200
                                 TH++PV E  V+    + + +AGRD+T  +  LL  RG
Sbjct: 187 WTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG 246

Query: 201 YAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRVIKVGP 255
                     T  +IK++ CYV  D+       D    +    +VE+ E    +VI VG 
Sbjct: 247 ---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKTRRKVIDVGY 303

Query: 256 ERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLP 313
           ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLSGGS+M+    
Sbjct: 304 ERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 362

Query: 314 SRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHM 370
            RL+++LK +   R+  ++    T+     V++    R+++ V+ GG++LA     + + 
Sbjct: 363 RRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAETAEFRGYC 422

Query: 371 WLSKQEWHEIGPAAMSKF 388
             SKQ++ EIGP  +  F
Sbjct: 423 H-SKQDYEEIGPEIVRNF 439

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score =  176 bits (447), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 137/444 (30%), Positives = 207/444 (46%), Gaps = 69/444 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFP----------------------------------- 31
           IV+D GTG  K+G AG + P + FP                                   
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQRSTTKQGGSGSGAGQSQGSGNPYFGNST 68

Query: 32  ------SIVGRPILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMENGIIRNWA 82
                 S+    +L     G   T   D  IG+EA   S+  SY  +SYP+ +G + NW 
Sbjct: 69  SATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSY-SLSYPIRHGQVENWD 127

Query: 83  DMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAV 142
            ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+QAV
Sbjct: 128 HMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAV 186

Query: 143 LALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194
           LAL A                       TH++PV E  V+    + + +AGRD+T  +  
Sbjct: 187 LALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQS 246

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGR 249
           LL  RG          T  +IK++ CYV  D+       D    +    +VE+ E    +
Sbjct: 247 LLRERG---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKTKRK 303

Query: 250 VIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSS 307
           VI VG ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLSGGS+
Sbjct: 304 VIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 362

Query: 308 MYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLANIM 364
           M+     RL+++LK +   R+  ++    T+     V++    R+++ V+ GG++LA   
Sbjct: 363 MFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTA 422

Query: 365 ADKDHMWLSKQEWHEIGPAAMSKF 388
             K +   +KQ++ EIGP  +  F
Sbjct: 423 EFKSYCH-TKQDYEEIGPEIVRNF 445

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  176 bits (445), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 133/459 (28%), Positives = 214/459 (46%), Gaps = 78/459 (16%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------- 34
           M+ +  +V+D GTG  K+G AG + P + FP+ +                          
Sbjct: 1   MNLNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIATASPSGNKKTGSSATSSSVSGSGTN 60

Query: 35  ------------------------GRPILRAEERGHASTPLKDIMIGDEA---SEVRSYL 67
                                   G+ +L     G   T   D  IG+EA   ++  SY 
Sbjct: 61  GSNGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSY- 119

Query: 68  QISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMF 127
            +SYP+ +G + NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ F
Sbjct: 120 SLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDH-YFLLTEPPLNPPENREQVAEIFF 178

Query: 128 EKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTR 179
           E ++  G Y+A+QAVLAL A                       TH++PV E  V+    +
Sbjct: 179 ESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIK 238

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLAR 234
            + +AGRD+T  +  LL  RG A        T  +IK++ CYV  D+       D +  +
Sbjct: 239 NIPIAGRDITEFIQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEK 295

Query: 235 ETTTLVESYELPDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDI 292
               +VES E    +V+ VG ERF APE  F P +   D   P +  ++  TIQA  +D+
Sbjct: 296 FAQFIVESQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDV 354

Query: 293 RTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRR 349
           R  LY  IVLSGGS+M+     RL++++K +   R+ +N+     +     V++    ++
Sbjct: 355 RKGLYNNIVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMTGVKSSGVDVQVISHRKQ 414

Query: 350 KHMVFIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           ++ V+ GG++LA     + +   +K+++ EIGP  +  F
Sbjct: 415 RNAVWFGGSLLAQTAEFRGYCH-TKRDYEEIGPEIVRNF 452

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score =  175 bits (443), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 134/446 (30%), Positives = 212/446 (47%), Gaps = 71/446 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV--------GRPILRAEERGHAS---------- 48
           +V+D GTG  K+G AG + P + FP+ +        G    +A+  G ++          
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGTATGSNKNKAQATGGSNAGGSNPYFGN 68

Query: 49  -------------------------TPLKDIMIGDEA---SEVRSYLQISYPMENGIIRN 80
                                    T   D  IG+EA   S+  SY  +SYP+ +G + N
Sbjct: 69  STSATSFNNLSSQMLMSNNLAGKRGTEDLDFYIGNEALIASQGASY-SLSYPIRHGQVEN 127

Query: 81  WADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQ 140
           W  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+Q
Sbjct: 128 WDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAVQ 186

Query: 141 AVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHL 192
           AVLAL A                       TH++PV E  V+    + + +AGRD+T+ +
Sbjct: 187 AVLALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFI 246

Query: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPD 247
             LL  RG A        T  +IK++ CYV  D+       D    +    +VE+ E   
Sbjct: 247 QTLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQEKTQ 303

Query: 248 GRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGG 305
            +V+ VG ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLSGG
Sbjct: 304 KKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGG 362

Query: 306 SSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLAN 362
           S+M+     RL+++LK +   R+ +N+    T+     V +    ++++ V+ GG++LA 
Sbjct: 363 STMFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 422

Query: 363 IMADKDHMWLSKQEWHEIGPAAMSKF 388
               K +   +K+++ E GP  +  F
Sbjct: 423 TAEFKSYCH-TKKDYEEYGPEIVRNF 447

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score =  174 bits (442), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 135/442 (30%), Positives = 210/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFP--------------SIVGRP--------------- 37
           +V+D GTG  K+G AG + P + FP              S VG P               
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTS 68

Query: 38  ----------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMENGIIRNWADM 84
                     +L     G   T   D  IG+EA   S+  SY  +SYP+ +G + NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLA 144
           E  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRVI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VE+ E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +   R+ +++    T+     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWHEIGPAAMSKF 388
           K +   +K+++ E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  173 bits (439), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 134/449 (29%), Positives = 208/449 (46%), Gaps = 74/449 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV----------------------------GRP- 37
           +V+D GTG  K+G AG + P + FP+ +                            G P 
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNTKKSSAVATMGGSGAQPGGSAGNPY 68

Query: 38  -----------------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMENGI 77
                            +L     G   T   D  IG+EA   S   SY  +SYP+ +G 
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSY-SLSYPIRHGQ 127

Query: 78  IRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYV 137
           + NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+
Sbjct: 128 VENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYI 186

Query: 138 AIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVT 189
           A+QAVLAL A                       TH++PV E  V+    + + +AGRD+T
Sbjct: 187 AVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT 246

Query: 190 RHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYE 244
             +  LL  RG          T  +IK++ CYV  D+       D    +    +VE+ E
Sbjct: 247 LFIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSE 303

Query: 245 LPDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVL 302
               +++ VG ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVL
Sbjct: 304 STKKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVL 362

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAV 359
           SGGS+M+     RL+++LK +   R+ +++    T+     V++    R+++ V+ GG++
Sbjct: 363 SGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSL 422

Query: 360 LANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           LA     K +   +KQ++ E GP  +  F
Sbjct: 423 LAQTAEFKSYCH-TKQDYEEYGPEIVRNF 450

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score =  172 bits (437), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 132/454 (29%), Positives = 211/454 (46%), Gaps = 79/454 (17%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------------- 34
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNAKQTSSNAVSAGASSVANTGQSSGS 68

Query: 35  -------------------GRPILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYP 72
                              G  ++     G   T   D  IG+EA   ++  SY  +SYP
Sbjct: 69  GRQYFGNSTSATAFNSLSSGSALMSNNLAGKRGTEDLDFYIGNEALIAAQGPSY-GLSYP 127

Query: 73  MENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDF 132
           + +G + NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++ 
Sbjct: 128 IRHGQVENWDHMERFWENSIFKYLRTEPEDHC-FLLTEPPLNPPENREQVAEIFFESFNC 186

Query: 133 GGTYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVA 184
            G Y+A+QAVLAL A                       TH++PV E  V+    + + +A
Sbjct: 187 AGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIA 246

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTL 239
           GRD+T  +  LL  RG          T  +IK++ CYV  D+       D    +    +
Sbjct: 247 GRDITLFIQQLLRERG---EEDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFV 303

Query: 240 VESYELPDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLY 297
           VES E    +V+ VG ERF APE  F P +   D   P +  ++ +TIQA  +D+R  LY
Sbjct: 304 VESQEKTRRKVVDVGCERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLY 362

Query: 298 KAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVF 354
             IVLSGGS+M+     RL+++LK +   R+++++    T+     V++    ++++ V+
Sbjct: 363 NNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVW 422

Query: 355 IGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKF 388
            GG++LA     K +   +K+++ EIGP  +  F
Sbjct: 423 FGGSLLAQTAEFKSYCH-TKKDYEEIGPEIVRNF 455

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  172 bits (436), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/442 (29%), Positives = 208/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRP----------------------------- 37
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGTSSAAGNEASYFGNSTS 68

Query: 38  ----------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMENGIIRNWADM 84
                     +L     G   T   D  IG+EA   S+  SY  +SYP+ +G + NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLA 144
           E  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRVI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VE+ E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +   R+ +++    T+     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWHEIGPAAMSKF 388
           K +   +K+++ E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  172 bits (436), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/442 (29%), Positives = 209/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRP----------------------------- 37
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDAPSWVFPTAIATAAPSNTKKSSGVGATSATGSEASYFGNATS 68

Query: 38  ----------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMENGIIRNWADM 84
                     +L     G   T   D  IG+EA   S+  SY  +SYP+ +G + NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLA 144
           E  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRVI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VE+ E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +  +R+ +++    T+     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWHEIGPAAMSKF 388
           K +   +K+++ E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score =  172 bits (435), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 129/447 (28%), Positives = 211/447 (47%), Gaps = 72/447 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRP----------------------------- 37
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQASNTKKSTVVNKSSAGGADSSGSGYFGN 68

Query: 38  ---------------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMENGIIR 79
                          +L     G   T   D  IG+EA   ++ +SY  +SYP+ +G + 
Sbjct: 69  STSATSFNSGDMSSLLLSNNLAGKRGTEDLDFYIGNEALAAAQGQSY-SLSYPIRHGQVE 127

Query: 80  NWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAI 139
           NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRH 191
           QAVLAL A                       TH++PV E  V+    + + +AGRD+T  
Sbjct: 187 QAVLALAASWTSPKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELP 246
           +  LL  RG    +    +T  +IK++ CYV  D+       D   ++    +VES E  
Sbjct: 247 IQQLLRERG---EQDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQEKT 303

Query: 247 DGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSG 304
             +++ VG ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLSG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSG 362

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           GS+M+     RL++++K +   R+ +++    T+     V++    ++++ V+ GG++LA
Sbjct: 363 GSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLA 422

Query: 362 NIMADKDHMWLSKQEWHEIGPAAMSKF 388
                K +   +K+++ E GP  +  F
Sbjct: 423 QTAEFKSYCH-TKKDYDEYGPEIVRNF 448

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  172 bits (435), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 134/449 (29%), Positives = 208/449 (46%), Gaps = 74/449 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFP----------------------------------- 31
           +V+D GTG  K+G AG + P + FP                                   
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQSGKSQSSSNKSTGFGSSSANAQSSYLSG 68

Query: 32  -----------SIVGRPILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMENGI 77
                      S+    ++     G   T   D  IG+EA   S+  SY  +SYP+ +G 
Sbjct: 69  GGNSTSATDFNSLASSTLISNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQ 127

Query: 78  IRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYV 137
           + NW  ME  W+ + F+ ++         LLTEPP+NP +NR+Q+ E+ FE ++  G Y+
Sbjct: 128 VENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENRQQVAEIFFESFNCAGLYI 186

Query: 138 AIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVT 189
           A+QAVLAL A                       TH++PV E  V+    + + +AGRD+T
Sbjct: 187 AVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT 246

Query: 190 RHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYE 244
             +  LL  RG    + A   T  +IK++ CYV  D+       D    +    +VE+ E
Sbjct: 247 LFIQSLLRERG---EQDASLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKE 303

Query: 245 LPDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVL 302
               +V+ VG ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVL
Sbjct: 304 RTTKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVL 362

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRRKHMVFIGGAV 359
           SGGS+M+     RL+++LK +   R+ +++    TR     V +    R+++ V+ GG++
Sbjct: 363 SGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSL 422

Query: 360 LANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           LA     K +   +KQ++ E GP  +  F
Sbjct: 423 LAQTGEFKSYCH-TKQDYEEYGPDIVRNF 450

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score =  171 bits (432), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 133/447 (29%), Positives = 210/447 (46%), Gaps = 72/447 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------GRP---- 37
           +V+D GTG  K+G AG + P + FP+ +                         G P    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGGSSSNAKKSMSSSAASSATAGNPYYGN 68

Query: 38  ---------------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMENGIIR 79
                          +L     G   T   D  IG+EA   S+  SY  +SYP+ +G + 
Sbjct: 69  STSATSFNDNNLSSMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVE 127

Query: 80  NWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAI 139
           NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRH 191
           QAVLAL A                       TH++PV E  V+    + + +AGRD+T  
Sbjct: 187 QAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELP 246
           +  LL  RG A        T  +IK++ CYV  D+       D    +    +VE+ E  
Sbjct: 247 IQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST 303

Query: 247 DGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSG 304
             +++ VG ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLSG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSG 362

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           GS+M+     RL+++LK +   R+ +++    T+     V++    ++++ V+ GG++LA
Sbjct: 363 GSTMFKDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLA 422

Query: 362 NIMADKDHMWLSKQEWHEIGPAAMSKF 388
                K +   +K+++ E GP  +  F
Sbjct: 423 QTAEFKGYCH-TKKDYDEYGPEIVRNF 448

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  171 bits (432), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 130/442 (29%), Positives = 207/442 (46%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRP----------------------------- 37
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGASSAAGSDTSYFGNSTS 68

Query: 38  ----------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMENGIIRNWADM 84
                     +L     G   T   D  IG+EA   S+  SY  +SYP+ +G + NW  M
Sbjct: 69  ATNFNGVTGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLA 144
           E  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRVI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VE+ E    + +
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKAV 303

Query: 252 KVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +   R+ +++    T+     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWHEIGPAAMSKF 388
           K +   +K+++ E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score =  170 bits (430), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 133/448 (29%), Positives = 210/448 (46%), Gaps = 79/448 (17%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGH-------------------- 46
           IV+D GTG  K+G AG + P + FP+ +      A  + H                    
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAI------ATSQNHTKKTSSMSSTSNTTSSNQYF 62

Query: 47  -------------ASTPLK------------DIMIGDEA---SEVRSYLQISYPMENGII 78
                        AS PL             D  IG+EA   ++  SY  +SYP+ +G I
Sbjct: 63  GNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQI 121

Query: 79  RNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVA 138
            NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A
Sbjct: 122 ENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIA 180

Query: 139 IQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTR 190
           +QAVLAL A                       TH++PV E  V+    + + +AGRD+T 
Sbjct: 181 VQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITL 240

Query: 191 HLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYEL 245
            +  LL  RG          T  +IK++ CYV  D+       D    +    +VE+ E 
Sbjct: 241 FIQSLLRERG---ETDTSLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEK 297

Query: 246 PDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLS 303
              +++ VG ERF APE  F P +   D   P +  ++ +TIQA  +D+R  LY  IVLS
Sbjct: 298 TQKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLS 356

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           GGS+M+     RL++++K +   R+ +++    T+     V +    ++++ V+ GG++L
Sbjct: 357 GGSTMFKDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLL 416

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           A     K +   +K+++ E GP  +  F
Sbjct: 417 AQTAEFKSYCH-TKKDYEEYGPEIVRNF 443

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  170 bits (430), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 130/451 (28%), Positives = 211/451 (46%), Gaps = 76/451 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRP----------------------------- 37
           IV+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQSSNAKSSANAPQGLGNAKAGVSNPATSN 68

Query: 38  -------------------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMEN 75
                              +L     G   T   D  IG+EA   S+  +Y  +SYP+ +
Sbjct: 69  PYFGNSTSATSFASNSNAFLLSNNLAGKRGTEDLDFYIGNEALVASQGPAY-SLSYPIRH 127

Query: 76  GIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGT 135
           G + NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G 
Sbjct: 128 GQVENWDHMERFWENSIFKYLRAEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGL 186

Query: 136 YVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRD 187
           Y+A+QAVLAL A                       TH++PV E  V+    + + +AGRD
Sbjct: 187 YIAVQAVLALAASWTSAQVTDRSLTGTVIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRD 246

Query: 188 VTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVES 242
           +T  +  LL  RG A    +  +T  +IK++ CYV  D+       D +  +    ++E+
Sbjct: 247 ITLFIQSLLRERGEA---DSSLKTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN 303

Query: 243 YELPDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
            +    +VI +G ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  I
Sbjct: 304 QDKTTKKVIDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNI 362

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRRKHMVFIGG 357
           VLSGGS+M+     RL++++K +   R+ +N+    T+     V++    ++++ V+ GG
Sbjct: 363 VLSGGSTMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGG 422

Query: 358 AVLANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           ++LA     K +   +K+++ E GP  +  F
Sbjct: 423 SLLAQTAEFKGYCH-TKKDYEEHGPEIVRNF 452

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score =  169 bits (428), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 132/448 (29%), Positives = 212/448 (47%), Gaps = 73/448 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------------- 34
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSKTAKSSSMSGMGQSGSGMGAGGSAFF 68

Query: 35  GRPILRAEERGHASTPLK-------------DIMIGDEA---SEVRSYLQISYPMENGII 78
           G         G  S+ L              D  IG+EA   ++  SY  +SYP+ +G +
Sbjct: 69  GNTTSATSFTGFTSSSLMSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQV 127

Query: 79  RNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVA 138
            +W  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G Y+A
Sbjct: 128 EDWNHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIA 186

Query: 139 IQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTR 190
           +QAVLAL A                       TH++PV E  V+    + + +AGRD+T 
Sbjct: 187 VQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITL 246

Query: 191 HLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLD-TKLARETTT----LVESYEL 245
            +  LL  RG          T  +IK++ CYV  D+  +  K  R+ T     +VE+ E 
Sbjct: 247 FIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVENKEK 303

Query: 246 PDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLS 303
              +V+ VG ERF APE  F P +   D   P +  ++  TIQA  +D+R  LY  IVLS
Sbjct: 304 TQKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLS 362

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           GGS+M+     RL+++L+ +   R+ +++    T+    +V++    R+++ V+ GG++L
Sbjct: 363 GGSTMFKDFGRRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLL 422

Query: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           A     K +   +K+++ E GP  +  F
Sbjct: 423 AQTAEFKSYCH-TKKDYEEYGPQIVRNF 449

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score =  168 bits (426), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 131/455 (28%), Positives = 210/455 (46%), Gaps = 80/455 (17%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRP----------------------------- 37
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQSSNTKKASSSSSSSAAALGPSNTGTSAN 68

Query: 38  -----------------------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISY 71
                                  +L     G   T   D  IG+EA   S+  SY  +SY
Sbjct: 69  SSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSY 127

Query: 72  PMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYD 131
           P+ +G + NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++
Sbjct: 128 PIRHGQVENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQIAEIFFESFN 186

Query: 132 FGGTYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDV 183
             G Y+A+QAVLAL A                       TH++PV E  V+    + + +
Sbjct: 187 CAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPI 246

Query: 184 AGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTT 238
           AGRD+T  +  LL  RG         +T  +IK++ CYV  D+       D   ++    
Sbjct: 247 AGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQF 303

Query: 239 LVESYELPDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSL 296
           +VE+ E    +V+ VG ERF APE  F P +   D   P +  ++ +TIQA  +D+R  L
Sbjct: 304 IVENQEQTRKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGL 362

Query: 297 YKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMV 353
           Y  IVLSGGS+M+     RL+++LK +   R+ +++    T+     V++    ++++ V
Sbjct: 363 YNNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAV 422

Query: 354 FIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           + GG++LA     K +   +K+++ E GP  +  F
Sbjct: 423 WFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 456

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score =  166 bits (421), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 126/451 (27%), Positives = 211/451 (46%), Gaps = 76/451 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRP----------------------------- 37
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSNSSGKSTGGGNTSSQSQANTSSGVIG 68

Query: 38  -------------------ILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYPMEN 75
                              +L     G   T   D  IG+EA   ++  +Y  +SYP+++
Sbjct: 69  SYFGNSTSATSFNNFASSLLLSNNLAGKRGTEDLDFYIGNEALTAAQGPAY-SLSYPIKH 127

Query: 76  GIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGT 135
           G + NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++  G 
Sbjct: 128 GQVENWNHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGL 186

Query: 136 YVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRD 187
           Y+A+QAVLAL A                       TH++PV E  V+    + + +AGRD
Sbjct: 187 YIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRD 246

Query: 188 VTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVES 242
           +T  +  LL  RG         +T  +IK++ CYV  D+       D  + + +  ++E+
Sbjct: 247 ITLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN 303

Query: 243 YELPDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLYKAI 300
                 +++ VG ERF APE  F P +   D   P +  ++ +TIQA  +D+R  LY  I
Sbjct: 304 QGKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYSNI 362

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGG 357
           VLSGGS+M+     RL+++L+ +   R+ +++    T+     V++    R+++ V+ GG
Sbjct: 363 VLSGGSTMFKDFGRRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGG 422

Query: 358 AVLANIMADKDHMWLSKQEWHEIGPAAMSKF 388
           ++LA     K +   +K+++ E GP  +  F
Sbjct: 423 SLLAQTAEFKSYCH-TKRDYEEYGPEIVRNF 452

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score =  165 bits (418), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 116/365 (31%), Positives = 190/365 (52%), Gaps = 28/365 (7%)

Query: 45  GHASTPLKDIMIGDEA---SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTT 101
           G   T   D  IG+EA   S+  SY  +SYP+ +G I NW  ME  W+ + F+ ++    
Sbjct: 97  GKRGTEDLDFYIGNEALIASQGPSY-SLSYPIRHGQIENWDHMERFWENSIFKYLR-AEP 154

Query: 102 SGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXX 161
                LLTEPP+NP +NREQ+ E+ FE ++  G Y+A+QAVLAL A              
Sbjct: 155 EDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTG 214

Query: 162 X--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVR 213
                    TH++PV E  V+    + + +AGRD+T  +  LL  RG A        T  
Sbjct: 215 TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAE 271

Query: 214 QIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRVIKVGPERFEAPECLFQPS 268
           +IK++ CYV  D+       D +  +    ++E+ +    +V+ +G ERF APE  F P 
Sbjct: 272 RIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIENQDKTKQKVVDIGYERFLAPEIFFNPE 331

Query: 269 LV--DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFT 326
           +   D   P +  ++ +TIQA  +D+R  LY  IVLSGGS+M+     RL++++K +  +
Sbjct: 332 IASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNS 390

Query: 327 RVLRNDP---TRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGPA 383
           R+++N+     +     V++    ++++ V+ GG++LA     K +   +K+++ E GP 
Sbjct: 391 RIIQNEAVTGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPE 449

Query: 384 AMSKF 388
            +  F
Sbjct: 450 IVRNF 454

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 7  IVLDQGTGFVKIGRAGENFPDYTFPSIVG 35
          IV+D GTG  K+G AG + P + FP+ + 
Sbjct: 9  IVMDNGTGLTKLGYAGNDSPSWIFPTSIA 37

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score =  161 bits (408), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 128/454 (28%), Positives = 205/454 (45%), Gaps = 79/454 (17%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFP----------------------------------- 31
           +V+D GTG  K+G AG + P + FP                                   
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIANAASSNAKNTASSSSTGGAGLAASSTGGSSA 68

Query: 32  ----------------SIVGRPILRAEERGHASTPLKDIMIGDEA---SEVRSYLQISYP 72
                           ++    ++     G   T   D  IG+EA   S+  +Y  ++YP
Sbjct: 69  ASNPYFTNATSTTNFGNLTTASLMSNNLSGKRGTEDLDFYIGNEALTASQGANY-SLNYP 127

Query: 73  MENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDF 132
           + +G + NW  ME  W+ + F+ ++         LLTEPP+NP +NREQ+ E+ FE ++ 
Sbjct: 128 IRHGQVENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNC 186

Query: 133 GGTYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVA 184
            G Y+A+QAVLAL A                       TH++PV E  V+    + + +A
Sbjct: 187 AGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSALKNIPIA 246

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTL 239
           GRD+T+ +  LL  RG          T  +IK++ CYV  D+       D    +    +
Sbjct: 247 GRDITQFIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYV 303

Query: 240 VESYELPDGRVIKVGPERFEAPECLFQPSLV--DVEQPGVGELLFNTIQAADVDIRTSLY 297
           VE+ +    +V+ +G ERF APE  F P +   D   P +  +L  TIQA  +D+R  LY
Sbjct: 304 VENQDKTRQKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVLDQTIQACPIDVRKGLY 362

Query: 298 KAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL---RNDPTRLDKFKVRIEDPPRRKHMVF 354
             IVLSGGS+M+     RL+++LK +   R+    R    R     V++    ++++ V+
Sbjct: 363 NNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAVW 422

Query: 355 IGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKF 388
            GG++LA     K +   +K+++ E GP  +  F
Sbjct: 423 FGGSLLAQTPEFKGYCH-TKKDYEEYGPEIVRNF 455

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 124/294 (42%), Gaps = 29/294 (9%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  T +++D G+    IG +G ++P    PS  G    +    G  ST  +  +  + + 
Sbjct: 12  DEITAVIIDPGSFSTNIGYSGTDYPQSILPSSYG--TYKETTEGQESTTKRKRIFSESSI 69

Query: 62  EV-RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
           ++ R   +I   +ENG I +W   +  W +A   Q+ L +TSG   LLTEP  N ++NR+
Sbjct: 70  QIPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQLHLQSTSGIPALLTEPIWNSVENRK 129

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +  E++ E  +F   Y++       +A G             T + PV + + L+  + R
Sbjct: 130 KSLEILLEGMNFEACYLSSVPTCVSFAAGRPNCLVVDIGHDTTSVSPVVDGMTLSKSSMR 189

Query: 181 LDVAGRDVT---------RHLIDLLS---RRGYAFNRTADF-------------ETVRQI 215
             +AG+ +          R +I L S   RR     RT D+             E  ++ 
Sbjct: 190 NFIAGKYINTLIEKYLQPREIIPLFSIKQRRPEFIKRTFDYTVDSSLYQYANEHEFFQEC 249

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPDGRVIKVGPE-RFEAPECLFQPS 268
           KE LC ++    L+    +  T    S E P    +    E RF   E LF P+
Sbjct: 250 KETLCQITSTGSLEKNKDQLKTISSRSIEAPWAEELVFENETRFGFGEELFVPN 303

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (53%), Gaps = 18/121 (14%)

Query: 264 LFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQL 323
           + +P+  D+   G+ +L+++ I  +DVD+R SL   +VL+GGSS  PGL  RL  EL + 
Sbjct: 382 ISEPTKNDI--AGLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNR- 438

Query: 324 WFTRVLRNDPTRLDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEI 380
                      RL   K RI        R++  ++GG++L + +     +W+ K E++E+
Sbjct: 439 -----------RLPALKFRILSTGHTKERQYQAWLGGSILTS-LGTFHQLWVGKNEYNEV 486

Query: 381 G 381
           G
Sbjct: 487 G 487

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 126/299 (42%), Gaps = 33/299 (11%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPL-KDIMIGDEA 60
           D  T IV+D G+    IG +G + P+   PS  G+    A+E     T +  +  IG   
Sbjct: 10  DEITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIG--- 66

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
              R   +I   +ENG I +W   +  WD+    ++ L + SG  VLLTEP  N ++NR+
Sbjct: 67  -LARPDYEIKRIVENGEIADWDTAQEQWDWVLKNELFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +  EV+ E  DF   Y++  +    +A G             T + PV + + L+  + R
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAGRPNCLVVDIGHDTTSVSPVIDGMTLSKSSTR 185

Query: 181 LDVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQ 214
             +AGR +  HLI+             + SRR     RT +++               ++
Sbjct: 186 NFIAGRYI-NHLIETYLKPREIIPLFAIESRRPEFKRRTFNYQVDDSLFTYGNERGFYQE 244

Query: 215 IKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRVIKVGPE-RFEAPECLFQPSLVDV 272
            KE LC +  +  L+      +T    S E P    I    E R+   E LF P   D+
Sbjct: 245 CKETLCQIIPNSTLEKSQDELSTMTKRSIEAPWAEEIVFDNEARYGFAEQLFSPHREDI 303

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 16/109 (14%)

Query: 276 GVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+ +L+  +I  +DVD+R SL   +V++GG+S  P L  RL  EL +            R
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSK------------R 457

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
           L   K RI        +++  ++GG++L + +     +W+ K+E+ E+G
Sbjct: 458 LPALKFRILTTGHLREKQYQAWLGGSILTS-LGTFHQLWVGKEEYKEVG 505

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 123/291 (42%), Gaps = 36/291 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+  L A+E        + I I  +  
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--LTADENSKKMFSEQSIGIPRKDY 69

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
           E++  +      ENG++ +W   +  W +A   ++ L + SG   LLTEP  N ++NR++
Sbjct: 70  ELKPII------ENGLVIDWDTAQEQWQWALRNELYLDSNSGIPALLTEPVWNSMENRKK 123

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + L+  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQI 215
            +AG+ +  HLI              +  R+     +  D++               ++ 
Sbjct: 184 FIAGKFIN-HLIQKALEPKEIIPLFAIKQRKPELIKKVFDYKVDKSLYDYANSRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELP-DGRVIKVGPERFEAPECLF 265
           KE LC++     L+   A  +TT   S E P +  +I     R+   E LF
Sbjct: 243 KETLCHICPTKPLEEAKAELSTTTKRSIESPWNEEIIFDNETRYGFAEELF 293

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 16/112 (14%)

Query: 273 EQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+  L++++I ++DVD+R +L   +VL+GG+S  PGL  RL  EL ++         
Sbjct: 380 ELAGLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKI--------- 430

Query: 333 PTRLDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
              L   K RI        R++  ++GG++L + +     +W+ KQE+ E+G
Sbjct: 431 ---LPSLKFRILTTGHIRERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 478

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 124/298 (41%), Gaps = 36/298 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+    A+E        + I I  +  
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--YTADEGNKKIFSEQSIGIPRKDY 69

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
           E++  +      ENG++ +W   +  W +A   ++ L + SG   LLTEP  N  +NR++
Sbjct: 70  ELKPII------ENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + L+  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQI 215
            +AG+ +  HLI              +  R+     +T D+E               ++ 
Sbjct: 184 FIAGKFI-NHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELP-DGRVIKVGPERFEAPECLFQPSLVDV 272
           KE LC++     L+      ++T   S E P +  ++     R+   E LF P   D+
Sbjct: 243 KETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLPKEDDI 300

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 16/119 (13%)

Query: 266 QPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWF 325
           +P   + E  G+ +L++++I ++DVD+R +L   +VL+GG+S  PGL  RL  EL ++  
Sbjct: 374 KPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKI-- 431

Query: 326 TRVLRNDPTRLDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
                     L   K RI        R++  ++GG++L + +     +W+ K+E+ E+G
Sbjct: 432 ----------LPSLKFRILTTGHTIERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 121/298 (40%), Gaps = 36/298 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+     + +    T   +  IG    
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSK----TIFSEQSIGIP-- 65

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
             R   ++   +ENG++ +W   +  W +A   ++ L + SG   LLTEP  N  +NR++
Sbjct: 66  --RKDYELKPIIENGLVIDWDTAQEQWQWALKNELYLDSNSGIPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + L+  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQI 215
            +AG+ +  HLI              +  R+     +  D+E               ++ 
Sbjct: 184 FIAGKFI-NHLIKKAIEPKEIIPLFAIKQRKPKLIKKIFDYEIDQSLYEYANNRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELP-DGRVIKVGPERFEAPECLFQPSLVDV 272
           KE LC++     L+   A    T   S E P +  ++     R+   E LF P   D+
Sbjct: 243 KETLCHICPTKTLEEAKAELNATTKRSIETPWNEEIVFDNETRYGFAEELFLPKKDDI 300

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 64/112 (57%), Gaps = 16/112 (14%)

Query: 273 EQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFT---RVL 329
           E  G+ +L++++I ++DVD+R +L   +VL+GG+S  PGL  RL  EL ++  +   R+L
Sbjct: 381 EITGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRIL 440

Query: 330 RNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
               TR             R++  ++GG++L + +     +W+ KQE+ E+G
Sbjct: 441 TTGHTR------------ERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 479

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 122/298 (40%), Gaps = 36/298 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+          A    K+I       
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKYT--------ADEGKKNIFSEQSIG 63

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
             R   ++   +++G++ +W   +  W +A   ++ L + SG   LLTEP  N  +NR++
Sbjct: 64  IPRKDYELKPIVKDGLVIDWDTAQEQWQWALKNELYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + L+  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFETVRQI------------- 215
            +AG+ +  HLI              +  R+     ++ ++E  + I             
Sbjct: 184 FLAGKFI-NHLIKKALEPKEIIPLFAIKQRKPELIKKSFNYEVDKSIYDYANNRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELP-DGRVIKVGPERFEAPECLFQPSLVDV 272
           KE LC++     L+   A  +TT   S E P +  ++     R+   E LF P   DV
Sbjct: 243 KETLCHICPTKTLEETKADLSTTTKRSIESPWNEEIVFDNETRYGFAEKLFLPKEDDV 300

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 63/114 (55%), Gaps = 16/114 (14%)

Query: 271 DVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLR 330
           D E  G+  L++++I ++DVD+R +L   +VL+GG+S+ PGL  RL  EL ++       
Sbjct: 379 DNELIGLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKI------- 431

Query: 331 NDPTRLDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
                L   K RI        R++  ++GG++L + +     +W+ K+E+ E+G
Sbjct: 432 -----LPSLKFRILTTGHTMERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 88/378 (23%), Positives = 146/378 (38%), Gaps = 70/378 (18%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65
           PIV+D G+  +K G A  N P +T  + + +         +    +KDI          S
Sbjct: 5   PIVIDNGSYEIKFGTASSNEP-FTALNSIAKDKYGNYHLSNQVRSIKDI----------S 53

Query: 66  YLQISYPMENGIIRNWADMELLWDYAFF-----EQMKLPTTSGGKVLLTEPPMNPIKNRE 120
            +  + P + G + +W     +WDY  F     +   L TT    ++ +E  M   +  +
Sbjct: 54  SVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSK 113

Query: 121 QMCEVMFEKYDFGGTYVA-IQAVLALYAQGLXXXXXXXXXXX------------------ 161
            M +V+FE+Y++   + A +   +   A+G                              
Sbjct: 114 NMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYE 173

Query: 162 --------XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVR 213
                    T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 174 LVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 231

Query: 214 QIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRVIKVG 254
            IKEK  ++S +   D+  +R  T   + Y LPD                    + I + 
Sbjct: 232 SIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQ 289

Query: 255 PERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPS 314
            E F  PE  F P +  +  PG+ E +  +I      +R  L   +V++GG+   P   S
Sbjct: 290 DELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFAS 349

Query: 315 RLEKELKQL----WFTRV 328
           RL  EL++     W  RV
Sbjct: 350 RLATELQRQCPTDWSCRV 367

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/371 (23%), Positives = 143/371 (38%), Gaps = 72/371 (19%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGHASTPLKDIMIGDEA 60
           TPI++D G+  VK G A  + P     ++     G P L      +  + LKDI      
Sbjct: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFE----QMKLPTTSGGKVLLTEPPMNPI 116
               S +Q   P E G + +W     +WDY  +       ++  T G  ++L+E  M+  
Sbjct: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108

Query: 117 KNREQMCEVMFEKYDFGGTYVA-IQAVLALYAQGLXXXXXXXXXXX-------------- 161
           +  +   +V+FE+Y+FG  +   +   +    Q L                         
Sbjct: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168

Query: 162 -----------XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFE 210
                       T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226

Query: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRVI 251
            V  IKEK  ++S     ++   +E TT    Y LPD                    + I
Sbjct: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284

Query: 252 KVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPG 311
           K+  E F  PE  F P +  + +PG+ E +  +I      IR  +    V++GG+     
Sbjct: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344

Query: 312 LPSRLEKELKQ 322
              RL  EL++
Sbjct: 345 FARRLATELQR 355

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 120/295 (40%), Gaps = 38/295 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  T +V+D G+    IG +G + P    PS  G+           +   KD +  +++ 
Sbjct: 12  DEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGK----------YTEGEKDELFSEQSI 61

Query: 62  EV-RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
            + R   +I   ++NG + +W   E  WD+A   +++  T SG   LLTEP  N  +NR+
Sbjct: 62  GLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRK 121

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +  EV+ E  DF   Y+   A    +A G             T + PV + + L+  + R
Sbjct: 122 KSLEVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIGHDVTSVCPVVDGMTLSKSSMR 181

Query: 181 LDVAG---RDVTRH---------LIDLLSRRGYAFNRTADFET-------------VRQI 215
             +AG    ++ R          L  +  RR     R  D+E               ++ 
Sbjct: 182 SYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEF 241

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPDG-RVIKVGPERFEAPECLFQPSL 269
           KE +  V+       K   ETT+   S E P G  ++    +R E  E LF P L
Sbjct: 242 KETMLQVAPTSISKFKSEIETTS-KRSIEAPWGEELVYDSLQRLEFAEQLFTPDL 295

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 65/110 (59%), Gaps = 12/110 (10%)

Query: 273 EQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +L++++I + DVD+RT+L   +V++GG+S  PGL  R+  EL         R+ 
Sbjct: 371 EVSGLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELN--------RSL 422

Query: 333 PTRLDKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
           P    KF++      R R++  ++GG++LA+ +     +W+ KQE+ E+G
Sbjct: 423 PAL--KFRMLTSGQLRERQYQGWLGGSILAS-LGTFHQLWVGKQEYAEVG 469

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 89/382 (23%), Positives = 142/382 (37%), Gaps = 77/382 (20%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGHASTPLKDIMIGDEA 60
           +P+++D G+  +K G   E  P     SI     G   L  + R      +KDI      
Sbjct: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52

Query: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFE-----QMKLPTTSGGKVLLTEPPMNP 115
               S +  + P E G + +W     +WDY  F         + TT G  ++ +E  M  
Sbjct: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108

Query: 116 IKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXX--------------- 160
            +  + M +V+FE+Y+F   + A   V   +  G                          
Sbjct: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168

Query: 161 -----------XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209
                        + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226

Query: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRV 250
             V  IKE   ++S +   ++  +R  T   + Y LPD                    + 
Sbjct: 227 ILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284

Query: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYP 310
           I +  E F  PE  F P +  +   G+ E +  +I      IR  +   IV++GG+   P
Sbjct: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344

Query: 311 GLPSRLEKELKQL----WFTRV 328
              SRL  EL++     W  RV
Sbjct: 345 NFASRLATELQRQCPTDWSCRV 366

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 83/366 (22%), Positives = 142/366 (38%), Gaps = 64/366 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65
           P+V+D G+  VK G +  + P +   + + R    A    +    +KDI          S
Sbjct: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53

Query: 66  YLQISYPMENGIIRNWADMELLWDYAFF-----EQMKLPTTSGGKVLLTEPPMNPIKNRE 120
            +    P E G + +W     +WDY FF     +   L  + G  ++ +E  M   +  +
Sbjct: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113

Query: 121 QMCEVMFEKYDFGGTYVA-----------IQAVLALYAQGLXXXXXXXXXXX-------- 161
            M +V+FE+Y+F     A            +    +  +G                    
Sbjct: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMV 173

Query: 162 ------XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215
                  T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRVIKVGPE 256
           KEK  ++S     D+  A++  T VE Y LPD                    + + +  E
Sbjct: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289

Query: 257 RFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRL 316
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349

Query: 317 EKELKQ 322
             EL++
Sbjct: 350 ATELQR 355

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 90/206 (43%), Gaps = 20/206 (9%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G      ++ G   T        DE++
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPHSILPSRYGSFKKTNKDSGDEDTK------SDESA 65

Query: 62  EVRSYL-------------QISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLL 108
             R+++             +I   +ENG + +W   +  W++A   ++ L +T G   LL
Sbjct: 66  TKRAHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNELFLESTKGIPALL 125

Query: 109 TEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPV 168
           TEP  N  KNR++  E + E  +F   Y+A  +    +A G               + PV
Sbjct: 126 TEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANCLVVDIGHDTCSVSPV 185

Query: 169 YESVVLNHLTRRLDVAGRDVTRHLID 194
            + + L+  TRR   AG+ +  HLI+
Sbjct: 186 VDGMTLSKSTRRSFFAGKYIN-HLIE 210

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 16/109 (14%)

Query: 276 GVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+ +L+ ++I A+DVD+R SL   + L+GG+S+ PGL  RL  EL              R
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELN------------AR 447

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
           L   K RI        R++  ++GG+VL + +     +W+ +QE+ E+G
Sbjct: 448 LPALKFRILTTGHKKEREYQSWLGGSVLTS-LGTFHQLWVGRQEYEEVG 495

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 139/362 (38%), Gaps = 60/362 (16%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65
           PIV+D G+  +K G      P   F + + R    +    +    +KDI          S
Sbjct: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53

Query: 66  YLQISYPMENGIIRNWADMELLWDYAFFEQ-----MKLPTTSGGKVLLTEPPMNPIKNRE 120
            +    P E G + +W     +WDY FF         L  + G  ++++E  M   +  +
Sbjct: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXX---------------------XXXXX 159
            M +V+FE+Y+F   + +  A  A + +                                
Sbjct: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173

Query: 160 XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231

Query: 220 CYVSYDLDLDTKLARETTTLVESYELPD-------------------GRVIKVGPERFEA 260
            +VS     ++   +E T +   Y LPD                    + +++  E F  
Sbjct: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289

Query: 261 PECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E +  ++      +R  +   IV +GG+   P   +RL  EL
Sbjct: 290 PETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349

Query: 321 KQ 322
           ++
Sbjct: 350 QR 351

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 91/369 (24%), Positives = 149/369 (40%), Gaps = 58/369 (15%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64
            PI++D G+  +K G +    P Y   + + R       R H S  +K I       EV 
Sbjct: 3   VPIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQI------REV- 51

Query: 65  SYLQISYPMENGIIRNWADMELLWDYAFFEQ----MKLPTTSGGKVLLTEPPMNPIKNRE 120
           S   +  P E G + +W   E +WDY  F        L  +    ++++E  M+  +  +
Sbjct: 52  SNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISK 111

Query: 121 QMCEVMFEKYDFG-------GTYVAIQ--AVLALY-AQGL----------XXXXXXXXXX 160
            M +V+FE+Y+FG         Y+     A   +Y + GL                    
Sbjct: 112 HMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171

Query: 161 XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229

Query: 221 Y---VSY--------DLDLDTKLARETTTLVESYELP------DGRVIKVGPERFEAPEC 263
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289

Query: 264 LFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQL 323
            F P + ++ +PG+ E +  +I      IR  +   I + GG+       SRL  EL++ 
Sbjct: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349

Query: 324 ----WFTRV 328
               W  RV
Sbjct: 350 CPTDWSVRV 358

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 84/376 (22%), Positives = 144/376 (38%), Gaps = 72/376 (19%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEV 63
             PIV+D G+  VK G +    P+    ++  +    A    +    +KDI         
Sbjct: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPT-----TSGGKVLLTEPPMNPIKN 118
            S + I  P E G + +W     +WDY FF   + P      T G  ++++E  M   + 
Sbjct: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111

Query: 119 REQMCEVMFEKYDF--------------------------GGTYVAIQAVLALYAQGLXX 152
              M +VMFE+Y+F                           G  V    +  + +Q +  
Sbjct: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171

Query: 153 -----XXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207
                          T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229

Query: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------- 247
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD                    
Sbjct: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287

Query: 248 -GRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGS 306
             +VI +  E F  PE +F P +  + +PG+ E +  ++      IR  L   IV  GG+
Sbjct: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347

Query: 307 SMYPGLPSRLEKELKQ 322
              P   SRL  EL++
Sbjct: 348 FNMPNFGSRLATELQR 363

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 86/372 (23%), Positives = 140/372 (37%), Gaps = 72/372 (19%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64
           TP+V+D G+  VK G A    P Y   + +      A    +    +KDI          
Sbjct: 4   TPVVIDNGSYRVKFGPASLEAP-YCALNAIANDKYDASYLSNQIKSIKDI---------- 52

Query: 65  SYLQISYPMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPIKNR 119
           S + I  P   G + +W    L+WDY       F    +  T    ++ +E  M   +  
Sbjct: 53  SSVSIKRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112

Query: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXX---------------------- 157
           + M +V+FE+Y+FG     +++ +A Y   L                             
Sbjct: 113 KNMDQVIFEEYEFGS---LMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169

Query: 158 -----XXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETV 212
                     T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227

Query: 213 RQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD----------------------GRV 250
             IKEK  +VS     D+   ++ T+    Y LPD                       + 
Sbjct: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285

Query: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYP 310
           I +  E F  PE  F P +  + +PG+ E +  ++      IR  +   I+  GG+   P
Sbjct: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345

Query: 311 GLPSRLEKELKQ 322
              SR+ KEL++
Sbjct: 346 HFASRVAKELQR 357

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 113/297 (38%), Gaps = 27/297 (9%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  T +V+D G+    IG +G + P    PS  G         G        +      +
Sbjct: 12  DEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLT 71

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
             R   +I   +ENG++ +W   +  WD+A    + L +  G   L+TE   N ++N+ +
Sbjct: 72  FPRPDYEIKPIVENGLVVDWDAAQEQWDWALRNVLHLESNKGVPALMTESIWNTMENKTK 131

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E  DF   Y++       +A G                 PV + + L+  TRR 
Sbjct: 132 SLEVLLETLDFEACYISSTPTCVSFATGRPNCLVVDVGHDTASSSPVVDGMTLSRSTRRN 191

Query: 182 DVAGRDVT---------RHLIDL---------LSRRGYAFN---RTADFETVR----QIK 216
            ++G+ V          R +I L           ++ + FN      +F   R    + K
Sbjct: 192 FISGKFVDQLIGKYLQPREIIPLFEIAQRRPEFKKKNFEFNIDPSLYNFANERGFFQECK 251

Query: 217 EKLCYVSYDLDLDTKLARETTTLVESYELP-DGRVIKVGPERFEAPECLFQPSLVDV 272
           E LC ++    LD       +T   S E P    ++   P R+   E LF P   D+
Sbjct: 252 ETLCQIA-PTTLDKFKPELESTAKRSIEAPWTEEIVFDNPSRYGFAEQLFYPQSEDI 307

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (53%), Gaps = 16/112 (14%)

Query: 273 EQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +L+ ++I +ADVD+R +L   IVL+GGSS  PG   RL  EL +          
Sbjct: 375 ELAGISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTK---------- 424

Query: 333 PTRLDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
             +L   K R+        R++  ++GG++L + +     +W+ K+E+ E+G
Sbjct: 425 --KLPALKFRVLTTGHLRERQYQSWLGGSILTS-LGSFHQLWVGKREYEEVG 473

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/364 (23%), Positives = 138/364 (37%), Gaps = 66/364 (18%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+D G+  +K G +G + P      +      R     + +  ++DI          S 
Sbjct: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKL-------PTTSGGKVLLTEPPMNPIKNR 119
             I  P E G + +W     +WDY F+ +            T    ++++E  M   +  
Sbjct: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114

Query: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXX------------------X 161
           + M +V+FE+YDF   +    A    + QG                              
Sbjct: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174

Query: 162 XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232

Query: 222 V---SYDLDLDTKLARETTTLVESYELPD------GRVIKVGPER--------------F 258
           V   SY      K+     T VE Y LPD      G V K G E+              F
Sbjct: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVF 287

Query: 259 EAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEK 318
             PE  F P +  + +PG+ E +   I      +R  L   IV +GG+   P    RL+ 
Sbjct: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347

Query: 319 ELKQ 322
           EL++
Sbjct: 348 ELQR 351

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 124/302 (41%), Gaps = 37/302 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA---------EERGHASTPLK 52
           D  + +V+D G+    IG +G + P    PS  G   L+          EE   ++   K
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSK 71

Query: 53  DIMIGDEASEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPP 112
            I      +  R+  +I   ++NG + +W   +  WD+A    + L + SG    LTEP 
Sbjct: 72  KIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPI 131

Query: 113 MNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESV 172
            N ++NR++  EV+ E   F   Y++       +A G               + PV + +
Sbjct: 132 WNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNCLVVDIGHDVASVSPVIDGM 191

Query: 173 VLNHLTRRLDVAGRDVTRHLIDLL------------SRRGYAFNRTADF---ETV----- 212
            L+  + R  ++GR +   + + L             R+     +T DF   ++V     
Sbjct: 192 TLSKSSMRNFISGRFINEKIKEFLKPREIIPLFEVKQRKPEFIKKTFDFPIHQSVYDYAN 251

Query: 213 -----RQIKEKLCYVSYDLDLDTKLARETTTLVE-SYE-LPDGRVIKVGPERFEAPECLF 265
                ++ KE LC ++    LD K+A E  +L + SYE L    ++     R+   E LF
Sbjct: 252 DHGIFQECKETLCQIAPTAALD-KMAPELESLAKRSYETLWKEDIVFDNVTRYSFAEHLF 310

Query: 266 QP 267
            P
Sbjct: 311 VP 312

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 18/111 (16%)

Query: 275 PGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSR----LEKELKQLWFTRVLR 330
           PG+ +L+ ++I A DVD+R SL   IVL+GG+S  PG   R    L K+L  L F RVL 
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKF-RVLT 453

Query: 331 NDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
              TR             R++  ++GG++L++ +     +W+ KQE+ E G
Sbjct: 454 TGQTR------------ERQYQAWLGGSILSS-LGTFHQLWVGKQEYEESG 491

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 112/297 (37%), Gaps = 30/297 (10%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G      +  G      K +       
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKK----KKVFSEQSIC 67

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
             R   +I   +ENG++ +W   +  W +A   Q+ L + SG   LLTEP  N ++NR++
Sbjct: 68  IPRKDYEIKPIVENGVVIDWDAAQEQWSWALENQLYLRSNSGIPALLTEPIWNTVENRKK 127

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             E++ E  DF   Y+A       +  G               + PV + + L+  T+R 
Sbjct: 128 SLELLLEGMDFEACYLASTPTCVSFGTGRSSCLVVDLGHDTCSVSPVVDGMTLSKSTKRN 187

Query: 182 DVAGRDVTRHLIDLLS------------RRGYAFNRTADFET-------------VRQIK 216
             AG  +   + + +S            RR     +  +F                ++ K
Sbjct: 188 FFAGGYLNELIKNYISPEKIIPLFAIDKRRPELKKKVFEFPVHESLYKYANDRGIFQECK 247

Query: 217 EKLCYVSYDLDLDTKLARETTTLVESYELP-DGRVIKVGPERFEAPECLFQPSLVDV 272
           E LC V+    LD   +   T    S E P    +I     R+   E LF P   DV
Sbjct: 248 ETLCQVAAPSTLDKMKSELATVAKRSIETPWTEEIIFDNETRYGFAEQLFLPRKEDV 304

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 16/109 (14%)

Query: 276 GVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           GV +L+ ++I A+DVD+R +L   +VL+GG+S  PGL  RL  EL             +R
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELN------------SR 427

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
           L   K R+        R++  ++GG+VL + +     +W+ K+E+ ++G
Sbjct: 428 LPALKFRMITTGHTRERQYQSWLGGSVLTS-LGTFHQLWVGKEEYQDVG 475

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 65/111 (58%), Gaps = 18/111 (16%)

Query: 275 PGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSR----LEKELKQLWFTRVLR 330
           PG+ +L+ ++I AADVD+RTSL   +VL+GG+S  PGL  R    L K L  L F RVL 
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKF-RVLA 455

Query: 331 NDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
           N  TR             R++  ++GG++L++ +     +W+ KQE+ EIG
Sbjct: 456 NGQTR------------ERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEIG 493

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 106/268 (39%), Gaps = 40/268 (14%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVG-------------RPILRAEERGHAS 48
           D    +V+D G+    IG +G ++P    PS  G             +P   A      +
Sbjct: 12  DEICAVVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENA 71

Query: 49  TPLKDIMIGDEAS--EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKV 106
           + +K   + +E S    R+  +I   ++NG + +W   +  W +A   ++ L +  G   
Sbjct: 72  SKIKIRKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENELFLKSNEGVPA 131

Query: 107 LLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIV 166
           LLTEP  N ++NR++  EV+ E   F   Y++       +A G               + 
Sbjct: 132 LLTEPIWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAGRSNCLVVDIGHDIISVS 191

Query: 167 PVYESVVLNHLTRRLDVAGRDVTRHLIDLL------------SRRGYAFNRTADFE---- 210
           PV + +  +  TRR  ++G+ +   + D L             R+     +T DF     
Sbjct: 192 PVVDGMTFSKSTRRNVISGKYLNVLINDFLKPREIVPLFEIKQRKPTLVKKTFDFPIHDS 251

Query: 211 ---------TVRQIKEKLCYVSYDLDLD 229
                      ++IKE LC VS +  L+
Sbjct: 252 LKTYANDRGIYQEIKEALCRVSPNSSLE 279

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 88/388 (22%), Positives = 150/388 (38%), Gaps = 78/388 (20%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR- 64
           P++++ G+  +K G A    P         R  L  +  G          + ++  ++R 
Sbjct: 4   PLLMENGSYEIKFGPANLETP------YRARNCLTRDRYGRYH-------LSNQMDQIRD 50

Query: 65  -SYLQISYPMENGIIRNWADMELLWDYAFFE----QMKLPTTSGGKVLLTEPPMNPIKNR 119
            S+  I  P E G + +W   E +WDY  F       +L  +    ++ +E  M   +  
Sbjct: 51  ISHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEIS 110

Query: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGL-------------------XXXXXXXXXX 160
           + M +V+FE+Y+FG       A    + +                               
Sbjct: 111 KNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGF 170

Query: 161 XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220
             T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C
Sbjct: 171 NCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCC 228

Query: 221 Y---VSYDLDLDTKLARETTTLVESYELPD-------------------GRVIKVGPERF 258
           +   VSY    D+   R+  T VE Y LPD                    +++++  E F
Sbjct: 229 FMPPVSY---FDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELF 283

Query: 259 EAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEK 318
             PE  F P + ++ +PG+ E +   +      +R  L   IV  GG+       +RL  
Sbjct: 284 TVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLAT 343

Query: 319 ELKQLWFTRVLRNDPTRLDKFKVRIEDP 346
           EL+        R  PT    +KVR+  P
Sbjct: 344 ELQ--------RQCPT---DWKVRVHQP 360

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 85/198 (42%), Gaps = 7/198 (3%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G+     +E   +      IM      
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFMIM------ 65

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
             R   +I   +ENG + +W   +  W +A  +++K  +  G    LTE   NP +NR++
Sbjct: 66  -PRPDFEIKRILENGCVVDWEAAQEQWAWAIRDELKFESFKGTPAFLTEAIWNPEENRKK 124

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E  +F   Y+A  A    +A G               + PV + + L+  + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCTSFAMGRPTCLVLDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGRDVTRHLIDLLSRR 199
            +AG+ + + + + L  R
Sbjct: 185 FLAGKLLNKLIENHLKPR 202

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 16/109 (14%)

Query: 276 GVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+ +L+   I A DVD+R +L   +V++GGSS  PGL  RL  EL +            +
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNK------------K 423

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
           L   K RI        R+   ++GG++L++ +     +W+ +QE+ E+G
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVG 471

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/367 (21%), Positives = 142/367 (38%), Gaps = 65/367 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65
           P+++D G+  +K G + +  P +   + + +         +    +KDI          S
Sbjct: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI----------S 53

Query: 66  YLQISYPMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
            + I  P + G + +W     +WDY F     F+  ++   S   ++LTE PM   +   
Sbjct: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTH---------------- 164
              +V+FE+Y F   Y A  A    + +              T+                
Sbjct: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173

Query: 165 --------IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIK 216
                   I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  IK
Sbjct: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNIK 231

Query: 217 EKLCYVSYDLDLDTKLARETTTLVESYELPDGRVIKVG---------------------P 255
           E   ++S  +       ++  T VE Y LPD +   +G                      
Sbjct: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289

Query: 256 ERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSR 315
           E F  PE  F P + +V +PG+ E +  ++      +R+ +   IV +GG+   P   SR
Sbjct: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349

Query: 316 LEKELKQ 322
           +  EL++
Sbjct: 350 IYTELQK 356

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 98/234 (41%), Gaps = 10/234 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           DPH PI +D G+  ++ G   +  P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPHVPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTS-GGKVLLTEPPMNPIKNRE 120
            VRS  Q   P +   + NW   E + DY F      P       +LLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVSPNNGVRNPILLTERMATVQSQRA 148

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLNHL 177
              ++MFE Y+  G    I ++   Y Q   G             T+++PV +   +   
Sbjct: 149 NWYQIMFETYNVPGVTFGIDSLYGFYNQNTSGNKTGLVIDCGHEDTNVIPVVDGTGVLTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
            +R++  GR    +L DL++ +   F     +     + +  CYVS + D D K
Sbjct: 209 AKRINWGGRQAVDYLSDLMALKYPYFPTKLSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 59/139 (42%), Gaps = 28/139 (20%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEL-------LFNTIQAADVDIRTSLYKAIVLSGGSSM 308
           ER   PE +FQP+L   +Q G+ EL        F +           +   + ++GG+S 
Sbjct: 617 ERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFITGGNSK 676

Query: 309 YPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
            PGL  R+ +E  +       F+  + +DP+ LD +K               G A LA  
Sbjct: 677 VPGLRERIVREFTEFLPVGTNFSVNMSSDPS-LDAWK---------------GMAALAQN 720

Query: 364 MADKDHMWLSKQEWHEIGP 382
             +     +SK+E+ E GP
Sbjct: 721 KEEYKKTVISKKEYEEYGP 739

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 82/203 (40%), Gaps = 6/203 (2%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  T +++D G+    IG AG + P    PS  G  I  AEE        K        S
Sbjct: 12  DEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGE-IHEAEESTSEDNTEKTRKTRKVFS 70

Query: 62  EV-----RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPI 116
           E      R   ++   +ENG + +W      W +A   ++ + +  G   +LTEP  N  
Sbjct: 71  EQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNELHIESNRGIPAMLTEPLWNSK 130

Query: 117 KNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNH 176
           +NR +  E++ E  +F   Y+   +    +A G               + PV + + L+ 
Sbjct: 131 ENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPNSLIVDIGHDIASVTPVIDGMSLSK 190

Query: 177 LTRRLDVAGRDVTRHLIDLLSRR 199
            TR    AGR + + L D L  R
Sbjct: 191 STRCNHFAGRFLNKLLTDYLKPR 213

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 63/110 (57%), Gaps = 12/110 (10%)

Query: 273 EQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E PG+ +L+ ++I + DVDIR SL   +V++GGSS  PGL  R+  EL  + F  +    
Sbjct: 385 ELPGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNEL-NMKFPAL---- 439

Query: 333 PTRLDKFKVRIEDPP-RRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
                KF+V        R++  ++GG++L++ +     +W+ K+E+ E+G
Sbjct: 440 -----KFRVLATGQSIERQYQSWLGGSILSS-LGTFHQLWIGKKEYEEVG 483

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 110/244 (45%), Gaps = 33/244 (13%)

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+P+ + V      ++LD+ GR +T  L + LS R Y  +   +   V  IKEK  +V
Sbjct: 201 TWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHY--DLMDETLLVNNIKEKCLFV 258

Query: 223 SYDLDLDTKLARETTTL-----------------VESYELPDG-RVIKVGPERFEAPECL 264
           S     D+  A+E T++                  +S  LP+G +V+K+  E F  PE  
Sbjct: 259 SPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETF 318

Query: 265 FQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLW 324
           F P +  + +PG+ E +  ++      +R  L   IV +GG+   P   +RL  EL+   
Sbjct: 319 FHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFAARLAAELQ--- 375

Query: 325 FTRVLRNDPTRLDKFKVRIEDPPRRKHMV-FIGGAVLANIMADKDHMWLSKQEWHEIGPA 383
                R  PT    +  RI  P +   +  +      AN  + K    +SK+E++E GP 
Sbjct: 376 -----RQLPT---DWTCRISVPKKECELFSWKSMCQFANTDSYKKTR-ISKEEYYEHGPD 426

Query: 384 AMSK 387
            ++K
Sbjct: 427 WLTK 430

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 16/142 (11%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64
           TP+VLD G+  +K G +    P   + ++ G  + +     + S  +K I    E SEV 
Sbjct: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV- 55

Query: 65  SYLQISYPMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPIKNR 119
               +  P E G + +W     +WDY       F+  +L  +    ++++EP M   +  
Sbjct: 56  ---TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112

Query: 120 EQMCEVMFEKYDFGGTYVAIQA 141
           + M +V+FE+Y+F   + A  A
Sbjct: 113 KNMDQVIFEEYEFDSLFKAPTA 134

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 99/247 (40%), Gaps = 30/247 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  T +V+D G+    IG +G + P    PS  G    +AE   +A    K I       
Sbjct: 12  DEITAVVIDPGSFSTNIGFSGTDCPQAILPSCYGEQ--KAETEDNAP---KKIFAEQSIG 66

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
             R   +I   ++N ++ +W   E  W +A  + + L + SG   LLTEP  N ++N+ +
Sbjct: 67  IPRPDYEIKPIVQNSMVVDWDAAEEQWSWALKDILYLNSNSGIPALLTEPIWNTLENKTK 126

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             E++ E   F   Y++       +A G             T + PV + + L+  T R 
Sbjct: 127 SLEILLESLQFEACYLSSTPTCVSFASGRPNCLVVDLGHDTTSVSPVVDGMTLSKSTMRN 186

Query: 182 DVAGRDVTR------------HLIDLLSRRGYAFNRTADFET-------------VRQIK 216
            +AG  +               L ++  R+     +T D++              +++ K
Sbjct: 187 FLAGNCINELIKKPLKGKDLVPLFEIAQRKPEFKKKTFDYQIHPSLYNYANSRGFLQECK 246

Query: 217 EKLCYVS 223
           E LC V+
Sbjct: 247 ETLCQVA 253

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 62/121 (51%), Gaps = 16/121 (13%)

Query: 265 FQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLW 324
            + S+   +  G  +L+  +I A+DVD+R +L   IVL+GG+S  PG   RL  EL +  
Sbjct: 364 LEESVTGSDIAGAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSELNK-- 421

Query: 325 FTRVLRNDPTRLDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
                     +L   K RI        R++  ++GG++L + +     +W+ KQE+ E+G
Sbjct: 422 ----------KLPALKFRILTTGHLRERQYQAWLGGSILTS-LGSFHQLWVGKQEYEEVG 470

Query: 382 P 382
           P
Sbjct: 471 P 471

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 97/234 (41%), Gaps = 10/234 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           DPH PI +D G+  ++ G   +  P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPHLPIAIDFGSSRLRAGFVNQATPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTS-GGKVLLTEPPMNPIKNRE 120
            VRS  Q   P +   + NW   E + DY F     LP       +LLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVLPNNGISNPILLTERMATVQSQRA 148

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLNHL 177
              +++FE Y+  G    I ++ + Y     G             T +VP+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYSFYNNNPSGNKTGLVIDCSHEDTSVVPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
            +R++  G     +L DL++ +   F     +     + +  CYVS + D D K
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 65/149 (43%), Gaps = 18/149 (12%)

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGEL-------LFNTIQAADVDIR 293
           +S  + +   + +  ER   PE +FQP++   +Q G+ EL        F + +       
Sbjct: 602 DSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTS 661

Query: 294 TSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
             +   I+++GG++  PGL  R+ KE     FT  L   P   +   V I   P      
Sbjct: 662 LDMVNNILITGGNAKVPGLRERIVKE-----FTEFL---PVGTN-VAVNISSNPSLD--A 710

Query: 354 FIGGAVLANIMADKDHMWLSKQEWHEIGP 382
           + G A LA   A+     +SK+E+ E GP
Sbjct: 711 WRGMAALARNKAEYKKTVISKEEYEEYGP 739

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 81/386 (20%), Positives = 134/386 (34%), Gaps = 84/386 (21%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65
           PIV+D G+  +K G +    P     ++       +    H    +KDI          S
Sbjct: 5   PIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKN-IKDI----------S 53

Query: 66  YLQISYPMENGIIRNWADMELLWDYAFFEQMK-----LPTTSGGKVLLTEPPMNPIKNRE 120
            +    P E G +  W     +WDY FF  ++     L    G  ++ +E  M   +  +
Sbjct: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXX-------------------- 160
              +V+FE+Y+F   + +  A    + +                                
Sbjct: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173

Query: 161 ----------------------XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198
                                   T I+PV + +      ++LDV GR +T  L + LS 
Sbjct: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233

Query: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD----------- 247
           R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD           
Sbjct: 234 RHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVRN 289

Query: 248 -----------GRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSL 296
                       + I +  E F  PE  F P +  + +PG+ E +  ++      +R  +
Sbjct: 290 RRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLM 349

Query: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322
              IV +GG+   P    RL  EL++
Sbjct: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 96/236 (40%), Gaps = 27/236 (11%)

Query: 64  RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMC 123
           RS  Q+   +ENG++ +W   E  W +A  E++ + +  G   LLTEP  N ++NR++  
Sbjct: 156 RSDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSFKGIPALLTEPVWNTVQNRKKSL 215

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           EV+ EK +F   Y+        +A G               + PV + + L    RR   
Sbjct: 216 EVLLEKMEFEACYLTTIPTNVSFAAGKPNCLVVDVGHDTCSVSPVIDGMTLTKSVRRNFF 275

Query: 184 AGRDVTRHLIDLL------------------SRRGYAFN-------RTADFETVRQIKEK 218
           AGR + R L + +                   R+ + FN          D +  ++ KE 
Sbjct: 276 AGRYLNRLLENYIKPREIIPLFMVEKRRPEFKRKIFDFNIDPSVISYANDHQFFQECKET 335

Query: 219 LCYVSYDLDLDTKLARE-TTTLVESYELPDGRVIKVGP-ERFEAPECLFQPSLVDV 272
           LC +  +      +  E  ++   S E P G  I+     RF   E LF P+  ++
Sbjct: 336 LCQIYPNNSFLANVKDELESSAKRSIEAPWGEKIEFDNMTRFGFAEELFNPNESNI 391

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 64/116 (55%), Gaps = 16/116 (13%)

Query: 275 PGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPT 334
           PG+ +L+  T+ ++DVD+R +L   ++L+GG+S+ PGL  RL  EL +            
Sbjct: 490 PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADRLMYELNK------------ 537

Query: 335 RLDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSK 387
           +L   K RI        RK+  ++GG++L + +     +W+ K+E+ E+GP  + K
Sbjct: 538 KLPALKFRILSSGHRRERKYQAWLGGSILTS-LGTFHQLWVGKREYEEVGPDRLLK 592

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 82/192 (42%), Gaps = 9/192 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D    IV+D G+    IG +G + P    PS  G      E  G      K I       
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGN----VETDGDT----KRIFNEQPLL 63

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
             R+ ++I   +EN  I +W   +  W+YA    +K  +  G  VLLTEP  N   +R++
Sbjct: 64  FPRAGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKK 123

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             E++ E  +F   Y+A  +    +A G             + + PV + + L+  + R 
Sbjct: 124 SLEILLESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTLSKSSTRN 183

Query: 182 DVAGRDVTRHLI 193
            VAG+ +  HLI
Sbjct: 184 YVAGKYLN-HLI 194

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 64/119 (53%), Gaps = 18/119 (15%)

Query: 273 EQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSR----LEKELKQLWFTRV 328
           E  G+ +L+  ++  ADVD+R +L   +VL+GG+S  PGL  R    L K L  L F R+
Sbjct: 412 EVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKF-RM 470

Query: 329 LRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSK 387
           L +   R             R++  ++GG++LA+ +     +W+ ++E+ E+GP  + K
Sbjct: 471 LSSGHLR------------ERQYQGWLGGSILAS-LGTFHQLWVGREEYEEVGPERLLK 516

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 80/185 (43%), Gaps = 7/185 (3%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G+     E+ G  S    D  +G    
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQ-YTGGEKEGKKS--FNDQFMG---- 64

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQ 121
             R   +I   +E+G + +W   +  W +A  +++K  +  G    LTE   N  +NR++
Sbjct: 65  MARPDFEIKRILEDGCVVDWEAAQEQWTWAIRDELKFGSFKGTPAFLTEAIWNSEENRKK 124

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E  +F   Y+A  A    +A G               + PV + + L+  + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCVSFAMGRPTCLVVDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGR 186
            +AG+
Sbjct: 185 FLAGK 189

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 56/115 (48%), Gaps = 16/115 (13%)

Query: 276 GVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+  L+   I   DVD+R +L   +V++GGSS   GL  RL  EL +            +
Sbjct: 376 GLANLVNTAIMETDVDLRATLAHNLVVTGGSSSILGLADRLMTELNK------------K 423

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSK 387
           L   K RI        R+   ++GG++L++ +     +W+ +QE+ E+G   + K
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 81/372 (21%), Positives = 142/372 (38%), Gaps = 72/372 (19%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64
           +PI +D G+  +K G    + P   + +I    I    ++ H +       + ++   ++
Sbjct: 4   SPIAIDNGSYEIKFGTTDLSSP---YRAINAFAI----DKYHTT------YLSNQIKNIK 50

Query: 65  SYLQISY--PMENGIIRNWADMELLWDYAFFEQMKLP-----TTSGGKVLLTEPPMNPIK 117
               +++  P E G + +W     +WDYA F   + P        G  ++ +E  M   +
Sbjct: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110

Query: 118 NREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXX----------------- 160
             + M +V+FE+Y+F   Y +  A    +A                              
Sbjct: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170

Query: 161 ----------XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209
                       T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228

Query: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRV 250
             V  IKE   +VS     D+    +  T VE Y LP+                    + 
Sbjct: 229 -LVNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQT 285

Query: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYP 310
           IK+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P
Sbjct: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345

Query: 311 GLPSRLEKELKQ 322
              +RL  EL++
Sbjct: 346 HFATRLTSELQR 357

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 100/241 (41%), Gaps = 12/241 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           DP  PI +D G+  ++ G   ++ P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPQLPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTS-GGKVLLTEPPMNPIKNRE 120
            VRS  Q   P +   + NW   E + DY F     +P       +LLTE        R 
Sbjct: 92  -VRS--QSKSPFDGPFVTNWNFTEEILDYTFHHLGIVPENGISNPILLTERMATVQSQRA 148

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLNHL 177
              +++FE Y+  G    I ++   Y     G             T+++P+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYGFYNYYPSGKQTGLVIDCGHEDTNVIPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVS--YDLDLDTKLARE 235
            +R++  G     +L DL++ +   F     +     + +  CYVS  YD D+D  L  E
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSRNYDEDVDKILTLE 268

Query: 236 T 236
            
Sbjct: 269 N 269

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 62/154 (40%), Gaps = 28/154 (18%)

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIR 293
           +S  + +   + +  ER   PE +FQP++   +Q G+ EL        F +         
Sbjct: 602 DSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTS 661

Query: 294 TSLYKAIVLSGGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPR 348
             +   + ++GG++  PGL  R+ KE              + +DP+ LD +K        
Sbjct: 662 IDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININMSSDPS-LDAWK-------- 712

Query: 349 RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGP 382
                  G A LA    +     +S++E+ E GP
Sbjct: 713 -------GMAALAQNEEEYKRTIISRKEYEEYGP 739

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 86/373 (23%), Positives = 139/373 (37%), Gaps = 66/373 (17%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERG--HASTPLKDIMIGD 58
           M     IV+D G+  VK G A E  P       V    L  ++ G  H S  +++I   D
Sbjct: 1   MTADQAIVIDNGSYQVKFGLASEVRPR------VALNALAKDKYGVTHLSNQVQNIK--D 52

Query: 59  EASEVRSYLQISYPMENGIIRNWADMELLWDYAFFE----QMKLPTTSGGKVLLTEPPMN 114
            +S V        P E G + +W     +WDY  +      +   +     V+L+E  M 
Sbjct: 53  ISSVV-----FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107

Query: 115 PIKNREQMCEVMFEKYDFGGTYVA-IQAVLALYAQGLXXXXXXXXX-------------- 159
             +  +   +V+FE+Y+    Y A   A +  Y                           
Sbjct: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167

Query: 160 -------------XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRT 206
                           T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225

Query: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTTLVESYE-------------LPD-GR 249
            +   V  IKE+  YV   SY      K   +   ++  ++             LPD  +
Sbjct: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285

Query: 250 VIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMY 309
           ++ +  ERF  PE  F P +    +PG+ E +  +I      +R  +   IV  GG+   
Sbjct: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345

Query: 310 PGLPSRLEKELKQ 322
           PG   RL  EL++
Sbjct: 346 PGFTDRLVSELQR 358

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 89/383 (23%), Positives = 136/383 (35%), Gaps = 75/383 (19%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65
           P V+D G+  +K G A    P      I       +    H  T ++DI          S
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKT-IRDI----------S 51

Query: 66  YLQISYPMENGIIRNWADMELLWDYAFFEQMKLP------TTSGGKVLLTEPPMNPIKNR 119
              I  P E G + +W     +WDY  +   +         T    ++LTE      +  
Sbjct: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111

Query: 120 EQMCEVMFEKYDFG----------------------------GTYVAIQAVLALYAQGLX 151
           +   +V+FE+Y+F                              T V      A   +   
Sbjct: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRD 171

Query: 152 XXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211
                      T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229

Query: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD--------------------GRV- 250
           +  IKEK  +VS     D+   ++   +   Y LPD                    G V 
Sbjct: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287

Query: 251 -IKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMY 309
            I +  ERF  PE  F P + ++ +PG+ E +   I      +R  L   IV  GG+   
Sbjct: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347

Query: 310 PGLPSRLEKEL-KQL---WFTRV 328
           P + SRL  EL +QL   W  RV
Sbjct: 348 PHMSSRLTSELQRQLPTDWTCRV 370

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 94/231 (40%), Gaps = 17/231 (7%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           DP+ PI +D G+  V+ G   ++ P + F + + R   R + R           IG++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLT-------FIGNDTN 86

Query: 62  ---EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSG--GKVLLTEPPMNPI 116
               VRS  Q   P +  I+ NW   E + +Y F   + +    G    +L+TE      
Sbjct: 87  LDLSVRS--QAKSPYDGAIVSNWDYTEEIMEYTFH-HLGVNGNDGVSNPILMTEKLATLQ 143

Query: 117 KNREQMCEVMFEKYDFGGTYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVL 174
             RE   +++FE +        I ++ + YA                 TH++PV     +
Sbjct: 144 SQRENWYQLLFECFGVPQVTFGIDSLFSFYANNDATASGLVINSGNEDTHVIPVMNGKGV 203

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 225
               +R++  GR    +L +LL+ +   F         + + E  CYVS D
Sbjct: 204 LSEAKRINWGGRQSVEYLSNLLALKYPYFPIKPSTHQFQSLYEDFCYVSVD 254

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIR 293
           +S  + +   + +  ER   PE +FQPS+  ++Q GV E+        F + ++   +  
Sbjct: 594 DSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGS 653

Query: 294 TSLYKAIVLSGGSSMYPGLPSRLEKEL 320
             L   + L+GG+   PG+  R+ +E 
Sbjct: 654 KKLAANVFLTGGNMRLPGVRERIVREF 680

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 78/185 (42%), Gaps = 10/185 (5%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D  T I++D G+    IG +G + P    PS  G+ I   E         K  +  +++ 
Sbjct: 12  DEITAIIIDPGSFNTNIGYSGTDCPQAILPSCYGQYINDEE---------KPSLFNEQSI 62

Query: 62  EV-RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
            + R   +I   + +G + +W   +  W++A    +   +  G   LLTEP  N   NR+
Sbjct: 63  GLPRKDYEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLFESNKGLPALLTEPIWNSEDNRK 122

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +  EV+ E  DF   Y+   A    +A G             T + PV + + L+  + R
Sbjct: 123 KSLEVLLEGMDFEACYLTPTATAVSFAMGRPTCLVVDIGHDITSVSPVIDGMTLSKSSMR 182

Query: 181 LDVAG 185
             +AG
Sbjct: 183 SFIAG 187

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 61/110 (55%), Gaps = 12/110 (10%)

Query: 273 EQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +L+ ++I + DVD+RT+L   +V++GGSS  PGL  R+  EL          N 
Sbjct: 372 EISGLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAEL----------NK 421

Query: 333 PTRLDKFKVRIEDPPRRK-HMVFIGGAVLANIMADKDHMWLSKQEWHEIG 381
                KF++      R K +  ++GG++LA+ +     +W+ KQE+ E+G
Sbjct: 422 SLPALKFRMLTSGQAREKQYQSWLGGSILAS-LGTFHQLWVGKQEYAEVG 470

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 79/387 (20%), Positives = 131/387 (33%), Gaps = 84/387 (21%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64
           +PIV+D G+  +K   +    P     ++       +    H    +KDI          
Sbjct: 4   SPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKN-IKDI---------- 52

Query: 65  SYLQISYPMENGIIRNWADMELLWDYAFFE-----QMKLPTTSGGKVLLTEPPMNPIKNR 119
           S +    P E G +  W     +WDY FF         L    G  ++ +E  M   +  
Sbjct: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112

Query: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTR 179
           +   +V+FE+Y+F   + +  AV   + +                 V    S +    +R
Sbjct: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172

Query: 180 ------------------------------------------RLDVAGRDVTRHLIDLLS 197
                                                     +LD+ GR +T  L + LS
Sbjct: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232

Query: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP----------- 246
            R Y  N   +   V  +KEK  +VS     D+  A++   L   Y LP           
Sbjct: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVR 288

Query: 247 -----------DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTS 295
                      D + I +  E F  PE  F P +  + +PG+ E +  ++      +R  
Sbjct: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348

Query: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322
           +   IV +GG+   P    RL  EL++
Sbjct: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 111/282 (39%), Gaps = 32/282 (11%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHAST-----PLKDIMI 56
           D  + +V+D G+    IG +G + P  T PS  G+ I   EE+           LK  + 
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGTDCPQVTLPSRYGQYISEEEEKDEQEQQEDDRKLKQKVF 71

Query: 57  GDEASEV-RSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNP 115
            +++  + R+  QI   + NG + +W   +  W +A   ++   +T G    LTEP  N 
Sbjct: 72  SEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFESTKGMPAFLTEPIWNT 131

Query: 116 IKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 175
            +NR++  EV+ E  +F   +++       +A G               + PV + + L+
Sbjct: 132 EENRKKSLEVLLENMEFEACFLSPTPTCVSFAMGRPTCLVVDIGHDVCSVSPVVDGMTLS 191

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARE 235
             +    +AG      L++ L  +     +T     + Q         +D ++D  L   
Sbjct: 192 KSSTSNFIAG-----SLLNALLSKQLDPKKTVPLFQIAQRHPNFIPKKFDFEVDPSL--- 243

Query: 236 TTTLVESYELPDGRVIKVGPERF---EAPECLFQPSLVDVEQ 274
                           K G ER+   E  E LFQ +   +E+
Sbjct: 244 ---------------FKFGNERWFFQECKETLFQVAPATLEK 270

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 64/118 (54%), Gaps = 16/118 (13%)

Query: 273 EQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +L++++I A DVD+R +L   +V++GG+S  PGL  R+  EL +          
Sbjct: 389 EIAGLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNK---------- 438

Query: 333 PTRLDKFKVRIEDP---PRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSK 387
              L   K R+        R++  ++GG++L++ +     +W+ KQE+ E+G + + K
Sbjct: 439 --SLPALKFRMLTSGHLKERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEVGASRLLK 493

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKE+  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEQCLFV 255

Query: 223 SYDLDLDTKLARETTTL-------------------VESYELP-DGRVIKVGPERFEAPE 262
           S     D+   ++   L                    E+  LP D ++I +  E F  PE
Sbjct: 256 SPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPE 315

Query: 263 CLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322
             F P +  + +PG+ E +  ++      +R  +   IV +GG+   P    RL  EL++
Sbjct: 316 TFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 57/149 (38%), Gaps = 16/149 (10%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65
           PIV+D G+  +K G +    P     ++       +    H    +KDI          S
Sbjct: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKN-IKDI----------S 53

Query: 66  YLQISYPMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPIKNRE 120
            +    P E G +  W     +WDY       F+   L    G  ++ +E  M   +  +
Sbjct: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQG 149
              +V+FE+Y+F   + +  AV   + + 
Sbjct: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKS 142

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 26/182 (14%)

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEKCLFV 255

Query: 223 SYDLDLDTKLARETTTLVESYELPD----------------------GRVIKVGPERFEA 260
           S     D+  ++    L   Y LPD                       + I +  E F  
Sbjct: 256 SPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTI 313

Query: 261 PECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E +  ++      +R  +   IV +GG+   P    RL +EL
Sbjct: 314 PETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLAREL 373

Query: 321 KQ 322
           ++
Sbjct: 374 QR 375

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 95/232 (40%), Gaps = 10/232 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           +P +PI +D G+  ++ G      P + FP+ + +   R  +     T + +  + D+A 
Sbjct: 35  NPQSPIAIDFGSSKLRAGFVNHATPTHIFPNALTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTS-GGKVLLTEPPMNPIKNRE 120
            VRS  Q   P +   + NW   E + DY F     +P       +LLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNLTEEILDYTFHHLGVVPDNGIPNPILLTERLATVQSQRT 148

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLNHL 177
              +++FE Y+  G    I ++ + Y     G             T+++PV +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLFSFYNYNPSGNKTGLVISCGHEDTNVIPVVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLD 229
            +R++  G     +L DL++ +   F     +     + +  CYVS + D D
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDED 260

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 63/154 (40%), Gaps = 28/154 (18%)

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGEL-------LFNTIQAADVDIR 293
           +S  + +   + +  ER   PE +FQP++   +Q G+ EL        F +         
Sbjct: 602 DSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTS 661

Query: 294 TSLYKAIVLSGGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPR 348
             +   ++++GG++  PGL  R+ KE           T  + +DP+ LD +K        
Sbjct: 662 IDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMSSDPS-LDAWK-------- 712

Query: 349 RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGP 382
                  G A LA          +SK+E+ E GP
Sbjct: 713 -------GMAALARNEEQYRKTVISKKEYEEYGP 739

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 98/233 (42%), Gaps = 11/233 (4%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64
           TPI +D G+  V+ G    + P + FP+ + R   R  +     T + + ++ D+   VR
Sbjct: 37  TPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRH--RDRKLSKTFTFIGNDVLLDQT--VR 92

Query: 65  SYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKN-REQMC 123
           S  Q   P +   I NW  +E +  Y F     +   S    L+   P+  +++ R+   
Sbjct: 93  S--QSKSPFDGSFIANWDYVEDIMQYTFNHLGVVGDNSVRNPLIINEPLGSLQSQRKNWY 150

Query: 124 EVMFEKYDFGGTYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
           E++FE +        I  +   YA  +G             T ++PV +   +    +R+
Sbjct: 151 ELLFECFHLPNVSFGIDGMFGFYANNEGNQDGIVINCSNEETDVIPVVDGRGVLTDAKRI 210

Query: 182 DVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL--DLDTKL 232
           +  GR    +L DL+S +   F         +Q+    CYVS D   D+DT L
Sbjct: 211 NWGGRQAVDYLSDLMSLKYPYFPSKLSTFQYQQMYTNYCYVSPDYSNDIDTML 263

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 66/148 (44%), Gaps = 18/148 (12%)

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGEL----LFNTIQAADVDI-RTS 295
           +S  + +   + +  ER   PE LFQP +   +Q G+ EL    L N   +   ++  TS
Sbjct: 599 DSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETS 658

Query: 296 L--YKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
           L   K I L+GG S  PGL  R+ KE     FT  L   P    K  V++   P      
Sbjct: 659 LGMAKNIWLTGGHSKLPGLRERIVKE-----FTGFL---PVGT-KLGVKMSKNPSLD--A 707

Query: 354 FIGGAVLANIMADKDHMWLSKQEWHEIG 381
           + G   LA   AD     +SK+++ E G
Sbjct: 708 WYGMRKLAQNEADYKDSIISKKDYEEYG 735

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 84/188 (44%), Gaps = 24/188 (12%)

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      +++D+ GR +T  L + LS R Y  N T +   V  IKEK  +V
Sbjct: 204 TWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHY--NVTDETILVNNIKEKCLFV 261

Query: 223 ---SY--DLDLDTKLARET------TTLV------ESYELPD-GRVIKVGPERFEAPECL 264
              SY     L  K A E       TT +         +LPD  ++I +  E F   E +
Sbjct: 262 APKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETI 321

Query: 265 FQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKEL-KQL 323
           F P +  + +PG+ E +  ++      IR  +   IV  GG+   P    RL  EL +QL
Sbjct: 322 FHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQL 381

Query: 324 ---WFTRV 328
              W T V
Sbjct: 382 PTDWTTHV 389

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 60/138 (43%), Gaps = 20/138 (14%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65
           PIV+D G+  +K G +    P     +I             A      + + ++   ++ 
Sbjct: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAI-------------AKDKYNTVYLSNQIKGIKD 51

Query: 66  YLQISY--PMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPIKN 118
              +++  P E G + +W     +WDY F     F+  +L  TS   ++++E  ++  + 
Sbjct: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111

Query: 119 REQMCEVMFEKYDFGGTY 136
              +  ++FE+Y++G  Y
Sbjct: 112 SRNIDHIIFEEYNYGSIY 129

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 92/234 (39%), Gaps = 17/234 (7%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           +P  PI +D G+  V+ G   E  P + FP+ + R   R   +    T       G++ S
Sbjct: 34  NPEIPIAIDFGSSTVRAGYTNEARPSHIFPTKLTRYRDRKINKTFTFT-------GNDCS 86

Query: 62  ---EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTS-GGKVLLTEPPMNPIK 117
               +RS  Q+  P +  +I NW  +E +  Y F     +P       +++TE       
Sbjct: 87  LDQTIRS--QMKSPFDGALITNWDYVEDILQYTFNHLGVVPDHGVQNPIIITEKLATIQS 144

Query: 118 NREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTH----IVPVYESVV 173
            R    +++FE Y+       I ++ A Y                +H    I+P+ +   
Sbjct: 145 QRSNWYQLLFETYNVPKATFGIDSLFAFYNNNNGSATSTGMVIDCSHEETNIIPIVDGQG 204

Query: 174 LNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
           +    +R++  GR    +L +LL+ +   F           + +  CYVS D D
Sbjct: 205 ILTDAKRINWGGRHAIDYLSNLLALKYPYFPTKLSSYQYESMYQNFCYVSQDYD 258

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 65/149 (43%), Gaps = 18/149 (12%)

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGEL-------LFNTIQAADVDIR 293
           +S ++     I +  ER   PE +FQPS+  ++Q G+ EL        F +      ++ 
Sbjct: 601 DSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELS 660

Query: 294 TSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
            ++   I L+GG+S  PGL  R+ KE ++               +F V +   P      
Sbjct: 661 LTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNT---------QFNVNMTSDP--TFDA 709

Query: 354 FIGGAVLANIMADKDHMWLSKQEWHEIGP 382
           + G A LA    D     +SK+E+ E GP
Sbjct: 710 WNGMAKLAQNETDYKKTIISKKEYEEYGP 738

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 99/232 (42%), Gaps = 15/232 (6%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D   PI +D G+  ++ G   ++ P + FP+ + R   R  +     T + + +  D+A 
Sbjct: 34  DSTIPIAIDFGSSQIRAGYTNQSTPSHIFPNRLTR--YRDRKINKTFTFIGNDVSLDQA- 90

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSG--GKVLLTEPPMNPIKNR 119
            +R+  Q   P +  II NW  +E +  Y  F  + +   +G    +LLTE        R
Sbjct: 91  -IRT--QSKSPFDGSIITNWDYVEDIMQY-IFNHLGVVGHNGVSNPILLTEKLATLQSQR 146

Query: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESVVLN 175
               +++FE +D     + I ++ A Y  GL                T ++PV E   + 
Sbjct: 147 SNWYQLLFECFDIPEVTLGIDSMFAFY--GLNERSSTGLVIDCGNEETDVIPVVEGAGML 204

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
              +R++  GR    +L DLL+ +   F         +++ +  CYV+ D D
Sbjct: 205 TDAKRINWGGRQAVDYLNDLLTLKYPYFPTKLSTAQYQRVYQDYCYVAKDYD 256

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIRTSLYKAIVLSGGSSM 308
           ER   PE LFQPS+   +Q G+ EL        F + Q        ++   + ++GG+S 
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTALAMANNLWITGGNSK 673

Query: 309 YPGLPSRLEKEL 320
            PG+  R+ KE 
Sbjct: 674 LPGMKERIVKEF 685

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 65/139 (46%), Gaps = 28/139 (20%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIRTSLYKAIVLSGGSSM 308
           ER   PE LFQP++   +Q G+ EL        F + Q    D+ TS+ + + ++GG++ 
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAK 670

Query: 309 YPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
            PGL  R+ KE  +       F+     DP+ LD ++               G A LA  
Sbjct: 671 LPGLRERIVKEFSEFLPSGSPFSIRKSQDPS-LDAWR---------------GMAKLAQN 714

Query: 364 MADKDHMWLSKQEWHEIGP 382
             D  H +++KQE+ E GP
Sbjct: 715 TEDFKHGYITKQEYLEYGP 733

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/240 (21%), Positives = 104/240 (43%), Gaps = 17/240 (7%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           +P+ PI +D G+  ++ G   +  P + FP+     + R  +R  A T      IG++ S
Sbjct: 34  NPNVPIAIDFGSSKLRAGYVNDPNPSHIFPN----RLTRYRDRKLAKTM---TFIGNDTS 86

Query: 62  EVRSY-LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSG--GKVLLTEPPMNPIKN 118
             ++  +Q     +  ++ NW  +E   +Y  F  + +    G    +++ E        
Sbjct: 87  LDQAVRVQAKSAFDGPLVTNWDYVEDTLEYT-FNHLGVAANGGISNPLVINERLATIQSQ 145

Query: 119 REQMCEVMFEKYDFGGTYVAIQAVLALYAQG--LXXXXXXXXXXXXTHIVPVYESVVLNH 176
           R    +++FE +D  G    I ++   Y                  T+++PV +   +  
Sbjct: 146 RANWYQILFECFDVPGVTFGIDSLFGFYHNSGPNSTGLVIGCGNEDTNVIPVVDGKGVLT 205

Query: 177 LTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYV--SYDLDLDTKLA 233
            ++R++  G   T +L +L+S +  Y   + + F+  + + E  CYV  SYD +L+  L+
Sbjct: 206 ESKRINWGGNQATEYLTNLMSLKYPYFPTKLSPFQ-YKTMYEDYCYVSQSYDEELEKYLS 264

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 111/285 (38%), Gaps = 36/285 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           +P T I +D G+  V+ G   +  P + FP+ + R   R   R           IG++ +
Sbjct: 34  NPETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLT-------FIGNDTN 86

Query: 62  ---EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSG--GKVLLTEPPMNPI 116
               VRS  Q   P +  ++ NW   E + +Y F   + +  T G    +++TE      
Sbjct: 87  LDLSVRS--QSRSPYDGALVTNWDYTEDIMEYTFH-HLGVKGTDGIPNPIIMTEKLGALH 143

Query: 117 KNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESVVL 174
             R+   +++FE +        + ++ + YA                 THI+PV +   +
Sbjct: 144 SQRDNWYQLLFECFGAPQVTFGLDSLFSFYANNDASASGLVISSGNEDTHIIPVVDGKGV 203

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234
               +R++  GR    +L +LL+ +   F         + + ++ CYVS D         
Sbjct: 204 LGEAKRINWGGRQSVDYLSNLLALKYPYFPIKPSTHQFKALYDEFCYVSPD--------- 254

Query: 235 ETTTLVESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGE 279
                   Y+    R++ +  E  E    L +   VDV QP   E
Sbjct: 255 --------YQDEIQRILTL--EELETKNVLVEAPFVDVVQPEKSE 289

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 68/154 (44%), Gaps = 28/154 (18%)

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIR 293
           +S ++     + +  ER   PE +FQPS+  ++Q G+ E+        F + ++    I 
Sbjct: 594 DSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIEICETNFLKKFGSSRSELSSIS 653

Query: 294 TSLYKAIVLSGGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPR 348
            SL   + L+GG+   PG+  R+ +E + L          + ND   LD ++        
Sbjct: 654 RSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMANDCA-LDAWR-------- 704

Query: 349 RKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGP 382
                  G A L+   +     ++++QE+HE GP
Sbjct: 705 -------GMAKLSRTDSLFRDTYVTRQEYHEYGP 731

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 102/238 (42%), Gaps = 18/238 (7%)

Query: 3   PHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS- 61
           P  PI +D G+  VK G   ++ P + F +     + R  +R  A T      IG++ + 
Sbjct: 35  PDIPIAIDFGSYNVKAGYTNQSLPTHVFTN----KLTRYRDRKLAKTM---TFIGNDTNL 87

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSG---GKVLLTEPPMNPIKN 118
           +    +Q   P +   I NW   E ++DY     + + TT+G     ++LTE        
Sbjct: 88  DQPLRIQAKRPYDGLFIANWEYAEEIFDYTL-HHLGVQTTNGSISNPIILTEKMACLQSQ 146

Query: 119 REQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESVVL 174
           R    +++FE +D       + ++ A Y                    T+IVP+ +   +
Sbjct: 147 RANWYQLLFETFDVPSATFGLDSLYAFYNNCANPFESDGLVINCGHEDTNIVPIVQGKGI 206

Query: 175 NHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
               +R++  GR  T +L  LL+ +  Y   + ++F+  + + E  CYVS + + D K
Sbjct: 207 LTEAKRINWGGRHSTEYLSSLLTLKYPYFPTKLSEFQ-YQTMYEDFCYVSPNYNEDIK 263

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 63/147 (42%), Gaps = 28/147 (19%)

Query: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGEL-------LFNTIQAADVDIRTSLYKAIVLS 303
           I +  ER   PE +FQPS+   +Q G+ EL        FN+       I   +   + L+
Sbjct: 617 IHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLT 676

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG +  PGL  R+ KE  +        +  + NDP+ LD +K               G A
Sbjct: 677 GGHAKLPGLKERIVKEYTEFLPVGTKMSINISNDPS-LDTWK---------------GMA 720

Query: 359 VLANIMADKDHMWLSKQEWHEIGPAAM 385
            LA+       + ++K+++ E GP  M
Sbjct: 721 KLASNTDYLKKIQVTKKDYEEYGPEYM 747

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 83/202 (41%), Gaps = 15/202 (7%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           +P+TPI LD G+  V+ G   ++ P + FP+     I+R +ER           IG++ S
Sbjct: 37  NPNTPIALDFGSYEVRAGFTSQDTPSHVFPT----KIVRYKERKIQKAL---TFIGNDCS 89

Query: 62  ---EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTS-GGKVLLTEPPMNPIK 117
               VRS+ +   P +  +I NW  ME +  Y F      P       ++LTE       
Sbjct: 90  LDNAVRSHSR--SPYDGSLITNWEYMEDMLSYTFHHLGVQPNDGISNPMILTEKMATVQA 147

Query: 118 NREQMCEVMFEKYDFGGTYVAIQAVLALYAQGL--XXXXXXXXXXXXTHIVPVYESVVLN 175
            R    +++FE Y        I  + + YA                 T+I+PV +   + 
Sbjct: 148 QRSNWYQLLFECYGIPQVTFGIDGLFSFYANNSPDSTGLIINSGHEDTNIIPVIKGKGIL 207

Query: 176 HLTRRLDVAGRDVTRHLIDLLS 197
              +R+D  G     +L  LLS
Sbjct: 208 SEAKRIDWGGNQSIDYLKSLLS 229

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIRTSLYKAIVLSGGSSM 308
           ER  APE +FQPS+  ++Q G+ EL        F +  +        +   I ++GG++ 
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMASNIFITGGNTK 670

Query: 309 YPGLPSRLEKEL 320
            P L  R+  E 
Sbjct: 671 IPNLRERIVNEF 682

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 92/231 (39%), Gaps = 13/231 (5%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           DP+ PI +D G+  V+ G   ++ P + FP+ + R   R   +           +G++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTFT-------FVGNDTN 86

Query: 62  -EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSG--GKVLLTEPPMNPIKN 118
            E     Q   P +  +I NW  +E + +Y  F  + +    G    +LLTE        
Sbjct: 87  LEQTLRTQSRSPFDGPMITNWDYVEDMMEYT-FNHLGVVGHDGISNPILLTEKMATLQSQ 145

Query: 119 REQMCEVMFEKYDFGGTYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLNH 176
           R    ++MFE +        I ++ + +A  Q              T+++PV     +  
Sbjct: 146 RSNWYQLMFECFGVPKLTFGIDSLFSYFANNQSDSTGLVISSGNEDTNVIPVVCGKGILS 205

Query: 177 LTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
             +R++  GR    +  +LLS +   F         + I    CYVS D D
Sbjct: 206 EAKRINWGGRHSVEYTTNLLSLKYPYFPTKLVSSQFQSIYHDFCYVSRDYD 256

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 59/134 (44%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEL-------LFNTIQAADVDIRTSLYKAIVLSGGSSM 308
           ER   PE +FQP +  ++Q G+ EL        F + +     +   +   + L+GG+  
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQEMANNVFLTGGNVR 669

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PGL  R+ +E     FT  L   P    K+ +++   P      + G A  A    D  
Sbjct: 670 VPGLRDRIVRE-----FTEFL---PVGT-KYNIKVASDPAID--AWKGMAKFAQSSTDYK 718

Query: 369 HMWLSKQEWHEIGP 382
             +++K+E+ E GP
Sbjct: 719 GSYVTKKEYEEYGP 732

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 97/233 (41%), Gaps = 11/233 (4%)

Query: 3   PHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASE 62
           P  PI +D G+  ++ G      P + F + + R   R  +     T + + +  D+A  
Sbjct: 35  PDVPIAVDFGSNQLRAGLINRATPSHVFTNRITR--FRDRKLMKTMTFIGNDVNLDQA-- 90

Query: 63  VRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTS-GGKVLLTEPPMNPIKNREQ 121
           VR+  Q   P +  ++ NW  +E + +Y F      P       +L+TE        R  
Sbjct: 91  VRA--QSKSPFDGPMVTNWDYVEDILEYTFNHLGSTPNNGISNPILVTERLATLQTQRSS 148

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVPVYESVVLNHLTR 179
             +V+FE ++  G    I ++ A Y                  T+I+PV +   +    +
Sbjct: 149 WYQVLFECFNVPGVTFGIDSLFAYYQNTTANSTGLVIGCGNEDTNIIPVVDGQGMLTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
           R++  G     +L +L++ +  Y   + ++F   R + E  CYVS D D + K
Sbjct: 209 RINWGGSQAADYLTNLMTLKYPYFPTKLSNFH-YRTMYEDYCYVSQDYDEELK 260

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 58/134 (43%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIRTSLYKAIVLSGGSSM 308
           ER   PE  FQP++   +Q GV EL        F         I + + K + ++GG++ 
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PGL  R+ KE     FT  L  + +    F V I   P      + G A  A    D  
Sbjct: 672 IPGLRERIVKE-----FTGFLPVNTS----FNVNISSDPSLD--AWRGMAKYAQNETDYK 720

Query: 369 HMWLSKQEWHEIGP 382
             ++SK+E+ E GP
Sbjct: 721 KSFISKKEYEEYGP 734

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEL-------LFNTIQAADVDIRTSLYKAIVLSGGSSM 308
           ER   PE LFQP +   +Q G+ EL        F +  +   D   ++ K + ++GG + 
Sbjct: 618 ERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQ 677

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PGL +R+ KE     FT  L ND     KF V I   P      + G A  ++  AD  
Sbjct: 678 LPGLKTRIVKE-----FTSFLPNDA----KFSVNISKHPSLD--AWKGMAKFSSDDADFK 726

Query: 369 HMWLSKQEWHEIGP 382
              +SK+E+ E GP
Sbjct: 727 SSLISKKEYEEYGP 740

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 94/232 (40%), Gaps = 19/232 (8%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           D   PI +D GT  VK G   +  P + FP+ + R   R   R           IG++ +
Sbjct: 35  DSSIPIAIDFGTCSVKAGYVNKADPAFNFPTRLTRFRDRKMSRTMT-------FIGNDTN 87

Query: 62  ---EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSG--GKVLLTEPPMNPI 116
               VRS  Q   P +   + NW   E + +Y  F+ + +    G    +++TE      
Sbjct: 88  LDYAVRS--QSKTPFDGPFVTNWEYAEDILEYT-FKHLGVTANHGISNPLIMTEKLATLQ 144

Query: 117 KNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVPVYESVVL 174
             R    +++FE ++       I  V A YA                 T+++P+ +   +
Sbjct: 145 SQRANWYQLLFETFNTSNVSFGIDNVFAFYANTDKHSSGLVFGLNNQDTNVIPIIDGKPV 204

Query: 175 NHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYD 225
              T+R++  G     +L DL++ +  Y   +  +F+     K+  CYVS D
Sbjct: 205 LTDTKRINWGGSQSVGYLSDLMTLKYPYFPTKLTEFQYETLYKD-YCYVSPD 255

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 95/234 (40%), Gaps = 13/234 (5%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65
           PI +D G+  +K G   ++ P   FP+ + R   R        T + + +  D+A  VR+
Sbjct: 39  PIAIDFGSNTLKAGYTNQDVPSLVFPTRLTR--FRDRRLNRTMTFIGNDISLDQA--VRA 94

Query: 66  YLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIK-NREQMCE 124
             Q   P +  ++ NW  ++ + +Y F     L        L+    +  ++  R Q  +
Sbjct: 95  --QSKSPFDGSMVTNWEYIDEMLEYTFKHLGVLGDNGISNPLIFSEKLAVVQAQRSQWYQ 152

Query: 125 VMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVPVYESVVLNHLTRRLD 182
           ++FE ++       I    A +A                 T+++P+   V      +R++
Sbjct: 153 LLFETFNISKATFGIDNQFAFFANNSIDSTGLMIGCNNEDTNVIPIVNGVASLQECKRIN 212

Query: 183 VAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVS--YDLDLDTKLA 233
             G     ++ +LLS +  Y   +  D +  +++    CYVS  Y  D+D  L 
Sbjct: 213 WGGNHAVSYMNNLLSLKYPYFPTKLTDLQ-YQKLYHDYCYVSPDYSADIDKYLT 265

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIRTSLYKAIVLSGGSSM 308
           ER   PE LFQP++   +Q GV EL        F +           +   I LSGG++ 
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 309 YPGLPSRLEKEL 320
            PGL +R+ KE 
Sbjct: 673 VPGLKNRIVKEF 684

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 88/231 (38%), Gaps = 9/231 (3%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEAS 61
           DP+ PI +D G+  ++ G    + P + FP+   +   R   +          +     S
Sbjct: 38  DPNIPIAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRS 97

Query: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTS-GGKVLLTEPPMNPIKNRE 120
           + RS      P +  ++ NW  +E +  Y F      P       +++ E        R 
Sbjct: 98  QARS------PFDGPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQSQRS 151

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVLNHLT 178
              + +FE +      +A++ +LA Y    G             T+++P+ E   +    
Sbjct: 152 NWYQTLFESFGVPKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMMLDA 211

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLD 229
           +R++  G     +L +LL  +   F     +    ++ +  CYVS D + D
Sbjct: 212 KRINWGGHSSIDYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETD 262

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 63/148 (42%), Gaps = 18/148 (12%)

Query: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIR 293
           +S  + +   + +  ER   PE +FQP L   +Q G+ E+        F +         
Sbjct: 602 DSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQS 661

Query: 294 TSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
             + K + L GG++  PGL SR+ KE     FT  L +D     K  V I + P     V
Sbjct: 662 LDMAKNVWLVGGNAQVPGLKSRVVKE-----FTEFLPSDT----KINVNISEAPTLD--V 710

Query: 354 FIGGAVLANIMADKDHMWLSKQEWHEIG 381
           + G   LAN   D     ++ +E+ E G
Sbjct: 711 WNGMYRLANTEEDYQRTIVTSEEYDECG 738

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIRTSLYKAIVLSGGSSM 308
           ER   PE +FQPS+  ++Q G+ EL        F + +    +I   + K I ++GG++ 
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRRELSEISKMMAKNIFITGGNAK 668

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PG+  R+ +E     F  V  N   +L       EDP       + G A  AN  +  +
Sbjct: 669 LPGIRERVVREF--TGFLPVGTNLNVKL------AEDPS---MSAWRGMAKFANNTSLYE 717

Query: 369 HMWLSKQEWHEIGP 382
              ++K+E+ E+GP
Sbjct: 718 TSIMTKKEYEELGP 731

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 52/256 (20%), Positives = 93/256 (36%), Gaps = 19/256 (7%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64
           TPI +D G+  V+ G   +  P   F + + R   R   R +         +G++ +  +
Sbjct: 37  TPIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYT-------FVGNDTNLDQ 89

Query: 65  SY-LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSG--GKVLLTEPPMNPIKNREQ 121
           S   Q   P +  +I NW  ++ +  Y F   + +    G    VL+TE        R  
Sbjct: 90  SIRTQSKSPFDGSMITNWDYVDDILAYTFH-HLDVRGNGGVPNPVLITERMAALQSQRSN 148

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQG--LXXXXXXXXXXXXTHIVPVYESVVLNHLTR 179
             E++FE Y+       I ++ + Y +                T ++PV     +    +
Sbjct: 149 WYELLFECYNLQKVTFGIDSLFSFYGEHPPGTTGIAINSGNEDTSVIPVVNGKGILTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTL 239
           R++  G+    +L  LLS +   F           +    CY S      T    E +TL
Sbjct: 209 RINWGGQQSVGYLNGLLSLKYPYFPTKLVNNQFESMYRDFCYFS------TNFEEEISTL 262

Query: 240 VESYELPDGRVIKVGP 255
           +    L    ++   P
Sbjct: 263 LTMENLESKDIVVEAP 278

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 63/144 (43%), Gaps = 28/144 (19%)

Query: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIRTSLYKAIVLS 303
           + +  ER   PE LF+PS+   +Q G+ EL        F +         + +   + ++
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG++  PG+ +R+ KE  +        +  +  DP+ LD +K               G A
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSEDPS-LDAWK---------------GMA 711

Query: 359 VLANIMADKDHMWLSKQEWHEIGP 382
            LAN   D  +  ++++E+ E GP
Sbjct: 712 KLANNETDYKNTAVTRKEYEEYGP 735

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/230 (20%), Positives = 89/230 (38%), Gaps = 16/230 (6%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA- 60
           DP+  I +D G+  ++ G   +N P Y FP+ + +   R  ++           IG++  
Sbjct: 34  DPNARIAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKTFT-------FIGNDTL 86

Query: 61  --SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSG--GKVLLTEPPMNPI 116
               +RS  Q   P +  ++ NW  +E + +Y  F  + +   +G    +++ E      
Sbjct: 87  LDQTIRS--QSKSPFDGTLLTNWDYVEDMLEYT-FHHLGVSGNNGVSNPLIINERLACLQ 143

Query: 117 KNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXX-XXXXXXXXXTHIVPVYESVVLN 175
             R    +++FE +D       I ++ + Y                 T ++P+     + 
Sbjct: 144 SQRNSWYQLLFETFDLPEVSFGIDSLFSFYGNSTKEDGLVINCGNEETDVIPIVGGRGIL 203

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 225
              +R++  G   T  L  LL+ +   F          Q+ E  CY S D
Sbjct: 204 SECKRINWGGSQSTNFLSSLLTLKYPYFPAKLSTLQYTQMYEDYCYTSPD 253

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 86/233 (36%), Gaps = 25/233 (10%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIG-DEASEVR 64
           PI +D G+  V+ G      P   FP+ + R   R   R +         +G D   +  
Sbjct: 42  PIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYT-------FVGRDTGLDAS 94

Query: 65  SYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGG----KVLLTEPPMNPIKNRE 120
              Q   P +  ++ NW  ++ +  Y F     L    GG     V+LTE        R 
Sbjct: 95  IRTQSRSPFDGPMVTNWDYVDDMLAYTFHH---LGVRGGGGVPNAVVLTERLATLQSQRA 151

Query: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQ------GLXXXXXXXXXXXXTHIVPVYESVVL 174
              E+++E Y+       I ++ + Y +      GL            T +VPV +   +
Sbjct: 152 NWYELLYEAYNLQEVTFGIDSLFSFYGERGPGSTGL----VVSSGNEDTCVVPVVDGRGV 207

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
               +R++  G+    +L  LL+ +   F           I  + CYV+ D +
Sbjct: 208 VSEAKRINWGGQQAVDYLTGLLALKYPYFPTKLSGSQFETIYREHCYVAEDFE 260

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 63/139 (45%), Gaps = 18/139 (12%)

Query: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGELL-------FNTIQAADVDIRTSLYKAIVLS 303
           + +  ER   PE +FQPS+  ++Q GV EL        F++ + A       + K + ++
Sbjct: 609 MHINVERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATCEKMAKNVFIT 668

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++  PG+  R+ +E     FT  L   P   +  KV +   P      + G A  A+ 
Sbjct: 669 GGNTKLPGIRERIVRE-----FTGFL---PVGTE-LKVTLAKDP--SLSAWKGMAKFASD 717

Query: 364 MADKDHMWLSKQEWHEIGP 382
                   L+K+E+ E GP
Sbjct: 718 PTSYKSSILTKREYEEYGP 736

>KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 253

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/98 (16%), Positives = 44/98 (44%)

Query: 91  AFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGL 150
           ++F  + +  + G K++++EP    I  ++++C+V+F +            + A    G+
Sbjct: 47  SWFHDILMYNSKGVKIVISEPLWLSILRKQRLCKVLFGRLKVNSICFVPNCLAAFIGAGI 106

Query: 151 XXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDV 188
                       T ++P+++  +L+  +R   +   +V
Sbjct: 107 RNGLYIEVNSKNTELIPIFDGRILDSYSRSSKLGSDNV 144

>SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 311

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 44/250 (17%), Positives = 100/250 (40%), Gaps = 42/250 (16%)

Query: 83  DMELLWD--YAFFEQMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQ 140
           D E LW   Y  +    +   S  KV++ E  + P+  +E +C+V+ ++           
Sbjct: 37  DEEFLWRLFYKCYHDELMVAPSSTKVVIIENVLLPLNCKELLCQVLLKRLLVSSIVFVPD 96

Query: 141 AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHL-------- 192
            ++  ++ G+              +VP+ +  +L++ +   + AG+ +  +L        
Sbjct: 97  VLMTCFSSGVKDGLVIDVGWEYVAVVPILDLRILDNWSHISNKAGKFLYDNLKEILPPGT 156

Query: 193 -IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRVI 251
            +D+L  +  A     DF+                       RE +    + E+ +G + 
Sbjct: 157 DLDILVPQIMACEGDKDFQY----------------------REISI---TKEVRNGFLK 191

Query: 252 KVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPG 311
           K      E       P   D ++  + +++  T++   VD++  ++  ++++G +S  PG
Sbjct: 192 KTIGHFDE------DPLEYDDDELPISQVVLKTLKDLPVDVKKRVFPHLMITGLASNIPG 245

Query: 312 LPSRLEKELK 321
              +L KE+K
Sbjct: 246 FKMKLLKEVK 255

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 58/150 (38%), Gaps = 15/150 (10%)

Query: 69  ISYPMENGIIR----NWADM-ELLWDYAFFEQMKLPTTSGG---------KVLLTEPPMN 114
           I YP  NG       +++ + ELL D        L  T  G         KV+L  P + 
Sbjct: 302 IRYPFSNGAFNVECPDYSSLQELLNDVTKLITFALSETKLGISRSQFPNYKVILIIPDLF 361

Query: 115 PIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVV 173
                EQM  ++  + +F    +  +++   Y  GL             T I  V E  V
Sbjct: 362 EKNYVEQMIRLLLSEMNFQAVALIQESLATCYGAGLSNSTCVIDIGASETKISCVDEGQV 421

Query: 174 LNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203
           + +   RL   G D+TR  ++LL +  + +
Sbjct: 422 IQNSCIRLSYGGDDITRLFVELLLQSNFPY 451

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 57/281 (20%), Positives = 105/281 (37%), Gaps = 41/281 (14%)

Query: 76  GIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPM----NPIKNR--EQMCEVMFEK 129
           G+  NW  +E  W+Y F +Q+K   T    VL+T P        I+N+  EQ C++ FEK
Sbjct: 73  GVPYNWEALEKQWEYIFEKQLKCDPTE-LPVLITIPSSISKNEDIENKVIEQYCKIAFEK 131

Query: 130 YDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVT 189
           +      +  +++      G             + + P+ + V++ +   +    G  + 
Sbjct: 132 FKIPYLQIVNESLSISLGLGKKTSLVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLD 191

Query: 190 RHLI--------DLLSRRGYAFNRTADFET-VRQIKEKLCYVSYDLDLDTKLARETTTLV 240
             +I        DL      + N      + ++  K+ +  V+     D +   E    +
Sbjct: 192 YQIIKKFSTIDEDLEEEMTNSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVEKYYEEQLRL 251

Query: 241 ESYELPDGRVIKVGP----------------------ERFEAPECLFQPSLVDVE---QP 275
           ++     G +  VG                       E ++  E LFQP L   +     
Sbjct: 252 QAELQNQGSITSVGTNPLSVKKEYLYRSRKTVTFESRELYQFGEYLFQPQLASEQYNRDD 311

Query: 276 GVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRL 316
           G+GEL++ +I +A +    +   A    GGSS   G  S +
Sbjct: 312 GLGELIYRSITSAAMGNMPAAVAASNNIGGSSGATGGDSNV 352

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 90/243 (37%), Gaps = 35/243 (14%)

Query: 54  IMIGDEASEV-RSYLQISYPMENGIIRNW------------ADMELLWDYAFF---EQMK 97
           I  G+EA    +    I YP   G   N             +D+  L++YA     E + 
Sbjct: 380 IYFGEEAERCNKENFIIRYPFNKGGSLNLDSPYYSSLPELLSDVTRLFEYALTKRDESIT 439

Query: 98  LPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXX 157
                  KV+L  P +    + E +  ++ ++  F    +  +++ A Y  G+       
Sbjct: 440 QAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIV 499

Query: 158 XX-XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFET 211
                 T I  V E  VL +   +LD  G D+TR     L    + F     + T  +  
Sbjct: 500 NIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTL 559

Query: 212 VRQIKEKLCYVSY-DLDLDTKL----ARETTTLVESYELPDGRVIKVGPERFEAPECLFQ 266
             Q+K+   Y ++ D ++  +L     R    + E YE       KV  E   AP  LF 
Sbjct: 560 AEQLKKN--YATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFY 611

Query: 267 PSL 269
           P +
Sbjct: 612 PDI 614

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 32/197 (16%), Positives = 76/197 (38%), Gaps = 5/197 (2%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+  GT     G    + P    P++  +     +++   +  L DI       +   Y
Sbjct: 11  VVIQNGTNTTLAGFNNVDLPQCVIPTVYIQDN-STQKKIFGNFELLDIASSRSNDDAGRY 69

Query: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNR---EQMC 123
              +    NG+  NW  ++  W+Y + E +K   +    +++T P  N   +    ++  
Sbjct: 70  EVFTIFDRNGLPYNWDALKEQWEYIYREVLKC-NSDEYPLVITIPSANKDVDEIILKKYF 128

Query: 124 EVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E+ FE ++     + I+ +    + G              ++ P+ +  V+ H   +   
Sbjct: 129 ELAFETFNVPVLQIIIEPLAVALSLGKSSSLVVNLGASGCNVTPIVDGTVIKHAVMKSKY 188

Query: 184 AGRDVTRHLIDLLSRRG 200
            G  +   ++++L  +G
Sbjct: 189 GGDFLDFQIVNILQEKG 205

>TPHA0N01730 Chr14 complement(369871..371103) [1233 bp, 410 aa] {ON}
           
          Length = 410

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 275 PGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPT 334
           P +    FN  Q        SL +AI +   S+   G  S+ E+E   + F R LRND  
Sbjct: 189 PAMANDKFNYCQ-----FSRSLEQAINVPESSNTGMGHYSKKEEEESMVNFRRSLRNDRN 243

Query: 335 RLDKFKVRIEDPPRRKH 351
           +L KF+   +D   + +
Sbjct: 244 KLVKFQFNFDDDSNKSN 260

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 50/136 (36%), Gaps = 11/136 (8%)

Query: 72  PMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVL---LTEPPMNPIKNR-------EQ 121
           P+ENG+I N    +    Y +   +K              T  P+  + N        E 
Sbjct: 66  PIENGMIINLEAFQEFLKYIYISLLKQKHDENADSFEYSFTNIPLLLLNNHKWSQFQMES 125

Query: 122 MCEVMFEKYDFGGTYVAIQAVLALYAQ-GLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +   +FEK    G  +   ++ A Y+   L            T IVP+ +   +NHL+  
Sbjct: 126 ITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHLSNT 185

Query: 181 LDVAGRDVTRHLIDLL 196
           L+  G  +   L  LL
Sbjct: 186 LNYGGSYINTILQKLL 201

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 75/191 (39%), Gaps = 24/191 (12%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+  G+     G +    P    PS     I R +E G A        + D A+E R+ 
Sbjct: 8   VVIHNGSHRTVAGFSNVELPQCIIPSSY---IKRTDEGGEAEFIFGTYNMIDAAAEKRNG 64

Query: 67  LQISYPMEN-GIIRNWADMELLWDYAFFEQMK-----------LPTTSGGKVLLTEPPMN 114
            ++   +++ G+  NW  +E+ W Y +  Q+K           +P T+G      +P M 
Sbjct: 65  DEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNG------KPDMA 118

Query: 115 PIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
            +   E+  E+ F+K +     + I+ +    + G              ++ P+ + +V+
Sbjct: 119 IL---ERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVV 175

Query: 175 NHLTRRLDVAG 185
            +   R    G
Sbjct: 176 KNAVVRSKFGG 186

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 73/191 (38%), Gaps = 24/191 (12%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66
           +V+  G+     G +    P    PS     + R  + G A        + D  +E RS 
Sbjct: 8   VVIHNGSHRTVAGFSNVELPQCIIPSSY---VKRTNDAGKAEFVFGTYDMIDATAEKRSD 64

Query: 67  LQISYPMEN-GIIRNWADMELLWDYAFFEQMK-----------LPTTSGGKVLLTEPPMN 114
            ++   M++ G+  NW  +EL W Y +  Q+K           +P T+G      +P M+
Sbjct: 65  DEVYTLMDSQGLPYNWEALELQWRYMYETQLKVSPEELPLVITMPATNG------KPDMS 118

Query: 115 PIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
            +   E+  E+ F+K       + I+ +    + G              ++ P+ + +V+
Sbjct: 119 IL---ERYYELAFDKLKVPVFQIVIEPLAIALSMGKSSAFVIDMGASGCNVTPIIDGIVV 175

Query: 175 NHLTRRLDVAG 185
            +   R    G
Sbjct: 176 KNAVVRSKFGG 186

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 259 EAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEK 318
           + PEC       D+++  +  L+  +I+   +D+++ + + +++ GG S   GL  RL +
Sbjct: 194 QDPEC-------DIDEFPIISLVLESIKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIE 246

Query: 319 ELK 321
            L+
Sbjct: 247 NLR 249

>KLLA0F26455g Chr6 (2450871..2453462) [2592 bp, 863 aa] {ON} similar
           to uniprot|P36016 Saccharomyces cerevisiae YKL073W LHS1
           Molecular chaperone of the endoplasmic reticulum lumen
           involved in polypeptide translocation and folding member
           of the Hsp70 family localizes to the lumen of the ER
           regulated by the unfolded protein response pathway
          Length = 863

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 72/168 (42%), Gaps = 19/168 (11%)

Query: 183 VAGRDVTRHLIDLLSRRGYAFN---RTADFETVRQIKEKLCYVSYDLDLDTKLARETTTL 239
           ++G  ++  ++DLL       N   RT  FE+    K KL   +    L      + +  
Sbjct: 264 LSGSVLSLAIVDLLENDFLESNPNIRTEQFESDASAKAKLVQAAEKAKLVLSANSDASIS 323

Query: 240 VES-YELPDGR--VIKVGPERF--EAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRT 294
           +ES Y   D +  + +   E F  E    + +P L  +E P  G+ L       D+D   
Sbjct: 324 IESLYHDLDFKTTITRAKFEEFVAELQSVVIEPILSTLESPLNGKAL----NVKDLD--- 376

Query: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVR 342
               +++L+GGS+  P +  +LE  L     ++ + +D + ++   +R
Sbjct: 377 ----SVILTGGSTRVPFVKKQLENHLGASLISKNVNSDESAVNGAAIR 420

>SAKL0D00594g Chr4 complement(48583..49875,50031..50132) [1395 bp,
           464 aa] {ON} highly similar to uniprot|P54839
           Saccharomyces cerevisiae YML126C ERG13
           3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) synthase,
           catalyzes the formation of HMG-CoA from acetyl-CoA and
           acetoacetyl-CoA; involved in the second step in
           mevalonate biosynthesis
          Length = 464

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 63/165 (38%), Gaps = 7/165 (4%)

Query: 83  DMELLWDYAFFE--QMKLPTTSGGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQ 140
           D+   +DY  F     KL T S G++L  +   NP    E   E+   +Y+   T   I+
Sbjct: 258 DVAKFFDYNVFHVPTCKLVTKSYGRLLYNDFRANPQLYPEVDAELAKAEYNASLTDKNIE 317

Query: 141 AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTR-HLIDLLSRR 199
                 A+ L            T+   +Y   V + L   L   G D  +   I L S  
Sbjct: 318 KTFVGVAKPLHKDRVAPSLIVPTNTGNMYTGSVYSSLASLLFFVGSDALQGKRIGLFS-- 375

Query: 200 GYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
            Y     A   + + + + + Y++  LDLD KL    T   E YE
Sbjct: 376 -YGSGLAASLFSCKVVGD-IKYITDVLDLDNKLNGRKTETPEDYE 418

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 47/115 (40%), Gaps = 4/115 (3%)

Query: 74  ENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMN---PIKNREQMCEVMFEKY 130
           ENG+  NW  +E  W Y F  ++K  +     +++T P M     ++  E+  ++ F K+
Sbjct: 70  ENGVPYNWEALERQWKYIFENELKCKSDE-FPLVITVPIMKDAVALRVMERYFDLAFNKF 128

Query: 131 DFGGTYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           +     V I+ +    + G              ++ PV +  V  +   +   AG
Sbjct: 129 NVPVLQVIIEPLAIALSMGKSSALVVDLGSSSCNVTPVIDGTVAKNSVLKSKYAG 183

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,592,783
Number of extensions: 1668168
Number of successful extensions: 3772
Number of sequences better than 10.0: 161
Number of HSP's gapped: 3412
Number of HSP's successfully gapped: 241
Length of query: 391
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 279
Effective length of database: 40,638,807
Effective search space: 11338227153
Effective search space used: 11338227153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)