Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C03828g3.162ON79379339980.0
ADR317C3.162ON81981516630.0
KLTH0F06468g3.162ON83780916570.0
Kwal_33.141673.162ON83884216560.0
SAKL0C07348g3.162ON86184916570.0
NCAS0I020803.162ON77477615060.0
TDEL0D046003.162ON79581214710.0
NDAI0A066203.162ON74777114040.0
Kpol_1032.103.162ON79172213930.0
Ecym_52363.162ON86450113990.0
ZYRO0B04906g3.162ON84763113851e-179
KAFR0F022203.162ON74775713621e-177
Suva_4.2213.162ON76576713621e-177
YDL028C (MPS1)3.162ON76472113541e-176
Skud_4.2233.162ON76979013411e-174
Smik_4.2073.162ON76576413381e-173
TPHA0M003003.162ON77457013311e-172
CAGL0K01617g3.162ON77479412441e-159
KNAG0K017403.162ON76557611901e-151
TBLA0F008603.162ON98042411631e-145
NCAS0C035603.162ON6415469251e-113
YHR102W (KIC1)5.406ON10802682551e-21
Skud_8.1635.406ON10762682541e-21
KNAG0B043205.406ON10273162496e-21
KAFR0D049505.406ON10082672497e-21
Smik_8.1805.406ON10732532471e-20
YDR490C (PKH1)3.92ON7662312451e-20
Suva_15.2975.406ON10742682452e-20
CAGL0L11550g5.406ON10722682442e-20
KNAG0F002901.52ON11252342443e-20
Suva_2.6663.92ON7642302414e-20
Smik_4.7673.92ON7582312414e-20
Skud_4.7643.92ON7562312396e-20
TBLA0B016303.177ON12952602409e-20
NCAS0H019405.406ON10152682391e-19
TPHA0G032002.479ON15342422391e-19
YDR507C (GIN4)1.52ON11422342391e-19
NDAI0C017005.406ON10202682381e-19
Smik_4.7891.52ON11362342362e-19
CAGL0K05709g1.52ON11032272344e-19
Suva_2.6871.52ON11282342344e-19
ZYRO0A06446g5.406ON9432532344e-19
TBLA0A071501.52ON13912342344e-19
TDEL0E021805.406ON9872682326e-19
CAGL0I07513g3.92ON10762292327e-19
NCAS0C049403.92ON11162262311e-18
SAKL0E02860g2.479ON13772352311e-18
Skud_4.7831.52ON11352342301e-18
KLLA0C12485g3.92ON9252272291e-18
NCAS0A080805.611ON6232452272e-18
CAGL0M08910g5.611ON6122952262e-18
TPHA0C004705.611ON6312452262e-18
TBLA0D022308.141ON11542862272e-18
YOL100W (PKH2)3.92ON10812332273e-18
Kpol_495.145.611ON6242452253e-18
KNAG0B032305.611ON6412972243e-18
ABL034W2.479ON14252352264e-18
Ecym_10581.52ON11642342264e-18
NCAS0B086001.52ON11172342245e-18
Ecym_73922.479ON14342352247e-18
SAKL0C09174g3.92ON10712272237e-18
Kpol_1018.655.611ON6012452218e-18
Suva_2.6515.611ON6332452211e-17
TPHA0D028405.611ON6342452201e-17
KLLA0F14190g1.271ON13382592221e-17
CAGL0K02673g2.496ON9152472211e-17
SAKL0C01716g1.52ON12152362221e-17
KLLA0F13552g2.479ON12672352211e-17
KAFR0C058605.611ON6442512191e-17
ZYRO0B06512g3.92ON11112322212e-17
NDAI0G042903.92ON11132312202e-17
TPHA0E036401.52ON11372362202e-17
TPHA0H016305.406ON10362692202e-17
KLLA0C01650g1.52ON11122342202e-17
TBLA0E033605.611ON6542512182e-17
Smik_15.573.92ON10812292192e-17
KLLA0A03806g5.611ON6022452173e-17
TPHA0M015003.338ON4302422143e-17
Smik_4.7545.611ON6322452163e-17
YDR477W (SNF1)5.611ON6332452164e-17
KAFR0K007007.86ON13812312174e-17
TDEL0D053203.92ON10572332174e-17
TPHA0I009201.271ON14342352174e-17
AFR696C1.52ON11422342175e-17
KLTH0F01672g1.52ON11642342165e-17
Skud_3.391.52ON10172272165e-17
KLLA0D11990g8.482ON3042742075e-17
KAFR0C014403.92ON10952292165e-17
Kpol_1031.105.406ON11271902165e-17
KLTH0E11220g8.482ON3022792076e-17
Skud_4.7515.611ON6342452147e-17
Kwal_26.77882.479ON12672352157e-17
KNAG0A065402.479ON14322352157e-17
TDEL0C064901.52ON11532342158e-17
Smik_3.541.52ON10322292148e-17
KLTH0C10912g6.31ON6972482139e-17
KLLA0A02497g4.184ON3621932089e-17
NDAI0A006601.52ON10222342149e-17
KNAG0E008506.31ON7112502131e-16
Kpol_499.34.184ON3741922071e-16
Kwal_47.182335.611ON5982892121e-16
Ecym_35863.92ON10772172131e-16
NDAI0H009405.611ON6852452121e-16
SAKL0H06534g8.676ON8042512121e-16
TBLA0I002802.496ON13162482131e-16
KAFR0D033902.496ON7982202112e-16
TPHA0C017808.482ON3052802032e-16
Kwal_26.78612.496ON9552352122e-16
Skud_15.543.92ON10822302122e-16
Kpol_431.92.479ON15522352122e-16
CAGL0D01694g3.338ON4321892072e-16
Kwal_56.224766.31ON6972482102e-16
TDEL0D026504.184ON3661902052e-16
Kpol_463.81.271ON14472362122e-16
KLTH0D05566g2.479ON11282352112e-16
KAFR0H015308.482ON3062692032e-16
SAKL0G06952g5.611ON5992952092e-16
AGL242C8.482ON3032782022e-16
TBLA0A035705.406ON9752472112e-16
TDEL0B015408.482ON3042002022e-16
Kpol_2002.461.52ON11232362112e-16
KLTH0D03454g1.271ON14332562112e-16
TBLA0C029401.271ON16432572112e-16
TBLA0B082503.92ON13472342112e-16
SAKL0B04488g4.184ON3681952052e-16
KLTH0C09548g3.92ON9932262102e-16
TDEL0A025502.479ON13692352113e-16
SAKL0C07722g3.177ON9122542103e-16
Kwal_26.73551.271ON14462442113e-16
Sklu_YGOB_Anc_2.4962.496ON6192292083e-16
CAGL0I09504g1.336ON5281702073e-16
Kwal_56.226933.92ON9842262093e-16
ZYRO0A12826g4.184ON3661902043e-16
AEL230W5.611ON6082452083e-16
CAGL0K08514g2.479ON14892372103e-16
NDAI0G034508.141ON9482992093e-16
TDEL0A027202.496ON9152332094e-16
KAFR0D041001.52ON11172362094e-16
KLLA0B11946g3.338ON4392692054e-16
Skud_16.2518.482ON3052002004e-16
KLLA0E03587g5.591ON6472322074e-16
Ecym_55055.406ON10032902084e-16
TPHA0P010503.92ON11212342084e-16
NCAS0C024708.482ON3112792004e-16
Ecym_24342.496ON11222502085e-16
Ecym_25318.482ON3012781995e-16
Suva_10.2028.302ON4352162045e-16
TBLA0E027905.591ON8082592075e-16
ZYRO0A05544g5.611ON6312452065e-16
SAKL0G01848g5.406ON8852682075e-16
Skud_12.1818.302ON4312162036e-16
YPL031C (PHO85)8.482ON3052791996e-16
KLLA0C04191g3.177ON7972462066e-16
NCAS0A057702.479ON14612352076e-16
NDAI0G054701.271ON15552622077e-16
Skud_10.1191.271ON14812492077e-16
KLLA0E21693g5.406ON10162542067e-16
Smik_12.1738.302ON4352162027e-16
Ecym_55885.611ON6132512058e-16
ZYRO0F08074g8.482ON3042711988e-16
TBLA0A084304.184ON3631902008e-16
Suva_16.2868.482ON3052801988e-16
YJL095W (BCK1)1.271ON14782502068e-16
Suva_3.1106.341ON13762492069e-16
TBLA0H016605.406ON9962682069e-16
Kpol_1007.178.482ON3072791971e-15
CAGL0L12474g8.482ON3022001971e-15
KNAG0C024401.182ON4012012011e-15
Smik_16.2963.338ON3882712001e-15
ACL104C5.406ON9472532051e-15
Suva_15.653.92ON10802292051e-15
Skud_11.1262.479ON15182352051e-15
CAGL0K04169g4.184ON3982032001e-15
KAFR0A014201.271ON13982662051e-15
ZYRO0F17402g1.52ON11892342051e-15
NDAI0D040504.184ON3662301991e-15
TPHA0J004206.31ON7072502031e-15
Kpol_1054.23.92ON10962352041e-15
TPHA0H007603.177ON9802562041e-15
KLTH0G05698g5.611ON5972452021e-15
Kpol_1055.242.496ON9372502041e-15
SAKL0H11638g8.482ON3042771961e-15
Kwal_55.215455.406ON8652682031e-15
TBLA0I011502.479ON17452362041e-15
KNAG0B053502.496ON8362352032e-15
TDEL0A047805.611ON6212452022e-15
SAKL0E01584g6.31ON6952492022e-15
ZYRO0G15290g1.271ON14872372042e-15
Ecym_61454.184ON3651921982e-15
KAFR0A050906.31ON6681712022e-15
YCL024W (KCC4)1.52ON10372292032e-15
KNAG0A023108.482ON3022791952e-15
SAKL0G06402g5.591ON7842302022e-15
KAFR0D032002.479ON14482362032e-15
ACL191C4.184ON3651931972e-15
ACR142W8.676ON8372452022e-15
NCAS0A094701.271ON15152632032e-15
SAKL0D06534g1.336ON5222342002e-15
KLTH0E16126g3.177ON8682292022e-15
YLR113W (HOG1)8.302ON4352151982e-15
Smik_10.1471.271ON14782502022e-15
YPR054W (SMK1)3.338ON3882711973e-15
Skud_2.4061.336ON5272321993e-15
NDAI0B047001.336ON5281711993e-15
YKL101W (HSL1)2.479ON15182362023e-15
AFR335C3.92ON10332172013e-15
Smik_11.1392.479ON15342362023e-15
Skud_1.723.177ON9742532013e-15
TPHA0G032902.496ON9732392014e-15
Kpol_1023.266.31ON7392512004e-15
Ecym_34883.338ON4372591974e-15
KLTH0D06006g2.496ON9542342004e-15
NDAI0E021108.676ON9032832004e-15
KNAG0K006803.92ON10952362004e-15
Suva_6.1691.271ON14842492005e-15
Suva_11.1232.479ON15262362005e-15
Kpol_1040.207.86ON12971652005e-15
ZYRO0D06182g8.302ON4312151965e-15
Suva_3.1901.52ON10242291995e-15
TBLA0H013308.302ON4812151965e-15
Smik_1.793.177ON9742601996e-15
TPHA0H026307.86ON13672301996e-15
SAKL0H16038g8.302ON4342161956e-15
ZYRO0B09196g1.336ON5162291967e-15
NDAI0E023208.654ON9322651987e-15
TPHA0E038501.24ON4823071957e-15
Kwal_27.97633.177ON8682261987e-15
Skud_11.675.274ON5083281958e-15
KNAG0B017801.271ON15802361988e-15
KLTH0A06776g6.341ON15232391988e-15
KLTH0G17512g4.184ON3651921928e-15
YMR001C (CDC5)6.31ON7052271978e-15
KAFR0A017602.496ON8852531978e-15
YAR019C (CDC15)3.177ON9742541979e-15
ZYRO0G03366g2.479ON16162351989e-15
ZYRO0B01166g2.496ON9632501979e-15
NDAI0G027008.302ON4472551949e-15
Smik_11.621.182ON3972131939e-15
KLTH0F16676g5.406ON8782541979e-15
KLLA0F20053g8.302ON4442151941e-14
Skud_13.1546.31ON7052271961e-14
NDAI0A038702.496ON8952481971e-14
Kwal_56.238418.302ON4322151931e-14
KLTH0D11242g8.676ON7952361961e-14
KLLA0F11143g8.676ON8132031961e-14
CAGL0M11748g8.302ON4472151931e-14
CAGL0G04609g3.92ON9652531971e-14
TPHA0J006304.184ON3741931921e-14
NCAS0C041008.141ON9052261961e-14
Skud_11.581.182ON3952131921e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C03828g
         (793 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...  1544   0.0  
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   645   0.0  
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   642   0.0  
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   642   0.0  
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   642   0.0  
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    584   0.0  
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   571   0.0  
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   545   0.0  
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....   541   0.0  
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   543   0.0  
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   538   e-179
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   529   e-177
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   529   e-177
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   526   e-176
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   521   e-174
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   520   e-173
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   517   e-172
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...   483   e-159
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   462   e-151
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   452   e-145
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...   360   e-113
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   102   1e-21
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   102   1e-21
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   100   6e-21
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   100   7e-21
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   100   1e-20
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    99   1e-20
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    99   2e-20
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    99   2e-20
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    99   3e-20
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    97   4e-20
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    97   4e-20
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    97   6e-20
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    97   9e-20
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    97   1e-19
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    97   1e-19
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    97   1e-19
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    96   1e-19
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    96   2e-19
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    95   4e-19
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    95   4e-19
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    95   4e-19
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    95   4e-19
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    94   6e-19
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    94   7e-19
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    94   1e-18
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    94   1e-18
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    93   1e-18
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    93   1e-18
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    92   2e-18
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    92   2e-18
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    92   2e-18
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    92   2e-18
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    92   3e-18
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    91   3e-18
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    91   3e-18
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    92   4e-18
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    92   4e-18
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    91   5e-18
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    91   7e-18
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    91   7e-18
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    90   8e-18
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    90   1e-17
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               89   1e-17
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    90   1e-17
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    90   1e-17
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    90   1e-17
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    90   1e-17
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    89   1e-17
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    90   2e-17
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    89   2e-17
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    89   2e-17
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    89   2e-17
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    89   2e-17
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    89   2e-17
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    89   2e-17
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    88   3e-17
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    87   3e-17
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    88   3e-17
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    88   4e-17
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    88   4e-17
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    88   4e-17
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    88   4e-17
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    88   5e-17
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    88   5e-17
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    88   5e-17
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    84   5e-17
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    88   5e-17
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    88   5e-17
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    84   6e-17
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    87   7e-17
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    87   7e-17
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    87   7e-17
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    87   8e-17
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    87   8e-17
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    87   9e-17
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    85   9e-17
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     87   9e-17
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    87   1e-16
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    84   1e-16
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    86   1e-16
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    87   1e-16
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    86   1e-16
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    86   1e-16
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    87   1e-16
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    86   2e-16
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    83   2e-16
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    86   2e-16
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    86   2e-16
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    86   2e-16
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    84   2e-16
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    86   2e-16
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    84   2e-16
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    86   2e-16
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    86   2e-16
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    83   2e-16
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    85   2e-16
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    82   2e-16
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    86   2e-16
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    82   2e-16
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    86   2e-16
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    86   2e-16
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    86   2e-16
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    86   2e-16
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    84   2e-16
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    86   2e-16
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    86   3e-16
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    86   3e-16
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    86   3e-16
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    85   3e-16
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    84   3e-16
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    85   3e-16
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    83   3e-16
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    85   3e-16
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    86   3e-16
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     85   3e-16
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    85   4e-16
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    85   4e-16
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    84   4e-16
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    82   4e-16
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    84   4e-16
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    85   4e-16
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    85   4e-16
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    82   4e-16
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    85   5e-16
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    81   5e-16
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    83   5e-16
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    84   5e-16
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    84   5e-16
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    84   5e-16
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    83   6e-16
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    81   6e-16
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    84   6e-16
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    84   6e-16
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    84   7e-16
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    84   7e-16
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    84   7e-16
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    82   7e-16
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    84   8e-16
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    81   8e-16
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    82   8e-16
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    81   8e-16
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    84   8e-16
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    84   9e-16
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    84   9e-16
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    80   1e-15
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    80   1e-15
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    82   1e-15
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    82   1e-15
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    84   1e-15
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    84   1e-15
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    84   1e-15
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    82   1e-15
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    84   1e-15
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    84   1e-15
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     81   1e-15
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    83   1e-15
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    83   1e-15
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    83   1e-15
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    82   1e-15
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    83   1e-15
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    80   1e-15
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    83   1e-15
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    83   1e-15
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    83   2e-15
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    82   2e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    82   2e-15
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    83   2e-15
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    81   2e-15
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             82   2e-15
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    83   2e-15
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    80   2e-15
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    82   2e-15
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    83   2e-15
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    80   2e-15
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    82   2e-15
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    83   2e-15
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    82   2e-15
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    82   2e-15
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    81   2e-15
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    82   2e-15
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    80   3e-15
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    81   3e-15
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    81   3e-15
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    82   3e-15
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    82   3e-15
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    82   3e-15
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    82   3e-15
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    82   4e-15
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    82   4e-15
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    80   4e-15
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    82   4e-15
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    82   4e-15
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    82   4e-15
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    82   5e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    82   5e-15
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    82   5e-15
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    80   5e-15
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    81   5e-15
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    80   5e-15
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    81   6e-15
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    81   6e-15
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    80   6e-15
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    80   7e-15
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               81   7e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    80   7e-15
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    81   7e-15
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    80   8e-15
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    81   8e-15
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    81   8e-15
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    79   8e-15
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    80   8e-15
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    80   8e-15
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    80   9e-15
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    81   9e-15
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    80   9e-15
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    79   9e-15
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    79   9e-15
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    80   9e-15
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    79   1e-14
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    80   1e-14
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     80   1e-14
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    79   1e-14
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    80   1e-14
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    80   1e-14
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    79   1e-14
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    80   1e-14
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    79   1e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     80   1e-14
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    79   1e-14
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    80   1e-14
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    80   1e-14
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    79   1e-14
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    80   1e-14
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    79   1e-14
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    79   1e-14
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    79   1e-14
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    80   1e-14
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    79   1e-14
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    79   1e-14
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    79   1e-14
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    78   1e-14
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    80   1e-14
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    80   1e-14
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    78   2e-14
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    79   2e-14
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    80   2e-14
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    79   2e-14
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    79   2e-14
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    78   2e-14
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    78   2e-14
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    78   2e-14
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    79   2e-14
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    78   2e-14
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    78   2e-14
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    78   2e-14
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    78   2e-14
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    79   2e-14
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    77   2e-14
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    79   2e-14
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    78   2e-14
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    78   2e-14
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    79   2e-14
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    77   2e-14
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    79   2e-14
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    78   2e-14
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    79   2e-14
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    79   2e-14
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    77   2e-14
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    79   3e-14
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    77   3e-14
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    79   3e-14
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    79   3e-14
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    79   3e-14
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    79   3e-14
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    76   3e-14
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    79   3e-14
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    79   3e-14
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    77   3e-14
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    78   3e-14
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    79   3e-14
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    76   4e-14
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    79   4e-14
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    78   4e-14
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    79   4e-14
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    79   4e-14
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    79   4e-14
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    77   4e-14
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    77   4e-14
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    76   5e-14
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    78   5e-14
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    78   5e-14
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    78   5e-14
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    77   5e-14
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    75   5e-14
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    77   5e-14
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    77   5e-14
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    74   5e-14
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    78   6e-14
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    77   6e-14
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    78   6e-14
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    78   6e-14
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    77   6e-14
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    78   6e-14
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    78   6e-14
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    77   6e-14
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    76   6e-14
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    77   7e-14
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    78   7e-14
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    78   7e-14
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    77   7e-14
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    75   7e-14
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    77   7e-14
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    75   7e-14
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    77   8e-14
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    77   8e-14
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    78   8e-14
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    77   8e-14
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    77   8e-14
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    75   8e-14
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    76   9e-14
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    77   9e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    76   9e-14
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    74   9e-14
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    76   1e-13
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    76   1e-13
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    77   1e-13
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    75   1e-13
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    77   1e-13
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    76   1e-13
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    76   1e-13
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    77   1e-13
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    77   1e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    77   1e-13
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    77   1e-13
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    74   1e-13
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    75   1e-13
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    76   1e-13
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    77   1e-13
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    74   1e-13
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    77   1e-13
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    74   1e-13
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    74   1e-13
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    74   1e-13
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    76   1e-13
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    76   2e-13
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    77   2e-13
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    75   2e-13
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    77   2e-13
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    76   2e-13
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    76   2e-13
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    76   2e-13
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    76   2e-13
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    76   2e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    77   2e-13
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    75   2e-13
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    74   2e-13
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    76   2e-13
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    75   2e-13
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    76   2e-13
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    75   2e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    76   2e-13
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    73   2e-13
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    75   2e-13
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    76   2e-13
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    74   3e-13
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    76   3e-13
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    74   3e-13
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    73   3e-13
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    76   3e-13
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    75   3e-13
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    75   3e-13
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    76   3e-13
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    75   3e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    76   3e-13
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    71   3e-13
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              75   3e-13
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      76   3e-13
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    74   4e-13
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    75   4e-13
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    74   4e-13
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    75   4e-13
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    74   4e-13
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    72   5e-13
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    73   5e-13
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    72   5e-13
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    74   5e-13
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    75   5e-13
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    74   5e-13
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      75   5e-13
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    75   5e-13
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    74   5e-13
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    74   5e-13
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    75   6e-13
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    75   6e-13
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    74   6e-13
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    74   6e-13
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    74   6e-13
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    74   6e-13
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    74   6e-13
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    75   6e-13
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    74   6e-13
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    74   6e-13
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    75   6e-13
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    75   7e-13
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    74   7e-13
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    74   7e-13
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    74   7e-13
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    75   7e-13
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    74   7e-13
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    74   7e-13
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    74   8e-13
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    74   8e-13
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    74   8e-13
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    74   9e-13
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              72   9e-13
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    74   9e-13
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    73   9e-13
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    74   1e-12
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    74   1e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    74   1e-12
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    74   1e-12
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    72   1e-12
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    73   1e-12
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    74   1e-12
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    74   1e-12
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     72   1e-12
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    72   1e-12
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    74   1e-12
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    72   1e-12
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    73   1e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    74   1e-12
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       74   1e-12
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    72   1e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    74   1e-12
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    72   1e-12
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    73   1e-12
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    73   1e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    74   1e-12
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              73   1e-12
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    72   1e-12
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    73   1e-12
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    73   1e-12
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    74   1e-12
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    72   1e-12
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    74   2e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    73   2e-12
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    74   2e-12
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    71   2e-12
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    73   2e-12
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    72   2e-12
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    73   2e-12
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    72   2e-12
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    73   2e-12
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    72   2e-12
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    72   2e-12
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    73   2e-12
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    72   2e-12
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    70   2e-12
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    71   2e-12
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    72   2e-12
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               73   2e-12
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     73   2e-12
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     72   2e-12
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    73   2e-12
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    73   2e-12
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    73   2e-12
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    70   2e-12
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    72   3e-12
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    72   3e-12
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    72   3e-12
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    72   3e-12
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    72   3e-12
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    73   3e-12
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    72   3e-12
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    73   3e-12
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    71   3e-12
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    72   3e-12
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    72   3e-12
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    72   3e-12
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    72   3e-12
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    72   3e-12
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     72   3e-12
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    72   3e-12
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    72   3e-12
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    72   3e-12
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    72   3e-12
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    72   3e-12
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    72   3e-12
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    72   3e-12
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    71   3e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    72   3e-12
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    71   3e-12
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    71   3e-12
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    71   4e-12
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    72   4e-12
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    72   4e-12
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    72   4e-12
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    72   4e-12
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    72   4e-12
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    72   4e-12
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    71   4e-12
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    70   4e-12
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    72   4e-12
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    71   4e-12
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    71   4e-12
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    72   4e-12
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    72   4e-12
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    72   4e-12
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    71   4e-12
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    72   4e-12
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    71   4e-12
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     72   4e-12
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    72   4e-12
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    71   5e-12
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    71   5e-12
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    69   5e-12
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    71   5e-12
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    71   5e-12
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    71   5e-12
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    72   5e-12
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    71   5e-12
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    71   5e-12
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    71   5e-12
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    71   5e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    71   5e-12
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    69   5e-12
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    71   5e-12
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    71   6e-12
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    71   6e-12
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    71   6e-12
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    71   6e-12
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    71   6e-12
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    72   6e-12
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    71   6e-12
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    71   7e-12
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     69   7e-12
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    70   7e-12
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    70   7e-12
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               70   7e-12
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    71   7e-12
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    70   7e-12
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     71   7e-12
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    71   8e-12
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    71   8e-12
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              71   8e-12
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    71   8e-12
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    70   8e-12
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    71   8e-12
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    71   8e-12
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    70   8e-12
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    70   8e-12
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    71   8e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    70   8e-12
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    71   8e-12
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    71   8e-12
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    70   9e-12
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    71   9e-12
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    70   9e-12
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    71   9e-12
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    70   9e-12
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    70   9e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    69   9e-12
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    70   9e-12
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    71   9e-12
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    70   1e-11
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    70   1e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    70   1e-11
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    70   1e-11
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    70   1e-11
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    70   1e-11
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    70   1e-11
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               70   1e-11
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    70   1e-11
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    70   1e-11
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    70   1e-11
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    70   1e-11
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    70   1e-11
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    70   1e-11
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    70   1e-11
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    70   1e-11
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    70   1e-11
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    70   1e-11
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    70   1e-11
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    70   1e-11
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    70   1e-11
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    70   1e-11
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    69   1e-11
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    70   1e-11
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    70   1e-11
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    69   1e-11
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    69   1e-11
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    70   1e-11
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    70   1e-11
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    70   1e-11
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    70   2e-11
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    70   2e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    70   2e-11
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    70   2e-11
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    69   2e-11
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    69   2e-11
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    70   2e-11
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    70   2e-11
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    70   2e-11
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    70   2e-11
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    67   2e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    70   2e-11
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    70   2e-11
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    70   2e-11
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    70   2e-11
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    69   2e-11
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    68   2e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    70   2e-11
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    70   2e-11
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    70   2e-11
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    69   2e-11
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    69   2e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    69   2e-11
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    69   2e-11
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              69   2e-11
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    69   2e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    69   2e-11
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    69   2e-11
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    69   2e-11
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    69   2e-11
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               69   2e-11
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    69   3e-11
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    69   3e-11
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    69   3e-11
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    69   3e-11
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    69   3e-11
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    69   3e-11
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    69   3e-11
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    69   3e-11
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    69   3e-11
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    69   3e-11
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    69   3e-11
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    68   3e-11
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    69   3e-11
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    68   3e-11
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    69   3e-11
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    69   3e-11
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    69   3e-11
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    68   3e-11
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    69   3e-11
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              69   3e-11
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    69   3e-11
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    68   3e-11
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    68   3e-11
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    68   4e-11
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    67   4e-11
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    69   4e-11
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    68   4e-11
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    69   4e-11
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    69   4e-11
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       68   4e-11
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    69   4e-11
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    69   4e-11
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    69   4e-11
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    69   4e-11
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    68   4e-11
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    69   4e-11
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             69   4e-11
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    68   4e-11
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    69   4e-11
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    69   4e-11
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       69   5e-11
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    68   5e-11
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     68   5e-11
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    68   5e-11
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    67   5e-11
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    68   5e-11
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    68   5e-11
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    68   5e-11
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    67   5e-11
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    68   5e-11
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    68   5e-11
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    68   6e-11
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        68   6e-11
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    67   6e-11
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    67   6e-11
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    68   6e-11
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    68   6e-11
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    68   6e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    68   6e-11
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    68   6e-11
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    68   6e-11
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    68   6e-11
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    67   6e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    68   6e-11
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    68   6e-11
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    67   6e-11
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    67   6e-11
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    67   7e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    68   7e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    68   7e-11
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    68   7e-11
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    67   7e-11
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    67   7e-11
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    67   7e-11
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    68   7e-11
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    67   7e-11
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    68   7e-11
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    68   7e-11
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    67   7e-11
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    67   7e-11
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    67   7e-11
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    68   7e-11
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    68   7e-11
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    68   7e-11
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    68   8e-11
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    67   8e-11
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    68   8e-11
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    67   8e-11
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    67   8e-11
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    68   8e-11
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    68   8e-11
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    67   8e-11
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    67   8e-11
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    67   8e-11
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    67   8e-11
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    68   8e-11
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    67   8e-11
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    67   8e-11
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    67   8e-11
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    67   1e-10
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    67   1e-10
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    67   1e-10
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    67   1e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    67   1e-10
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    67   1e-10
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    65   1e-10
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    67   1e-10
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    67   1e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    67   1e-10
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    67   1e-10
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    67   1e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    67   1e-10
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    67   1e-10
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    67   1e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    67   1e-10
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    67   1e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    67   1e-10
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    65   1e-10
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    67   1e-10
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    65   1e-10
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    67   1e-10
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    66   1e-10
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    67   1e-10
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    66   1e-10
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    66   1e-10
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    67   1e-10
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    67   1e-10
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    67   2e-10
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    67   2e-10
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    66   2e-10
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    66   2e-10
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    67   2e-10
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    67   2e-10
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    66   2e-10
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    66   2e-10
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    66   2e-10
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    67   2e-10
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    65   2e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    66   2e-10
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    65   2e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    67   2e-10
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    65   2e-10
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    66   2e-10
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    66   2e-10
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    66   2e-10
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    65   2e-10
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    66   2e-10
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    66   2e-10
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    66   2e-10
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    66   2e-10
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    66   2e-10
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    66   3e-10
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    65   3e-10
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    65   3e-10
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    66   3e-10
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    65   3e-10
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    66   3e-10
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    65   3e-10
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    65   3e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    66   3e-10
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    65   3e-10
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    66   3e-10
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    66   3e-10
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    66   3e-10
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    65   3e-10
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     65   3e-10
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    66   3e-10
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    64   3e-10
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    65   3e-10
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    66   3e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    65   3e-10
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    65   3e-10
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    65   3e-10
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    65   3e-10
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    65   3e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    65   4e-10
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    65   4e-10
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    65   4e-10
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    65   4e-10
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    65   4e-10
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    65   4e-10
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    64   4e-10
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    65   4e-10
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    65   4e-10
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    65   4e-10
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    65   4e-10
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    64   4e-10
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    65   4e-10
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    65   4e-10
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    65   4e-10
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    65   4e-10
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    65   4e-10
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    65   4e-10
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    65   4e-10
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    64   4e-10
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    64   4e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    65   5e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    65   5e-10
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    65   5e-10
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    65   5e-10
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    65   5e-10
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    65   5e-10
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    65   5e-10
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    65   5e-10
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    64   5e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    65   5e-10
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    65   5e-10
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    65   5e-10
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    65   5e-10
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    65   5e-10
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    65   6e-10
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    65   6e-10
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    65   6e-10
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    64   6e-10
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    65   6e-10
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    64   6e-10
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    65   6e-10
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    65   7e-10
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    65   7e-10
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    65   7e-10
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    64   7e-10
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    64   7e-10
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    64   7e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    64   7e-10
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    64   7e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    64   8e-10
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    64   8e-10
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    64   8e-10
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    64   8e-10
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    64   8e-10
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               64   8e-10
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    64   8e-10
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    63   8e-10
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    64   8e-10
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    63   8e-10
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    64   8e-10
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    63   8e-10
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    64   9e-10
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    64   9e-10
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    64   9e-10
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    64   9e-10
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    63   9e-10
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    64   9e-10
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    64   9e-10
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               64   1e-09
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    63   1e-09
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    64   1e-09
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    64   1e-09
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    63   1e-09
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    63   1e-09
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    64   1e-09
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    64   1e-09
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    64   1e-09
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    63   1e-09
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              64   1e-09
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    64   1e-09
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    64   1e-09
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    64   1e-09
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    64   1e-09
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    64   1e-09
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    64   1e-09
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    64   1e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    64   1e-09
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    64   1e-09
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    63   1e-09
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    63   1e-09
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    63   1e-09
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    64   1e-09
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    64   1e-09
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    64   2e-09
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    63   2e-09
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    63   2e-09
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    63   2e-09
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    64   2e-09
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    64   2e-09
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    63   2e-09
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    62   2e-09
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    63   2e-09
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               62   2e-09
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    63   2e-09
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    63   2e-09
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    62   2e-09
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    63   2e-09
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    63   2e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    64   2e-09
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              64   2e-09
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    63   2e-09
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    63   2e-09
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     63   2e-09
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    62   2e-09
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    62   2e-09
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    63   2e-09
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    63   2e-09
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    63   2e-09
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    63   2e-09
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    62   2e-09
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    63   2e-09
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    62   2e-09
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    63   2e-09
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    63   2e-09
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    63   2e-09
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    62   2e-09
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    63   2e-09
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    63   2e-09
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    63   3e-09
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    63   3e-09
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    63   3e-09
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    63   3e-09
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    63   3e-09
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    62   3e-09
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    63   3e-09
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    62   3e-09
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    63   3e-09
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    62   3e-09
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    62   3e-09
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    62   3e-09
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    62   3e-09
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    63   3e-09
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    63   3e-09
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    63   3e-09
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    61   3e-09
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    62   3e-09
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    62   3e-09
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    62   3e-09
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    62   3e-09
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    62   3e-09
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    62   3e-09
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    62   3e-09
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    62   4e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    62   4e-09
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    62   4e-09
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    62   4e-09
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    62   4e-09
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    62   4e-09
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    62   4e-09
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    62   4e-09
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    62   4e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    62   4e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    61   4e-09
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    62   4e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    62   4e-09
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    61   4e-09
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    62   4e-09
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    62   5e-09
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    62   5e-09
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     62   5e-09
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    61   5e-09
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    61   5e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    61   5e-09
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    62   5e-09
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    62   5e-09
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    62   5e-09
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    62   5e-09
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    62   5e-09
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    62   5e-09
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    62   5e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    62   5e-09
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    62   5e-09
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    62   6e-09
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    62   6e-09
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    62   6e-09
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    62   6e-09
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    62   6e-09
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    62   6e-09
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    62   6e-09
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    60   6e-09
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    61   6e-09
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    62   6e-09
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    62   6e-09
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    62   6e-09
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    61   6e-09
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    61   7e-09
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    62   7e-09
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    61   7e-09
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    61   7e-09
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    60   7e-09
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    61   7e-09
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    61   7e-09
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    60   7e-09
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    60   7e-09
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    61   7e-09
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    61   7e-09
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    60   8e-09
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    61   8e-09
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    61   8e-09
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    61   8e-09
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    61   8e-09
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    61   8e-09
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    61   8e-09
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    61   8e-09
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    60   8e-09
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    60   9e-09
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    61   1e-08
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    60   1e-08
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    60   1e-08
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    59   1e-08
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    60   1e-08
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    61   1e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    60   1e-08
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    60   1e-08
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    60   1e-08
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    60   1e-08
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    60   1e-08
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    59   1e-08
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    60   1e-08
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     60   1e-08
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    61   1e-08
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    60   1e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    60   1e-08
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    60   1e-08
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    60   1e-08
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    61   1e-08
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    60   1e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    60   1e-08
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    60   1e-08
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    60   1e-08
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    60   1e-08
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    60   1e-08
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    60   1e-08
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    60   1e-08
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    60   1e-08
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    60   2e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    60   2e-08
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    60   2e-08
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    60   2e-08
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    60   2e-08
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    60   2e-08
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    59   2e-08
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    59   2e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    60   2e-08
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    59   2e-08
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    60   2e-08
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    60   2e-08
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    60   2e-08
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    59   2e-08
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    60   2e-08
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    60   2e-08
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    60   2e-08
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    59   2e-08
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    60   2e-08
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    60   2e-08
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    59   2e-08
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    59   2e-08
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      60   2e-08
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    60   2e-08
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    60   2e-08
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    59   2e-08
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    60   2e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    59   2e-08
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    59   2e-08
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     59   3e-08
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    59   3e-08
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    59   3e-08
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    59   3e-08
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    59   3e-08
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    59   3e-08
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    59   3e-08
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    59   3e-08
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    59   3e-08
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    59   3e-08
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    59   3e-08
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    58   3e-08
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    59   3e-08
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    58   3e-08
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    59   3e-08
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    59   3e-08
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    59   3e-08
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    59   3e-08
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    59   3e-08
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    59   3e-08
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    59   3e-08
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    59   4e-08
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    59   4e-08
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    59   4e-08
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    59   4e-08
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    59   4e-08
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    58   4e-08
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    59   4e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    59   4e-08
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    59   4e-08
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    59   4e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    59   4e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    59   4e-08
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    59   4e-08
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    59   4e-08
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    57   4e-08
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    59   4e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    57   5e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    59   5e-08
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    59   5e-08
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    59   5e-08
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     59   5e-08
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    58   5e-08
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    58   5e-08
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    59   5e-08
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    59   5e-08
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    59   5e-08
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    59   5e-08
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    59   5e-08
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    59   5e-08
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    59   6e-08
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    59   6e-08
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    58   6e-08
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    58   6e-08
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    57   6e-08
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    58   6e-08
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    58   6e-08
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    57   6e-08
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    58   6e-08
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    58   6e-08
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    59   6e-08
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    58   6e-08
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    58   6e-08
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    58   6e-08
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    57   6e-08
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    58   6e-08
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    57   6e-08
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    58   7e-08
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    59   7e-08
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    57   7e-08
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    58   7e-08
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    58   7e-08
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    58   7e-08
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    58   7e-08
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    58   7e-08
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    58   7e-08
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    58   7e-08
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    57   7e-08
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    57   7e-08
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    58   7e-08
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    58   7e-08
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    58   7e-08
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    58   7e-08
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    58   8e-08
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    54   8e-08
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    58   8e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     57   8e-08
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    58   8e-08
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    57   8e-08
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    58   8e-08
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    58   8e-08
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    58   8e-08
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    58   9e-08
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    57   9e-08
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    58   9e-08
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    58   9e-08
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    57   9e-08
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              58   9e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    58   9e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    57   9e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    58   9e-08
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    57   9e-08
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    58   9e-08
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    58   9e-08
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    58   9e-08
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    57   9e-08
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    57   9e-08
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    58   9e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               57   9e-08
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    57   9e-08
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    58   9e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    57   9e-08
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    58   1e-07
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    58   1e-07
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    58   1e-07
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    57   1e-07
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    57   1e-07
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    58   1e-07
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    57   1e-07
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    57   1e-07
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    57   1e-07
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    57   1e-07
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    58   1e-07
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    57   1e-07
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    57   1e-07
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    57   1e-07
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    57   1e-07
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    57   1e-07
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    57   1e-07
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               57   1e-07
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    55   1e-07
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    57   1e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    57   1e-07
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    57   1e-07
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    57   1e-07
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    57   1e-07
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    57   1e-07
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    57   1e-07
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    57   1e-07
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    57   1e-07
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    57   1e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    57   1e-07
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     57   1e-07
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    57   1e-07
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    57   1e-07
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    57   1e-07
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    57   1e-07
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    57   1e-07
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    57   1e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    57   1e-07
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    57   1e-07
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    57   1e-07
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    57   2e-07
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    57   2e-07
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    57   2e-07
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    57   2e-07
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    57   2e-07
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               57   2e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    56   2e-07
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    56   2e-07
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    57   2e-07
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    57   2e-07
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    57   2e-07
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    57   2e-07
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    57   2e-07
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    57   2e-07
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    57   2e-07
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    57   2e-07
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    57   2e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    57   2e-07
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               57   2e-07
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    57   2e-07
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    56   2e-07
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    57   2e-07
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    57   2e-07
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     57   2e-07
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    57   2e-07
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    57   2e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    56   2e-07
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    56   2e-07
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    56   2e-07
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    56   2e-07
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    55   2e-07
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    56   2e-07
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    56   2e-07
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    56   2e-07
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    56   2e-07
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    56   3e-07
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    56   3e-07
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    55   3e-07
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    56   3e-07
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    55   3e-07
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    56   3e-07
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    55   3e-07
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    56   3e-07
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    56   3e-07
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    56   3e-07
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    56   3e-07
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    56   3e-07
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    56   3e-07
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    56   3e-07
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    56   3e-07
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    55   3e-07
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    56   3e-07
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    56   3e-07
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    55   3e-07
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    55   3e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    55   4e-07
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    55   4e-07
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    55   4e-07
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    56   4e-07
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    55   4e-07
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    55   4e-07
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    55   4e-07
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    55   4e-07
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    55   4e-07
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    55   4e-07
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    55   4e-07
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    55   5e-07
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    54   5e-07
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    55   5e-07
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    55   5e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    55   5e-07
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    54   5e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    54   5e-07
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    55   5e-07
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    55   5e-07
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    55   5e-07
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    55   6e-07
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    55   6e-07
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    55   6e-07
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    55   6e-07
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 55   6e-07
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    55   6e-07
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    55   6e-07
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    54   6e-07
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    55   6e-07
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              55   6e-07
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    55   6e-07
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    55   7e-07
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      55   7e-07
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    55   7e-07
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    55   7e-07
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    55   7e-07
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    54   7e-07
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    55   7e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    55   7e-07
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    55   7e-07
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    55   7e-07
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    54   8e-07
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    55   8e-07
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    55   8e-07
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    55   8e-07
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    54   8e-07
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    54   9e-07
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    55   9e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    55   9e-07
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    54   9e-07
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    54   1e-06
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    54   1e-06
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    54   1e-06
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    54   1e-06
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    54   1e-06
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    54   1e-06
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    54   1e-06
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    54   1e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    54   1e-06
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    54   1e-06
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    54   1e-06
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    54   1e-06
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    53   1e-06
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    54   1e-06
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    54   1e-06
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    54   1e-06
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    54   1e-06
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    54   1e-06
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    53   1e-06
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    53   1e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    54   1e-06
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    54   1e-06
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    54   1e-06
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    54   1e-06
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    54   1e-06
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    54   1e-06
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    54   1e-06
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    53   1e-06
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    54   1e-06
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    54   1e-06
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    54   1e-06
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    54   1e-06
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    53   1e-06
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    54   1e-06
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    54   1e-06
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    54   2e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    54   2e-06
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    54   2e-06
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    54   2e-06
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    54   2e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    53   2e-06
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    54   2e-06
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    54   2e-06
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    53   2e-06
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    53   2e-06
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    53   2e-06
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    53   2e-06
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    54   2e-06
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     53   2e-06
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    53   2e-06
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    54   2e-06
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    53   2e-06
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    53   2e-06
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    54   2e-06
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    53   2e-06
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    53   2e-06
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    53   2e-06
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    54   2e-06
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    53   2e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    53   2e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    54   2e-06
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    53   2e-06
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    54   2e-06
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    53   2e-06
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    52   2e-06
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    53   2e-06
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    54   2e-06
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    53   2e-06
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    53   2e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    53   2e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    53   2e-06
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    53   2e-06
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    53   2e-06
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    52   3e-06
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    53   3e-06
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    52   3e-06
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    52   3e-06
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      53   3e-06
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    53   3e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    53   3e-06
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    52   3e-06
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    53   3e-06
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    53   3e-06
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    53   3e-06
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    53   3e-06
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    52   3e-06
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    52   3e-06
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    53   3e-06
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    52   3e-06
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    52   3e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    53   3e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    53   3e-06
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    52   3e-06
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    52   3e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    53   3e-06
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    52   3e-06
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    52   3e-06
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     52   3e-06
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    52   3e-06
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    52   3e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    52   4e-06
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    52   4e-06
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    52   4e-06
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    52   4e-06
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    52   4e-06
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    52   4e-06
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    53   4e-06
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    52   4e-06
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    52   4e-06
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    52   4e-06
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    52   4e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    52   4e-06
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    52   4e-06
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    52   4e-06
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    51   5e-06
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    52   5e-06
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    52   5e-06
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    52   5e-06
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    52   5e-06
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    52   5e-06
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    52   5e-06
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    52   5e-06
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    52   5e-06
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    52   5e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    52   5e-06
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    52   5e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    52   5e-06
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    52   5e-06
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               52   5e-06
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    51   5e-06
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    52   5e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    52   5e-06
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    52   5e-06
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    52   5e-06
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    51   6e-06
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    52   6e-06
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    52   6e-06
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    52   6e-06
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    51   6e-06
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    51   6e-06
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    52   6e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    52   6e-06
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    51   6e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    51   6e-06
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    52   6e-06
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    52   6e-06
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    52   6e-06
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    52   7e-06
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    51   7e-06
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    51   7e-06
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    51   7e-06
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    51   7e-06
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    51   7e-06
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    51   7e-06
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    51   7e-06
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    51   7e-06
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    52   7e-06
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    51   8e-06
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    51   8e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    52   8e-06
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    51   8e-06
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    51   8e-06
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    51   8e-06
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    50   8e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    51   8e-06
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    51   8e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    51   8e-06
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    51   8e-06
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    51   9e-06
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    51   9e-06
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    51   9e-06
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    51   9e-06
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    51   9e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    51   9e-06
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    50   9e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    51   9e-06
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    50   1e-05
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    50   1e-05
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    51   1e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    51   1e-05
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    51   1e-05
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    51   1e-05
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    51   1e-05
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    51   1e-05
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              51   1e-05
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    50   1e-05
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    50   1e-05
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    51   1e-05
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    51   1e-05
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    50   1e-05
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    50   1e-05
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    51   1e-05
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    50   1e-05
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    50   1e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    50   1e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    51   1e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    50   1e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    50   2e-05
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    50   2e-05
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    50   2e-05
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    50   2e-05
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    50   2e-05
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    50   2e-05
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    50   2e-05
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    50   2e-05
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    50   2e-05
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    50   2e-05
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    50   2e-05
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     50   2e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    50   2e-05
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    50   2e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    50   2e-05
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    50   2e-05
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    50   2e-05
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    50   2e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    50   2e-05
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    50   2e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    50   2e-05
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    50   2e-05
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    49   2e-05
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    50   2e-05
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    50   2e-05
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    50   2e-05
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    50   2e-05
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    49   2e-05
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    49   2e-05
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    50   2e-05
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    50   2e-05
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    49   2e-05
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    50   2e-05
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    49   2e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    50   2e-05
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     49   2e-05
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    50   2e-05
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    50   3e-05
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    50   3e-05
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    50   3e-05
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    50   3e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    49   3e-05
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    50   3e-05
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    49   3e-05
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             49   3e-05
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    49   3e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    50   3e-05
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    49   3e-05
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    49   3e-05
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    50   3e-05
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    49   3e-05
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    49   3e-05
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    49   3e-05
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    49   3e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    50   3e-05
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    49   3e-05
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    49   3e-05
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    49   3e-05
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    49   3e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    49   3e-05
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    49   4e-05
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    49   4e-05
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    49   4e-05
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    49   4e-05
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    49   4e-05
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    49   4e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    49   4e-05
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    49   4e-05
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               49   4e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    49   4e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    49   4e-05
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    49   4e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    49   4e-05
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    49   4e-05
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    49   4e-05
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    49   4e-05
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    49   5e-05
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    48   5e-05
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    49   5e-05
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    48   5e-05
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    49   5e-05
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    48   5e-05
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    48   5e-05
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    48   5e-05
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    49   6e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    49   6e-05
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    49   6e-05
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    48   6e-05
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    49   6e-05
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    49   6e-05
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    49   6e-05
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               48   6e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    48   7e-05
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    48   7e-05
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    48   7e-05
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    48   7e-05
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     48   7e-05
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    48   7e-05
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    48   7e-05
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    48   8e-05
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    48   8e-05
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    48   8e-05
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    48   8e-05
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    47   8e-05
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    48   8e-05
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    48   8e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    48   8e-05
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    48   8e-05
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    48   9e-05
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    48   9e-05
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    47   9e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    48   9e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    48   9e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    48   9e-05
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    48   9e-05
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               47   1e-04
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    48   1e-04
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    48   1e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    47   1e-04
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    47   1e-04
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     47   1e-04
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    48   1e-04
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    47   1e-04
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    47   1e-04
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    47   1e-04
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    47   1e-04
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    47   1e-04
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    47   1e-04
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    47   1e-04
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    47   2e-04
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    47   2e-04
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    47   2e-04
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    47   2e-04
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    47   2e-04
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    47   2e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    47   2e-04
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    47   2e-04
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    47   2e-04
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    47   2e-04
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    47   2e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    47   2e-04
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    47   2e-04
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    47   2e-04
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    47   2e-04
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    47   2e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    47   2e-04
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    46   2e-04
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    46   2e-04
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    47   2e-04
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    47   2e-04
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    47   2e-04
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    47   2e-04
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    47   2e-04
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    46   2e-04
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    47   2e-04
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    47   2e-04
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    46   2e-04
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    47   3e-04
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      46   3e-04
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    46   3e-04
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    46   3e-04
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    46   3e-04
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    45   4e-04
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    46   4e-04
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    46   4e-04
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    46   4e-04
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    46   4e-04
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    45   4e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    45   5e-04
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    45   5e-04
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    45   5e-04
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    45   6e-04
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    45   6e-04
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    45   6e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    45   6e-04
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    45   6e-04
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    45   6e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    45   7e-04
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      45   7e-04
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    45   7e-04
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    45   7e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    45   7e-04
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    45   7e-04
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     45   7e-04
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    45   7e-04
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    45   7e-04
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    44   8e-04
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    45   8e-04
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    45   8e-04
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    45   8e-04
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    45   9e-04
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    44   0.001
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    45   0.001
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    45   0.001
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               45   0.001
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    44   0.001
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    45   0.001
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    44   0.001
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    44   0.001
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       44   0.001
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    44   0.001
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    44   0.001
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    44   0.001
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    44   0.002
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    44   0.002
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    44   0.002
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    44   0.002
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    44   0.002
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    44   0.002
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    44   0.002
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    43   0.002
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    44   0.002
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    43   0.002
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    44   0.002
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    43   0.002
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    43   0.003
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    43   0.003
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    43   0.003
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     43   0.003
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    43   0.003
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     43   0.004
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    43   0.004
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    42   0.004
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    42   0.004
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    42   0.004
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    42   0.004
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    43   0.004
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    42   0.004
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    43   0.004
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    42   0.004
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    43   0.004
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    42   0.004
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    42   0.004
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    42   0.004
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    42   0.005
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    42   0.005
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    42   0.005
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    42   0.005
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    42   0.005
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    42   0.005
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    42   0.006
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    42   0.006
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    42   0.006
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    42   0.006
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    42   0.006
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     42   0.006
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    42   0.006
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    42   0.007
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    42   0.007
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    42   0.007
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    41   0.008
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    41   0.008
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    42   0.008
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    41   0.009
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    41   0.009
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    41   0.009
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    41   0.010
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    41   0.010
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    41   0.010
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    41   0.010
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    41   0.011
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    41   0.011
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    41   0.011
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     41   0.012
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    41   0.013
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    41   0.013
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    41   0.013
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    41   0.014
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    41   0.014
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    41   0.014
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    40   0.015
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    41   0.015
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    40   0.016
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    41   0.016
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    40   0.017
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    40   0.018
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    40   0.018
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    40   0.019
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    40   0.020
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    40   0.020
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    40   0.022
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    40   0.024
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    40   0.025
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    40   0.025
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    40   0.026
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    39   0.029
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    40   0.030
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    40   0.031
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    40   0.032
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    40   0.032
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    39   0.033
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    40   0.033
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    39   0.035
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    39   0.036
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    40   0.037
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    39   0.038
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    39   0.038
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    39   0.040
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    39   0.040
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    39   0.041
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    39   0.048
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    39   0.050
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    39   0.053
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    39   0.053
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.053
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    39   0.056
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    39   0.057
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    39   0.058
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    39   0.060
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    39   0.062
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    39   0.063
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    39   0.063
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    39   0.064
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     39   0.066
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    38   0.067
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    39   0.068
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    39   0.070
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    39   0.071
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    39   0.071
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    39   0.074
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    38   0.075
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    39   0.076
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    38   0.076
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    39   0.077
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    38   0.083
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    38   0.088
ZYRO0E02376g Chr5 complement(181177..182817) [1641 bp, 546 aa] {...    38   0.089
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     38   0.091
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    38   0.092
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    38   0.100
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.10 
KLTH0E06952g Chr5 complement(639783..641045) [1263 bp, 420 aa] {...    38   0.10 
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    38   0.10 
TDEL0F01010 Chr6 complement(178943..180418) [1476 bp, 491 aa] {O...    38   0.10 
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    38   0.11 
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    38   0.11 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    38   0.11 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    38   0.11 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    38   0.11 
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    38   0.11 
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    38   0.12 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    38   0.12 
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    38   0.12 
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    38   0.12 
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    38   0.13 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    38   0.13 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    37   0.14 
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    38   0.14 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    37   0.15 
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    37   0.15 
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    37   0.15 
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    37   0.17 
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    37   0.19 
KLLA0E13531g Chr5 (1193481..1194902) [1422 bp, 473 aa] {ON} some...    37   0.19 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    37   0.19 
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    37   0.20 
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     37   0.20 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    37   0.22 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    37   0.22 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    37   0.22 
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    37   0.22 
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    37   0.22 
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    37   0.24 
Kwal_47.17314 s47 complement(347091..348356) [1266 bp, 421 aa] {...    36   0.28 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    37   0.29 
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    36   0.30 
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    36   0.30 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    36   0.30 
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    36   0.31 
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    36   0.32 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    36   0.33 
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    36   0.33 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    36   0.34 
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    36   0.37 
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    36   0.37 
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    36   0.37 
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    36   0.39 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    36   0.44 
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    36   0.52 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    36   0.57 
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    35   0.57 
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    36   0.60 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    35   0.66 
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    35   0.77 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    35   0.79 
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    35   0.84 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    35   1.1  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   1.1  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    35   1.2  
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    35   1.2  
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    34   1.3  
SAKL0H01474g Chr8 (155887..156678) [792 bp, 263 aa] {ON} highly ...    34   1.3  
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    34   1.3  
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    34   1.4  
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    34   1.6  
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    34   1.6  
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    33   2.0  
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    33   2.5  
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    33   2.9  
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    33   4.0  
Suva_6.134 Chr6 (224180..225811) [1632 bp, 543 aa] {ON} YJL058C ...    33   4.3  
Skud_10.154 Chr10 (291036..292622) [1587 bp, 528 aa] {ON} YJL058...    33   4.7  
Smik_10.182 Chr10 complement(317865..319496) [1632 bp, 543 aa] {...    32   5.8  
TDEL0B06290 Chr2 (1112253..1113737) [1485 bp, 494 aa] {ON} Anc_1...    32   6.3  
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    32   6.3  
YJL058C Chr10 complement(326242..327873) [1632 bp, 543 aa] {ON} ...    32   7.2  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    32   7.4  
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    32   8.3  
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    31   9.8  

>KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 793

 Score = 1544 bits (3998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/793 (94%), Positives = 747/793 (94%)

Query: 1   MLGSDGVVRLNQSSFPTAESQHEYSRYQDAKTGLEEPTHSNPLHFVRHFNGRNTTHTSNH 60
           MLGSDGVVRLNQSSFPTAESQHEYSRYQDAKTGLEEPTHSNPLHFVRHFNGRNTTHTSNH
Sbjct: 1   MLGSDGVVRLNQSSFPTAESQHEYSRYQDAKTGLEEPTHSNPLHFVRHFNGRNTTHTSNH 60

Query: 61  TEDQSQSTVFTMVNKQFQPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNEESLMKDDTHS 120
           TEDQSQSTVFTMVNKQFQPSMTTMNTVVKE             KYNKLNEESLMKDDTHS
Sbjct: 61  TEDQSQSTVFTMVNKQFQPSMTTMNTVVKEDNDISNSNSNHDNKYNKLNEESLMKDDTHS 120

Query: 121 HTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSFNVDSPSESR 180
           HTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSFNVDSPSESR
Sbjct: 121 HTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSFNVDSPSESR 180

Query: 181 VXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKD 240
           V                   DIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKD
Sbjct: 181 VDNSQINSSIINDTSNISQQDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKD 240

Query: 241 PSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATS 300
           PSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATS
Sbjct: 241 PSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATS 300

Query: 301 GTLALKREFTQYRRTQTARQPRRKHNFGTDKTSLQDPLSSPLQKNQLVFQEVDRELANKR 360
           GTLALKREFTQYRRTQTARQPRRKHNFGTDKTSLQDPLSSPLQKNQLVFQEVDRELANKR
Sbjct: 301 GTLALKREFTQYRRTQTARQPRRKHNFGTDKTSLQDPLSSPLQKNQLVFQEVDRELANKR 360

Query: 361 EALKPLDVNNPSSSQEAKRPKYENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPK 420
           EALKPLDVNNPSSSQEAKRPKYENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPK
Sbjct: 361 EALKPLDVNNPSSSQEAKRPKYENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPK 420

Query: 421 STVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXX 480
           STVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELL  
Sbjct: 421 STVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLGK 480

Query: 481 XXXXXXXXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMG 540
                       DHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMG
Sbjct: 481 GGSGKVYKVKSSDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMG 540

Query: 541 QGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPAN 600
           QGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPAN
Sbjct: 541 QGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPAN 600

Query: 601 FVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKV 660
           FVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKV
Sbjct: 601 FVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKV 660

Query: 661 GKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVID 720
           GKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVID
Sbjct: 661 GKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVID 720

Query: 721 TIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEEL 780
           TIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEEL
Sbjct: 721 TIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEEL 780

Query: 781 SEDVWNKLAEFKL 793
           SEDVWNKLAEFKL
Sbjct: 781 SEDVWNKLAEFKL 793

>ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL028C
           (MPS1)
          Length = 819

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/815 (46%), Positives = 487/815 (59%), Gaps = 140/815 (17%)

Query: 49  FNGRNTTHTSNHTE----------DQSQSTVFTMVNKQFQPSMTTMNTVVKEXXXXXXXX 98
             G N T TS HT+          + S ST+F+ ++K  QPSMTT++             
Sbjct: 75  LQGGNATATSGHTKPSTFTGTMNTEDSHSTLFSSMSKH-QPSMTTVDA------------ 121

Query: 99  XXXXXKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLS 158
                      E +   DD  S  S +++V+QQSMK+E+    ++   +R+RRFITSRL+
Sbjct: 122 -----------ERTAPGDDGLS--SHRYQVIQQSMKDEIL---SRQGTRRSRRFITSRLA 165

Query: 159 SLGPAKRNLSTSFNVDSPSESRVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYH 218
           +LGPAKRN ST+ N +  S                          NS++   +N GY   
Sbjct: 166 TLGPAKRN-STTTNFEFSSN-----ISHDEPRDVSHQEGNVSTSSNSNSGVLNNNGY--- 216

Query: 219 DHNIFLETHRQHSTPSHDENKDPSANLQPNI-NYENIDFGDLNPYQYLKKYNLPSGELPY 277
             N+FL+T  +     HD+ +  SA  Q  + +Y NI FGDLNPYQYLKK+NLP+ ELP 
Sbjct: 217 --NVFLDTEER---ARHDDKESHSAARQSGLSDYGNISFGDLNPYQYLKKHNLPTSELPN 271

Query: 278 ISKVYFERQKEENRKTVLRK------------------ATSGTLALKREFTQYRRTQTA- 318
           IS++YFE QK ENR+  +RK                  A + T    +E        +  
Sbjct: 272 ISRIYFEMQKRENRRAAVRKNVLNGSGGQVAQLPTNNSAIASTAVALKEANGIASISSGS 331

Query: 319 ----------------RQPRRKHNFGTDKT---SLQDPLSS------------PLQKNQL 347
                           RQPRRKH+  +  +    L  P+S+            P+QKN  
Sbjct: 332 NKLTPPQAANSMIKRDRQPRRKHSDASVSSFSKLLSSPISAGAPNYADSQKHTPVQKNST 391

Query: 348 VFQEV-DRELANKREALKPLDVN-NPSSSQEAKRPKYENDHVPEDYRPPFFSHRKAPSPH 405
            ++ +   +   KREAL  LDVN N   S   K+ K +  H   DY       +KAP+  
Sbjct: 392 PYEPLLINQNTKKREALNSLDVNANRHPSIITKKQKVDELH---DYL------KKAPA-- 440

Query: 406 DSKPFKKVEIVEPPKS-TVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPT 464
            +   KKVEIVEP +   +  IPLK    +V + +++             +KR       
Sbjct: 441 -AASVKKVEIVEPVRDPVITTIPLKPPSAEVPANVHQ----------LPQRKRQ-----V 484

Query: 465 ITVNGTAYEKVELLXXXXXXXXXXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKK 524
           ITVNG+ YEKVELL               +++YALKRVSFDEFD++S DGFKGEIELLKK
Sbjct: 485 ITVNGSEYEKVELLGRGGSSKVYKVRNSSNRIYALKRVSFDEFDDASADGFKGEIELLKK 544

Query: 525 LENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVK 584
           LEN+ RVVKLID+ M  GVL+++MECG+HDLSQVL QRS +P D EFVRYH QEM+KCVK
Sbjct: 545 LENQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRSSMPLDIEFVRYHAQEMLKCVK 604

Query: 585 VVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLV 644
           VVHDA IVHSDLKPANFVFVKG+LKIIDFGIANAVPDHTVNIYRD QIGTPNYMAPE LV
Sbjct: 605 VVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALV 664

Query: 645 AMNFTRNDGE------QAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNP 698
           AMN+T++  +        +WKVGKPSD+WSCGCI+YQM+YGKPPYG+FQG NRL AIMNP
Sbjct: 665 AMNYTQDSDQIQQEMHHNRWKVGKPSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNP 724

Query: 699 DVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDL 758
           +VKI YPEK   G  +PRT +DTI++CLERNP  R T+D+LL G  I P+TVT FFI DL
Sbjct: 725 EVKIVYPEKTPTGDFVPRTALDTIKACLERNPERRWTVDELLRGPFIKPITVTHFFIRDL 784

Query: 759 IKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
           IKNAV YG DQ++V+ E+VE L++DVW++L++F+L
Sbjct: 785 IKNAVKYGSDQRYVSKEKVENLADDVWHRLSDFRL 819

>KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 837

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/809 (45%), Positives = 500/809 (61%), Gaps = 126/809 (15%)

Query: 46  VRHFNGRNTT------HTSNHTEDQSQSTVFTMVNKQFQPSMTTMNTVVKEXXXXXXXXX 99
           VR F+  NT       +++ H+E+ S ST+F   +K  Q SMTT N              
Sbjct: 94  VREFSSSNTNNSVAGPYSTFHSEEHSDSTMFA-TSKHNQQSMTTFNPETP---------- 142

Query: 100 XXXXKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSS 159
                    +E+   +D     +  + K +QQ++++EL   + +SS +RNRRF++SR + 
Sbjct: 143 ---------SEQGKPEDMYLEKSRSRVKSMQQTLRDEL---SLRSSKRRNRRFVSSRFNL 190

Query: 160 LGPAKRNLSTSFNVDSPSESRVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHD 219
           LGPAKR    S N  +P+ S +                   +   SH+S++  T ++ ++
Sbjct: 191 LGPAKR---ASSNTGTPNHSELADESNVSQQ----------EANFSHSSSAGATAHQ-NE 236

Query: 220 HNIFLETHRQHSTPSHDENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYIS 279
           +N+F E+  Q+S+    ++  P+ +   +INY+NI+FGDLNPYQYLKK+N+P+ ELP IS
Sbjct: 237 YNVFYES--QNSSSPQKDSAAPTDHT--SINYDNIEFGDLNPYQYLKKHNIPTTELPNIS 292

Query: 280 KVYFERQKEENRKTVLRKATSGTLALKREFTQ--------------YRRTQT--ARQPRR 323
           ++YFERQK ENRKT LRK  +   A +   T                +R Q+   RQPRR
Sbjct: 293 RLYFERQKGENRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRR 352

Query: 324 K---HNFGTDKTSLQDPLSS-------PLQ-----KNQLVFQEVDRELAN------KREA 362
           K   H    D  +   P+SS       P +     +   +++ ++R   +      +REA
Sbjct: 353 KISDHATNNDSKAWSSPVSSSKGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREA 412

Query: 363 LKPLDVNNPSSSQEAKRPKYENDHVPED---YRPPF-------------FSHRKAPSPHD 406
           L  +++N+     + KR KY  +++ E    +RPPF             F HR  P+  +
Sbjct: 413 LSNININSNYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPE 472

Query: 407 SKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTIT 466
            K    VEIVEP K+T E IPLK            GD+Y       + +K      PTI 
Sbjct: 473 RK---HVEIVEPLKTT-ESIPLKPPATS-------GDSY-------NRRK------PTIY 508

Query: 467 VNGTAYEKVELLXXXXXXXX-XXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKKL 525
           VNGT YEK+ELL               ++KVYALKRVSFDEFD+SSI+GFKGEIELLKKL
Sbjct: 509 VNGTEYEKLELLGRGGSSKVYKVKNVANNKVYALKRVSFDEFDDSSIEGFKGEIELLKKL 568

Query: 526 ENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKV 585
           E K RVVKLID+ M  GVL+ +MECG+HDLS  L  RS +  D EFVR+H QEM+KCVKV
Sbjct: 569 ETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628

Query: 586 VHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVA 645
           VHD+ IVHSDLKPANFVFVKG+LKIIDFGIANAVP+HTVNIYR+ QIGTPNYMAPE LVA
Sbjct: 629 VHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 688

Query: 646 MNFTRND-GEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPY 704
           MN+T+    EQ +WKVGKPSD+WSCGCI+YQM+YG+PPYG FQG NRL AIMNP+VKI Y
Sbjct: 689 MNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 748

Query: 705 PEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVN 764
           PEK S G V+P+T IDT+++CLERNP  R ++D++L+G  + P+ VT FFI DLIKN+V 
Sbjct: 749 PEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVK 808

Query: 765 YGCDQKHVNNERVEELSEDVWNKLAEFKL 793
           YG +Q+ ++NE++EEL+EDVW++LA+F+L
Sbjct: 809 YGANQREISNEKIEELAEDVWHRLADFRL 837

>Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028C
           (MPS1) - serine/threonine/tyrosine protein kinase (dual
           specificity), able to autophosphorylate as well as act
           on Mad1p. A mutation predicted to abolish kinase
           function eliminates in vitro protein kinase activity and
           behaves like a null mutation in vivo. [contig 105] FULL
          Length = 838

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/842 (45%), Positives = 509/842 (60%), Gaps = 136/842 (16%)

Query: 17  TAESQHEYSRYQDAKTGLEEPTHSNPLHFVRHFNGRNTT------HTSNHTEDQSQSTVF 70
           TA S+H +   Q ++T  + P+ +  L   R F+  NT       H++ H+ D S ST+F
Sbjct: 68  TASSRH-HPLNQMSRTHSQLPSRTETLAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLF 126

Query: 71  TMVNKQFQPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNEESLMKDDTHSHTSQKFKVLQ 130
               K  Q SMTT N                    ++L++  L +       S K K LQ
Sbjct: 127 ATF-KDNQQSMTTFNPD------------------DQLHQSGLDRVSLEQSRS-KIKSLQ 166

Query: 131 QSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSFNVDSPSESRVXXXXXXXXX 190
           Q+++++L   ++++S +R RRF +SRLS LGPAKR  STS    +P+ S +         
Sbjct: 167 QALRDDL---SSRNSKRRTRRFASSRLSLLGPAKRASSTS---GTPNRSELIEESNISQP 220

Query: 191 XXXXXXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKDPSANLQPNIN 250
                     +I NS T  +S      ++HNIF E   Q+S  +   +  P   +   IN
Sbjct: 221 EG--------NISNSSTRTASAN---LNEHNIFYEP--QNSNQAIQSSHSPF--ISSTIN 265

Query: 251 YENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTLALKREFT 310
           YE+++FGDLNPYQYLKKYNLP+ ELP IS++YFERQK +NRK  LRK+ +   A++    
Sbjct: 266 YEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQNRIA 325

Query: 311 -------------QYRRTQTA--RQPRRKHNFGTDKTSLQDP--LSSPLQ--KNQLVFQ- 350
                          RR  +A  RQPRRK    ++  +  DP   SSP     N  V   
Sbjct: 326 TTSSPHSPPVDADAIRRDNSAFKRQPRRKI---SESATSNDPKAWSSPFSGINNPTVASA 382

Query: 351 ------EVDRELAN-------------KREALKPLDVNNPSSSQ-EAKRPKYENDHVPED 390
                 + D + +N             +REAL  +++N+ S++Q + K+PKY +D+ P++
Sbjct: 383 RRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYSAAQPQHKKPKY-SDYNPQE 441

Query: 391 Y----RP-------------PFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGC 433
           +    RP             P F HR  P      P K VEIVEP + T E IPLK    
Sbjct: 442 FGRLPRPSLENRSPISNKEEPQFKHRSPPL----IPGKHVEIVEPIR-TKESIPLKPPAS 496

Query: 434 DVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXX-XXXXXX 492
                          +   + +KR     P + VNGT YEK+ELL               
Sbjct: 497 ---------------SDDINGRKR-----PVVYVNGTEYEKLELLGRGGTSKVYKVKNAN 536

Query: 493 DHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGE 552
           ++KVYALKRVSFDEFD+SSIDGFKGEIELLKKLE + RVVKLID+ M  GVL+++MECG+
Sbjct: 537 NNKVYALKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGD 596

Query: 553 HDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIID 612
           HDLSQ L  RS +P D EFVRYH QEM+KCVKVVHDA IVHSDLKPANFVFVKG+LKIID
Sbjct: 597 HDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIID 656

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDG-EQAKWKVGKPSDVWSCGC 671
           FGIANAVP+HTVNIYR+ QIGTPNYMAPE LVAMN+T N   EQ++WKVGKPSD+WSCGC
Sbjct: 657 FGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGC 716

Query: 672 ILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
           I+YQM+YG+PPYG FQG NRL AIMNP+VKI YPEK S G  +P+T IDT+++CLERNP 
Sbjct: 717 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPN 776

Query: 732 SRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEF 791
            R T++++ +G+ + PV+VT FFI DLI+N+V YG +QK +++ +VEEL+EDVW++L EF
Sbjct: 777 KRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEF 836

Query: 792 KL 793
           +L
Sbjct: 837 RL 838

>SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some
           similarities with uniprot|P54199 Saccharomyces
           cerevisiae YDL028C MPS1 Dual-specificity kinase required
           for spindle pole body (SPB) duplication and spindle
           checkpoint function substrates include SPB proteins
           Spc42p Spc110p and Spc98p mitotic exit network protein
           Mob1p and checkpoint protein Mad1p
          Length = 861

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/849 (44%), Positives = 490/849 (57%), Gaps = 152/849 (17%)

Query: 27  YQDAKTGLEEPTH---SNPLHFVRHFNGRNT---THTSNHTEDQSQSTVFTMVNKQFQPS 80
           +QD  TG + P+    S  L      N  NT   ++ S ++ED SQST+FT    + QPS
Sbjct: 83  FQDISTGCQRPSQVPLSRNLSLNSMSNTNNTFGASYPSYNSEDPSQSTLFT--TSRHQPS 140

Query: 81  MTTMNTVVKEXXXXXXXXXXXXXKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEELYNS 140
           MTT++                        E   +       +S + + LQ S+KEEL   
Sbjct: 141 MTTVHP-----------------------EPHGLDSSKSEQSSHRLRALQHSLKEEL--- 174

Query: 141 TTKSSNKRNRRFITSRLSSLGPAKRNLSTSFNVDSPSESRVXXXXXXXXXXXXXXXXXXX 200
           +++ + +RNRRF++SRL  LGPAKR  ST+    + S +                     
Sbjct: 175 SSRHAKRRNRRFVSSRLGLLGPAKRASSTAGLAYTDSGN---------------DDASIS 219

Query: 201 DIENSHTSNSSNTGYRYHD--HNIFLETH-----RQHSTPSHDENKDPSANLQPNINYEN 253
             E + + +SS +G+  ++  +N+FLE+H     RQH T S D            ++Y +
Sbjct: 220 QQEANVSGSSSTSGFVGNNEGYNVFLESHTGAGERQHHTSSKDTG----------VDYRD 269

Query: 254 IDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRK---------------- 297
           +DFGDLNPYQYLKK+NLP+ ELP ISK+YFERQKEENR+T LRK                
Sbjct: 270 VDFGDLNPYQYLKKHNLPTSELPNISKIYFERQKEENRRTALRKNVVTRETLHERVASMP 329

Query: 298 -ATSGTLALKREFTQYRRTQ-----------TARQPRRKHN------------------- 326
             + G    +RE      +            T RQPRRK +                   
Sbjct: 330 NVSFGAALQQREHAGASTSTNTSNSASNSNITTRQPRRKASDTPSSAFSKSLSSPLTTSN 389

Query: 327 ---FGTDKTSLQDPLSSPLQKNQLVFQEVDRELANKREALKPLDVNNPS----------S 373
              +    T+ + P     Q+        D  +  KREAL  +D N+            S
Sbjct: 390 SSTYAVAATAAKHPYIDHPQQKYDTPPATDTPIHKKREALANIDTNSQRHSHAQTKMHRS 449

Query: 374 SQEAKRPKYENDHVPEDYRPPFFSHRKAPS--------PHDSKPFKKVEIVEPPKSTVEV 425
           S  + R +       +      F HR+AP+        P DS   ++ E+ +  +  VE 
Sbjct: 450 SAASLRNEVHQHRQQQLGSQQEFLHRRAPAPPPPPPSLPTDSD--RRGELTKAAR--VET 505

Query: 426 IPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXX 485
           +PLK                L    S D+  R     PTI VNGT YEK+ELL       
Sbjct: 506 VPLKPPAT----------GSLKPPASLDSHARRK---PTIQVNGTEYEKMELLGRGGSSK 552

Query: 486 XXXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLF 545
                  ++KVYALKRV+FDEFDESS+DGFKGEIELLKKLEN+ RVV+L+DY M  GVLF
Sbjct: 553 VYKVRTPNNKVYALKRVAFDEFDESSVDGFKGEIELLKKLENQPRVVRLVDYEMAHGVLF 612

Query: 546 LLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK 605
           ++MECG+HDLS +L  R+ +P D EFVRYH QEM++CVKVVHDADIVHSDLKPANFVFVK
Sbjct: 613 VVMECGDHDLSSILAHRASLPLDIEFVRYHAQEMLRCVKVVHDADIVHSDLKPANFVFVK 672

Query: 606 GMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRND-GEQAKWKVGKPS 664
           G+LKIIDFGIANAVPDHTVNIYR+ QIGTPNYMAPE LVAMN+ +    +Q +WKVGKPS
Sbjct: 673 GILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYAQGQPHQQNRWKVGKPS 732

Query: 665 DVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRS 724
           D+WSCGCILYQM+YG+PPYG FQG NRL AIMNP+VKI YPEK   G V+PRT +DT+++
Sbjct: 733 DIWSCGCILYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTPSGDVVPRTALDTMKA 792

Query: 725 CLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDV 784
           CLERNP  R T+D++L+GA I PV+VT FF+ DLIKNAV YG +Q+ V++E+VEEL++DV
Sbjct: 793 CLERNPDKRCTVDEVLNGAFIRPVSVTHFFVRDLIKNAVKYGSEQREVSSEKVEELADDV 852

Query: 785 WNKLAEFKL 793
           WN+LAEF+L
Sbjct: 853 WNRLAEFRL 861

>NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162
          Length = 774

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/776 (44%), Positives = 455/776 (58%), Gaps = 127/776 (16%)

Query: 59  NHTEDQS-QSTVFTMVNKQFQPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNEESLMKDD 117
           N  +D S  ST+F       Q S+TTMN+                      N  +L  D 
Sbjct: 85  NQADDLSLHSTLFANTVGNRQSSLTTMNST---------------------NNFALNHDT 123

Query: 118 THSHTS-----QKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSFN 172
              HT      QK K LQQ+MKEEL   T++   +RN+RF+TSR ++LGPAKR  +++  
Sbjct: 124 NKEHTVFEDNLQKIKSLQQTMKEEL---TSRYIERRNKRFLTSRRNNLGPAKR--ASTSA 178

Query: 173 VDSPSESRVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHD-HNIFLETHRQHS 231
           + + +E R                      EN   SN  N  Y   D  NI  +   + S
Sbjct: 179 ISASTEDRYQ--------------------ENDKHSN--NEKYSTQDDSNILAKQVGRLS 216

Query: 232 TPSHDENK------DPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFER 285
           +P + +N+          N++  ++Y +I+FG+L P++YLKK++LP+ ELPYIS++YFE+
Sbjct: 217 SPLNRQNRAFQSSNGDDTNMKEPVDYSSIEFGELTPFEYLKKHDLPTSELPYISRIYFEK 276

Query: 286 QKEENRKTVLRK-----------ATSGTLALKREFTQYRRTQTARQ---PRRKHNFGTDK 331
           QK ENR+TVLRK            T+ +LA           Q +R    PRRK +  + K
Sbjct: 277 QKLENRQTVLRKRRFSSKESLSLGTTSSLAPYSNSKNNTTNQVSRDLSLPRRKISDTSSK 336

Query: 332 TSLQDPLSSPLQKNQLV-------FQEVDR--ELANK--REALKPLDVNNPSSSQEAKRP 380
            S Q  L S +  ++          Q + R  E A K  R  L  L+VNN S     +  
Sbjct: 337 ISKQ-ILKSNINLSESGSHGFPPDLQSIQRQHESAEKLSRAPLIDLNVNNVSP---KRMD 392

Query: 381 KYENDHVPEDYRPPF--FSHRKAPSPHDSK-PFKKVEIVEPPKSTVEVIPLKSEGCDVSS 437
           K    H   D R     FS +     ++ + P KKVEIVEP +S               S
Sbjct: 393 KLRETHKFSDSRLNVQDFSKKTDVVVYEKQAPRKKVEIVEPKRS--------------HS 438

Query: 438 KLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXXXXXXXXDHKVY 497
           KL K +                    TITVN T YEK+ELL               +KV+
Sbjct: 439 KLAKRN--------------------TITVNDTEYEKIELLGRGGSSRVYKVKNSQNKVF 478

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALKRVSFDEFD+SS+DGFKGEIELL+KL N+ RVVKL DY M  GVLFL+MECG+HDLSQ
Sbjct: 479 ALKRVSFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMECGDHDLSQ 538

Query: 558 VLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGIAN 617
           +L+QRS +P D +FVRYH +E+++C+K+VHDA IVHSDLKPANFVFVKG+LKIIDFGIAN
Sbjct: 539 ILSQRSDMPLDMDFVRYHAREVVRCIKIVHDAGIVHSDLKPANFVFVKGILKIIDFGIAN 598

Query: 618 AVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMV 677
           A+PDHTVNIYR+NQIGTPNYMAPE LVAMN+T  +    KWKVGKPSD+WSCGCI+YQM+
Sbjct: 599 AIPDHTVNIYRENQIGTPNYMAPEALVAMNYTNENDGGNKWKVGKPSDIWSCGCIIYQMI 658

Query: 678 YGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTID 737
           YG+PPY  FQG NRL AIMNPDVK+ + EK +    IPR++ID ++ CL R+P  R ++D
Sbjct: 659 YGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLTRDPEKRWSVD 718

Query: 738 QLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
           Q+L     NP+ VT FFI DLIKNAV YG DQ+ V+NE++EEL+ DV  +L +FK+
Sbjct: 719 QVLESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELANDVLGRLTDFKM 774

>TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.162
           YDL028C
          Length = 795

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/812 (42%), Positives = 460/812 (56%), Gaps = 162/812 (19%)

Query: 48  HFNGRNT------THTSNHTEDQSQSTVFTMVNKQFQPSMTTMNTVVKEXXXXXXXXXXX 101
           +F+G N       T+ S ++ + SQST+F       QPSMTTM+T               
Sbjct: 80  YFSGSNNQTSFSQTYVSANSGEPSQSTIFAQSRFNQQPSMTTMDT--------------- 124

Query: 102 XXKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFI-TSRLSSL 160
                  N   +   D  +    + K +QQ+M+EEL   TT+ + +R+RRF+  +R+  L
Sbjct: 125 -------NGIKIPASDLETSFG-RIKSMQQNMREEL---TTRHAQRRSRRFLHGTRIGVL 173

Query: 161 GPAKRNLSTSFNVDSPSESRVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHDH 220
           GPAKR  ST+                              D+ +    N           
Sbjct: 174 GPAKRASSTN----------------------------GADMSDLSIGNVQMV---QQTD 202

Query: 221 NIFLETHRQHSTPSH---DENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPY 277
           N  LE HR+  +P+    D  K  +   +  ++Y++IDFGD+NP QYLK +NL S ELP 
Sbjct: 203 NTPLEEHREVQSPAEIKPDLTKKETRT-RDVLDYKSIDFGDMNPVQYLKLHNLSSSELPK 261

Query: 278 ISKVYFERQKEENRKTVLRKATSGTLALKREFTQY------------RRTQTARQPRRKH 325
           +SKVYFERQ+EE  +  L+K+ S   AL  +  +             R +     PRRK 
Sbjct: 262 LSKVYFERQREEIHQMALQKSISSREALTNKVQRSFSSISSSGNSIRRESSMPLYPRRKL 321

Query: 326 N----FGTDKTSLQDPLSSPL---QKNQLVFQEV-------------DRELAN------- 358
           +        KTS Q   SSPL   +KN L+ Q V              ++ A        
Sbjct: 322 SDTSVSSAAKTSFQSSFSSPLAYPKKNFLIDQPVVTSKPAADHGKNLTKQYAQREQYTLE 381

Query: 359 ----KREALKPLDVNNPS--SSQEAKRPK-------YENDHVPEDY-RPPFFSHRKAPSP 404
               KREAL  +D+N  S  S Q+ KR K           H+PE Y     + +R+ P P
Sbjct: 382 SSFKKREALANIDINRNSQESLQQPKRFKPIRTQEQLSESHLPEPYVNKEEYLNREPPKP 441

Query: 405 HDSKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPT 464
             +K   +VEI+EP                   K ++G +  N                 
Sbjct: 442 RATK---RVEILEP-------------------KPSQGQSRKN----------------V 463

Query: 465 ITVNGTAYEKVELLXXXXXXXXXXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKK 524
           + VN   YEKVELL               + VYALKRV FDEFD+SS+ GFKGEIELLKK
Sbjct: 464 VKVNDVEYEKVELLGRGGSSKVYKVRDRSNNVYALKRVVFDEFDDSSVSGFKGEIELLKK 523

Query: 525 LENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVK 584
           LEN+ RVV+L+D+ M  GVL+L+MECG+HDLS++L  R+ +P D EFVRYH +EM++CVK
Sbjct: 524 LENQNRVVQLVDHEMEHGVLYLIMECGDHDLSRILNHRAGMPLDMEFVRYHAREMLRCVK 583

Query: 585 VVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLV 644
           VVHD+ IVHSDLKPANFVFVKG+LKIIDFGIANAVPDHTVNIYR+NQIGTPNYMAPE LV
Sbjct: 584 VVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRENQIGTPNYMAPEALV 643

Query: 645 AMNFTRND---GEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVK 701
           AMN+T++D    +Q +WKVGKPSD+WSCGCI+YQM+YG+PPYG FQG NRL AIMNPDVK
Sbjct: 644 AMNYTQDDEKYQQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPDVK 703

Query: 702 IPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKN 761
           I + +K S    IPR+ +DT+++CL RNP  R+T+D++L    + P+ VT FFI DLIKN
Sbjct: 704 IIFSDKTSRDETIPRSALDTMKACLTRNPDKRLTVDEVLESNFLKPLMVTPFFIRDLIKN 763

Query: 762 AVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
           AV YG DQK V+ E+VEEL++DV ++L++F+L
Sbjct: 764 AVRYGADQKEVSKEKVEELADDVLSRLSDFRL 795

>NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa]
           {ON} 
          Length = 747

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/771 (42%), Positives = 429/771 (55%), Gaps = 137/771 (17%)

Query: 53  NTTHTSNHTEDQSQ-STVFTMVNKQFQPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNEE 111
           N T+ +   +D S  ST+F   N   QPS+TT N  V                YN+L  E
Sbjct: 84  NITNNATQFDDHSSISTIFAHTNLPRQPSITTTNNNVP----GDDDNARLAESYNELEME 139

Query: 112 SLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSF 171
           S +         Q+ KVLQQSMKEEL   T++   +RNRRF+TSRL+ LGPAKR  S   
Sbjct: 140 SNL---------QRIKVLQQSMKEEL---TSRYVERRNRRFLTSRLTRLGPAKRASSA-- 185

Query: 172 NVDSPSESRVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQHS 231
                                        DI  S  +N+ +    YH   + +   ++ S
Sbjct: 186 -------------------------VSEKDILRSIDNNTQHLLPEYHTPPLSVLDQKEIS 220

Query: 232 TPSHDENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENR 291
           T        P +  + NI+Y +IDFG L P++YLKK  LP+ ELP ISK YF++QKEE+ 
Sbjct: 221 TV-------PESAARGNIDYSSIDFGRLKPFEYLKKKKLPTSELPSISKAYFQKQKEESL 273

Query: 292 KTVLRK------------------ATSGTLALKR-----EFTQYRRTQTARQPRRKHNFG 328
           +  L+K                   +SG +  K         + + +Q + +P   HN  
Sbjct: 274 QNTLKKRHRTLNEDPKIGTFNDEGGSSGNIVSKGTPRIPNLPRRKFSQASARPSAPHNLP 333

Query: 329 -TDKTSLQDPLSSPLQKNQLVFQEVDRELANKREALKPLDVNNPSSSQEAKRPKYE-NDH 386
            TDK         P+Q              + R+ L  LD+NN S S+   +  Y+    
Sbjct: 334 PTDKYG-------PIQ-------------YSSRDVLTSLDINNQSPSKADHKFGYDIQIG 373

Query: 387 VPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYL 446
            P   + P     K  SP      KKVEI+EP                            
Sbjct: 374 KPYTVKTPLNESYKRLSPK-----KKVEIIEP---------------------------- 400

Query: 447 NYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXXXXXXXXDHKVYALKRVSFDE 506
                +  KK+T   + +ITVNG  YEK+ELL               +K++ALKRVSFDE
Sbjct: 401 ---FIYAQKKKTGKKL-SITVNGIDYEKIELLGRGGSSKVYKVKNDQNKIFALKRVSFDE 456

Query: 507 FDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIP 566
           FD+SSI GFKGEIELL+KL  + RVV+L DY M  GVL+L+MECG++DLSQVL QR   P
Sbjct: 457 FDDSSIAGFKGEIELLEKLCKEPRVVRLFDYQMSSGVLYLIMECGDNDLSQVLNQRMGFP 516

Query: 567 FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNI 626
            D +F+RYH +E++KCVK VHDA IVHSDLKPANFVF+KG+LK+IDFGIAN +PDHTVN+
Sbjct: 517 LDMDFLRYHVRELLKCVKAVHDAGIVHSDLKPANFVFIKGLLKLIDFGIANVIPDHTVNV 576

Query: 627 YRDNQIGTPNYMAPETLVAMNFTRN----DGEQAKWKVGKPSDVWSCGCILYQMVYGKPP 682
           YR++QIGTPNYMAPETL+A N +      + E +KWKVGKPSDVWSCGCI+YQM+YG+PP
Sbjct: 577 YRESQIGTPNYMAPETLIATNHSIEQSDLNKEMSKWKVGKPSDVWSCGCIIYQMIYGRPP 636

Query: 683 YGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSG 742
           Y  FQG NRL AIMNP+VK+ + E+ +    IP ++ID +++CL R+P  R +ID+LL  
Sbjct: 637 YAGFQGQNRLLAIMNPEVKVIFSERTAKDEKIPTSLIDLMKACLLRDPAKRWSIDKLLCS 696

Query: 743 ALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
              NP+ VT FFI DLIKNAV YG DQK V + ++EELS DV  +L +FK+
Sbjct: 697 PFFNPIIVTPFFIKDLIKNAVKYGTDQKTVTDAKIEELSNDVLERLNDFKM 747

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
           (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/722 (44%), Positives = 414/722 (57%), Gaps = 107/722 (14%)

Query: 118 THSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFIT-SRLSSLGPAKRNLSTSFNVDSP 176
           T + T Q+FK L +S+K+EL  +T     ++ RRF   +++  LGPA R        +  
Sbjct: 131 TGNSTFQRFKGLHESIKDEL--NTKNLERRKTRRFFNRTKMGVLGPAMR-------TNLE 181

Query: 177 SESRVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHD 236
           +E                       + +S ++ +S++   YHD      TH+  +  S  
Sbjct: 182 NEKLGKNSKHETIEEKINKYDQPAHLISSSSTVASSSYTSYHD------THQSINQTS-- 233

Query: 237 ENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLR 296
                    Q  INY+ IDFG+LNP QY+KK NLP+ ELP ISK+YFERQ+ E+RK  L+
Sbjct: 234 ---------QTTINYDLIDFGELNPVQYIKKNNLPTTELPTISKLYFERQRAESRKIALK 284

Query: 297 K--------ATSGTLALKREFTQYRRTQTARQPRRKHNFGTD-----KTSLQDPLSSPLQ 343
           K         +S + ALK  F Q    Q   +    +   TD     K S ++   S   
Sbjct: 285 KHSSSKELLFSSSSSALKNSFNQISDAQNESKCISNNTGDTDALSEPKISDKENSRSTWS 344

Query: 344 KNQLVFQEVD---------------RELANKREALKPLDVN------------NPSSSQE 376
           +N     + D                 L  KREAL  ++VN            N  +   
Sbjct: 345 RNGYAILKDDYINNLEYYKNPSGYSSSLNKKREALSSINVNTNHNHSYQELGDNKRNKIS 404

Query: 377 AKRPKYENDHVPEDYRPPFFSHRKAPSPHDSKPF----KKVEIVEPPKSTVEVIPLKSEG 432
            K  + E +HV    R      +K    + +       KKVEI+EP  ++   I  KS  
Sbjct: 405 TKGIESEIEHVAA--RNSMLEQQKVEQLNSANIHKHGKKKVEIIEPKSASANRIASKS-- 460

Query: 433 CDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXX-XXXXX 491
                                           ++VNG  YEK+ELL              
Sbjct: 461 -------------------------------VVSVNGVEYEKIELLGRGGSSKVYKVKNV 489

Query: 492 XDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECG 551
            ++K++ALKRV FDEFDESSID FKGEIELLKKLEN++RVV LI + M  GVL L+MECG
Sbjct: 490 HNNKIFALKRVMFDEFDESSIDSFKGEIELLKKLENEKRVVTLIQHQMESGVLLLIMECG 549

Query: 552 EHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKII 611
           +HDLSQ+L QR  +P D EF+R+H +EM+KCVKVVHDA IVHSDLKPANFVFVKG+LKII
Sbjct: 550 DHDLSQILNQRMNMPLDIEFIRFHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKII 609

Query: 612 DFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGC 671
           DFGIANAVPDHTVNIYR+ QIGTPNYMAPE LVAMN  ++  +Q KWKVGKPSD+WSCGC
Sbjct: 610 DFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNSQQDSDQQNKWKVGKPSDIWSCGC 669

Query: 672 ILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
           ILYQM YG+PPYG+FQG NRL AIMNP+VKI + EK S    IPR+ ++T+++CL RNP 
Sbjct: 670 ILYQMFYGRPPYGSFQGQNRLLAIMNPNVKIVFSEKTSNNERIPRSALETMKACLIRNPD 729

Query: 732 SRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEF 791
            R  +DQ+L G+  NPV VT F I DLIKNAVNYG DQ++V +E++ EL++DV N+LA+F
Sbjct: 730 KRWAVDQVLEGSFFNPVMVTSFIIRDLIKNAVNYGADQRYVTDEKITELADDVLNRLADF 789

Query: 792 KL 793
           +L
Sbjct: 790 RL 791

>Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar to
           Ashbya gossypii ADR317C
          Length = 864

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/501 (55%), Positives = 346/501 (69%), Gaps = 54/501 (10%)

Query: 319 RQPRRKHNFGTDKTSLQDPLSSPLQKNQLVFQEVDREL-------------------ANK 359
           RQPRRK +  +  +S    LSSP+      + E  +++                     K
Sbjct: 392 RQPRRKTSDAS-VSSFSKILSSPITGAANNYVESQKQIQPPMQRSPVSLGPLQLNPNTKK 450

Query: 360 REALKPLDVNNPSSSQEAKRPKYENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPP 419
           REAL  LDVN+ ++ Q     K+++D         F+  RKAP+P      KKVEI+EP 
Sbjct: 451 REALNKLDVNS-TNQQAIVHKKHKSDE------QNFYHIRKAPNP---PAVKKVEIIEPV 500

Query: 420 KSTV-EVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELL 478
           K TV   IPLK    +              NGS+ T +R       I VNG+ YEKVELL
Sbjct: 501 KDTVITTIPLKPPSTE--------------NGSYQTPQRKRQ---IIQVNGSEYEKVELL 543

Query: 479 XXXXXXXXXXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYH 538
                         ++K+YALKRVSFDEFD++SIDGFKGEIELLK+LE++ RVVKLID+ 
Sbjct: 544 GRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHE 603

Query: 539 MGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKP 598
           M  GVL+++MECG+HDLSQVL QR+ +PFD EFVRYH QEM+KCV+VVHD  IVHSDLKP
Sbjct: 604 MNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKP 663

Query: 599 ANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDG----- 653
           ANFVFVKG+LKIIDFGIANAVPDHTVNIYRD QIGTPNYMAPE LVAMN+T + G     
Sbjct: 664 ANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQE 723

Query: 654 -EQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGT 712
            +Q +WKVGKPSD+WSCGCI+YQM+YG+PPYG FQG NRL AIMNP+VKI YPEK + G 
Sbjct: 724 IQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGD 783

Query: 713 VIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHV 772
           ++PRT +DTI++CLERNP  R T+D LL G  I PV+VT FFI DLIKNAV YG DQ++V
Sbjct: 784 LVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYV 843

Query: 773 NNERVEELSEDVWNKLAEFKL 793
           + E+VE+L++DVWN+L++F+L
Sbjct: 844 SKEKVEDLADDVWNRLSDFRL 864

 Score =  132 bits (332), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 133/238 (55%), Gaps = 42/238 (17%)

Query: 60  HTEDQSQSTVFTMVNKQFQPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNEESLMKDDTH 119
           H +D S ST+FT V+K  QPSMTT+N                  +     EE L      
Sbjct: 99  HMDDGSHSTLFTSVSKH-QPSMTTVN-----------------QEQRTPGEEGL------ 134

Query: 120 SHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSFNVDSPSES 179
              S +F+++QQSMK+EL   +++   +R+RRFITSRLS+LGPAKRN + + N+D  S  
Sbjct: 135 --GSYRFQMIQQSMKDEL---SSRQIMRRSRRFITSRLSTLGPAKRNTTLTANLDFSSN- 188

Query: 180 RVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENK 239
                                D   S +SN+ +   +  D+N+FL+T       S + + 
Sbjct: 189 ---------MSHEDSRDLSHQDGNISSSSNNHSGLLQNQDYNVFLDTEPNCRPDSKENDG 239

Query: 240 DPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRK 297
             SA+   +I+Y+NI FGDLNPYQYLKK+NLP+ ELP IS++YFE QK+ENR+  +RK
Sbjct: 240 LKSAS---SIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294

>ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 847

 Score =  538 bits (1385), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 304/631 (48%), Positives = 380/631 (60%), Gaps = 119/631 (18%)

Query: 254 IDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEEN------RKTVLRK---ATSGTLA 304
           +D GDLNP QYLKK++LP+ ELP IS++YFE+QK         ++ +LR+   ++SG   
Sbjct: 245 VDLGDLNPVQYLKKHDLPTSELPRISRLYFEKQKPRKMELARLKQEILRESRTSSSGNNG 304

Query: 305 LKREFTQYRRTQT---ARQPRRKHNFGTDKTSLQDPLSSPL------------QKNQLVF 349
              +    RR  +   A QPRRK +  + +   Q   SSP+             K+ L  
Sbjct: 305 SGVQHIPIRRENSLSAATQPRRKLSDTSSRNIFQRGFSSPVARSVDSQRNILSDKSSLKH 364

Query: 350 QEVDRELAN--------KREALKPLDVNNPSSSQ----EAKRPKY---------ENDHVP 388
            E D    +        KREAL  +DVN  ++ Q    E KR KY          ND+ P
Sbjct: 365 NEYDSYPHSNTLLYSHRKREALANIDVNRNNNDQIYEPELKRYKYFDEHHNNNRNNDYEP 424

Query: 389 EDYR----------------------------PPF-------------FSHRKAPSPHDS 407
           E  R                            PP              F HR+AP P   
Sbjct: 425 ESKRYDLFEDHRNGNNNKDEKPISLERLPSEAPPVAIPIHPSVIQENEFHHREAPKP--- 481

Query: 408 KPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITV 467
              KKVEIVEP K T           D   K + G+     N +              TV
Sbjct: 482 PVVKKVEIVEPEKRT-----------DSKGKSSNGEALTRRNAT--------------TV 516

Query: 468 NGTAYEKVELLXXXXXXXXXXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLEN 527
           N   YEK+ELL              ++K+YALKRV FDEFD+SS++GFKGEIELL KL++
Sbjct: 517 NDVEYEKIELLGRGGSSKVYKVKDNNNKLYALKRVVFDEFDDSSVNGFKGEIELLNKLKD 576

Query: 528 KQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVH 587
           K RVVKL DY M  GVL+L+MECG+HDLSQ+L QR+ +P D EFVRYH +EM+KCVKVVH
Sbjct: 577 KTRVVKLFDYEMEHGVLYLIMECGDHDLSQILNQRAGMPLDIEFVRYHAREMLKCVKVVH 636

Query: 588 DADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMN 647
           DA IVHSDLKPANFVFVKG+LKIIDFGIANAVPDHTVNIYR+ QIGTPNYMAPE LVAMN
Sbjct: 637 DAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMN 696

Query: 648 FT-RNDG----EQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKI 702
           +T +NDG    +Q +WKVGKPSDVWSCGCI+YQM+YG+PPYG FQG NRL AIMNP+VKI
Sbjct: 697 YTGQNDGDKYKQQNRWKVGKPSDVWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 756

Query: 703 PYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNA 762
            + EK +    +PR+++DT+++CL RNP  R+T+D++L    + PV VT FFI DLIKNA
Sbjct: 757 IFSEKTANDEAVPRSILDTMKACLLRNPDKRLTVDEVLDSPFLKPVMVTPFFIRDLIKNA 816

Query: 763 VNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
           V YG DQK V+ E+VEEL++DV  KLA+ +L
Sbjct: 817 VRYGADQKEVSKEKVEELADDVLGKLADIRL 847

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 57/113 (50%), Gaps = 28/113 (24%)

Query: 55  THTSNHTEDQSQSTVFTMVNKQFQPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNEESLM 114
           T+ S H+ D SQST+F       QPSMTTMN+   +                        
Sbjct: 108 TYASIHSGDPSQSTLFAQYRSHQQPSMTTMNSTDVQD----------------------- 144

Query: 115 KDDTHSHTS-QKFKVLQQSMKEELYNSTTKSSNKRNRRFI-TSRLSSLGPAKR 165
           KD      S QK K +QQSM+EEL   T++ + +R+RRF+ +SR   LGPAKR
Sbjct: 145 KDGNDFENSFQKIKSMQQSMREEL---TSRHAERRSRRFLNSSRKEFLGPAKR 194

>KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.162
           YDL028C
          Length = 747

 Score =  529 bits (1362), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 309/757 (40%), Positives = 431/757 (56%), Gaps = 102/757 (13%)

Query: 52  RNTTHTSNHTEDQS-QSTVFTMVNKQFQPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNE 110
           RN ++ S    +QS Q+++F         SMTT+     +              YNK+N+
Sbjct: 78  RNNSYGSYGIAEQSPQTSIFATTINNRPISMTTIQNGSADSNVTNNVNDKYESSYNKINK 137

Query: 111 ESLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFI-TSRLSSLGPAKRNLST 169
                             +QQS+K+EL    T     R +RF+ T+R++ LGPAKR  ++
Sbjct: 138 ------------------IQQSIKDEL----TSRHTGRIKRFLNTNRMNKLGPAKR--AS 173

Query: 170 SFNVDSPSESRVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQ 229
           +  VD P  +                       ++ ++S+   +G    + N   E    
Sbjct: 174 TMEVDIPLPANTN--------------------DSYNSSSDVFSGQAIEEANDIKEVQ-- 211

Query: 230 HSTPSHDENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEE 289
                             N +Y NI+FGDLNP+Q+L+KYNLP+ ELP ISK+YFERQKEE
Sbjct: 212 ------------------NYDYSNINFGDLNPFQFLRKYNLPTTELPNISKIYFERQKEE 253

Query: 290 NRKTVLRKATSGTLALKREFTQYRRTQTARQPRRKHNFGTDKTSLQDPLSSPLQKNQLVF 349
           NR ++L+K T+     K      +    +     K+    DKT L++ +++ L    L+ 
Sbjct: 254 NRLSILKKHTNNNTGAKTNGNDIKDFSIS-----KNLTSEDKTDLKNTVNTGLVSRTLLN 308

Query: 350 QEVDRELANKREALKPLDVNNPSSSQEAKRPKY---ENDHV-PEDYRPPFF---SHRKAP 402
             +     N   + K  D NN  +S + + PK+    ND + P   R P     ++RK P
Sbjct: 309 STLSSRKTNSSLSPKSKD-NNEFNSLDVEEPKHLTSNNDEIRPNKRREPLVDLSTNRKEP 367

Query: 403 SPHDSKPF----KKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRT 458
                K F    K+ EI+   ++ V+ +P   +  ++                    K +
Sbjct: 368 ELKRFKTFEENKKRDEIINEKENVVQDVPKSMKRVEIMEP-----------------KMS 410

Query: 459 SYAVPTITVNGTAYEKVELLXXXXXXXXXXXXXXDHKVYALKRVSFDEFDESSIDGFKGE 518
                 I VN T YEK+ELL               +KV+ALKRV FDEFD+SSI+GFKGE
Sbjct: 411 HRQRNVINVNETEYEKIELLGRGGSSKVYKVKGPSNKVFALKRVVFDEFDDSSINGFKGE 470

Query: 519 IELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKI--PFDTEFVRYHF 576
           I+LL KL N+ RVVKL DY M QG+L+L+MECG+ DLSQ+L Q+  +  PFD EF+RY+ 
Sbjct: 471 IKLLNKLRNENRVVKLFDYEMNQGLLYLIMECGDVDLSQILNQKINLNLPFDIEFIRYYT 530

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           +EMIKCVKVVHD  IVHSDLKPANFV VKG+LKIIDFGIA+AVPDHTVNIYR+ Q GTPN
Sbjct: 531 REMIKCVKVVHDNGIVHSDLKPANFVLVKGVLKIIDFGIADAVPDHTVNIYRETQTGTPN 590

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           YMAPETL+AMN+T N  +  KWKVGKPSDVWSCGCI+YQM+YGK PY  FQG +R++AIM
Sbjct: 591 YMAPETLIAMNYTNNGAKDLKWKVGKPSDVWSCGCIIYQMIYGKAPYAGFQGQHRIFAIM 650

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIH 756
           N DVKI YPEK +   +IP+T+++ +++CL R+P  R T+D +LS   +NP+  ++ FI 
Sbjct: 651 NSDVKIVYPEKTNEEELIPKTMVELMKNCLRRDPGKRWTVDDILSSTFLNPIVTSQSFIR 710

Query: 757 DLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
           DLIKNA+ +G  QK V+ +++ +L+ DV  +L EFK+
Sbjct: 711 DLIKNAITFGSQQKIVSEDKINDLTNDVLTRLQEFKM 747

>Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  529 bits (1362), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 317/767 (41%), Positives = 439/767 (57%), Gaps = 159/767 (20%)

Query: 78  QPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEEL 137
           Q SMTTMNT                      N+  +   ++   + +K + L+Q+MKE++
Sbjct: 107 QTSMTTMNT----------------------NDIEINVGNSLDKSFEKIRSLRQNMKEDI 144

Query: 138 YNSTTKSSNKRNRRF-ITSRLSSLGPAKR--NLSTSFNVDSPSESRVXXXXXXXXXXXXX 194
              T+K + +R++RF I++R + LGPAKR   L+  F+ D P+ S               
Sbjct: 145 ---TSKYTERRSKRFLISNRTTKLGPAKRASTLTNVFDDDVPNSS--------------- 186

Query: 195 XXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKDPSANLQPNINYENI 254
                    N   SN   T            T      PS  E K+     + N +YE+I
Sbjct: 187 ---------NQLISNLRET------------TESPLDDPSETEFKET----KKNSDYESI 221

Query: 255 DFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTLA---------L 305
           +FGDLNP QY+KK+NLP+ +LP IS++YF++Q+EENR+  LRK +S  L          L
Sbjct: 222 NFGDLNPIQYIKKHNLPTSDLPMISQIYFDKQREENRQAALRKHSSRELLSKNRSSSTPL 281

Query: 306 KREFTQYRR-----TQTARQPRRK-------------------HNFGTDKTSLQDPLSSP 341
              ++   +     + +  QPRRK                    N  TD  S    L SP
Sbjct: 282 SNSYSLVNKDHSITSNSNSQPRRKISTGSSSSKSSIEIRKVLKENIDTDNYS---NLKSP 338

Query: 342 LQKNQLVFQEVDREL---ANKREALKPLDVNNPSSS----QEAKRPKYEND----HVPED 390
           + K   +++E  R     + KREAL+ + +N   +     Q+ KR K   D    H  E+
Sbjct: 339 INK---IYRESSRNKDSDSEKREALRNISINTSHADSGLQQDNKRLKRSLDDAIIHDNEN 395

Query: 391 YR-PPFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYN 449
            +    F HR AP P  +K   KVEIVEP KS             +S+  N         
Sbjct: 396 MKNQDVFYHRPAPKPPVTK---KVEIVEPIKS-----------ASLSNSRN--------- 432

Query: 450 GSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXXXXXXXXDHKVYALKRVSFDEFDE 509
                          ITVN + YEK+ELL               +KVYALKRVSFD FD+
Sbjct: 433 --------------IITVNDSQYEKIELLGRGGSSRVYKVKGAGNKVYALKRVSFDAFDD 478

Query: 510 SSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDT 569
           SS+DGFKGEIELL+KL++++RV++L+DY MG G+L+L+MECG+HDLSQ+L QRS +  D 
Sbjct: 479 SSVDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMSLDF 538

Query: 570 EFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRD 629
            F+R++ +EM++C+KVVHDA IVHSDLKPANFV VKG+LKIIDFGIANAVP+HTVNIYR+
Sbjct: 539 NFIRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRE 598

Query: 630 NQIGTPNYMAPETLVAMNFTR---NDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTF 686
            QIGTPNYMAPE LVAMN+T+   N  E  KWKVG+PSD+WSCGCI+YQM+YGKPPYG+F
Sbjct: 599 TQIGTPNYMAPEALVAMNYTQTNENRQEGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSF 658

Query: 687 QGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALIN 746
           QG NRL AIMNPDVKIP+P+  S    IP++ I+ +++CL RNP  R T+D++LS   + 
Sbjct: 659 QGQNRLLAIMNPDVKIPFPDHTSNNERIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718

Query: 747 PVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
           P  ++   + DLI+NAV YG ++  ++++ + ++ E V  K A++K+
Sbjct: 719 PFMISGSIMEDLIRNAVRYGSEKPQISHDDLNDVVETVLRKFADYKI 765

>YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}
           MPS1Dual-specificity kinase required for spindle pole
           body (SPB) duplication and spindle checkpoint function;
           substrates include SPB proteins Spc42p, Spc110p, and
           Spc98p, mitotic exit network protein Mob1p, and
           checkpoint protein Mad1p
          Length = 764

 Score =  526 bits (1354), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 303/721 (42%), Positives = 415/721 (57%), Gaps = 138/721 (19%)

Query: 124 QKFKVLQQSMKEELYNSTTKSSNKRNRRF-ITSRLSSLGPAKR--NLSTSFNVDSPSESR 180
           ++ + L+Q+MKE++   T K + +R++RF I++R + LGPAKR   L+  F+ D P+   
Sbjct: 131 ERIRNLRQNMKEDI---TAKYAERRSKRFLISNRTTKLGPAKRAMTLTNIFDEDVPNSP- 186

Query: 181 VXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKD 240
                                +E+SH +N             F ET R            
Sbjct: 187 --------NQPINARETVELPLEDSHQTN-------------FKETKR------------ 213

Query: 241 PSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATS 300
                  N +Y++IDFGDLNP QY+KK+NLP+ +LP IS++YF++Q+EENR+  LRK +S
Sbjct: 214 -------NTDYDSIDFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSS 266

Query: 301 GTLALKREFTQYRR--------------TQTARQPRR-------------------KHNF 327
             L  K   +                  +    QPRR                   K N 
Sbjct: 267 RELLYKSRSSSSSLSSNNLLANKDNSITSNNGSQPRRKVSTGSSSSKSSIEIRRALKENI 326

Query: 328 GTDKTSLQDPLSSPLQKNQLVFQEVDREL---ANKREALKPLDVNNPSS----SQEAKRP 380
            T   S     +SP+ K   +++ + R     + KRE L+ + +N   +     QE KR 
Sbjct: 327 DTSNNS---NFNSPIHK---IYKGISRNKDSDSEKREVLRNISINANHADNLLQQENKRL 380

Query: 381 KYENDHVPED-----YRPPFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGCDV 435
           K   D    +          F HR AP P  +   KKVEIVEP KS             +
Sbjct: 381 KRSLDDAITNENINSKNLEVFYHRPAPKPPVT---KKVEIVEPAKS-----------ASL 426

Query: 436 SSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXXXXXXXXDHK 495
           S+  N                        ITVN + YEK+ELL               ++
Sbjct: 427 SNNRN-----------------------IITVNDSQYEKIELLGRGGSSRVYKVKGSGNR 463

Query: 496 VYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDL 555
           VYALKRVSFD FD+SSIDGFKGEIELL+KL++++RV++L+DY MG G+L+L+MECG+HDL
Sbjct: 464 VYALKRVSFDAFDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDL 523

Query: 556 SQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGI 615
           SQ+L QRS +P D  FVR++ +EM+ C+KVVHDA IVHSDLKPANFV VKG+LKIIDFGI
Sbjct: 524 SQILNQRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGI 583

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQ---AKWKVGKPSDVWSCGCI 672
           ANAVP+HTVNIYR+ QIGTPNYMAPE LVAMN+T+N   Q    KWKVG+PSD+WSCGCI
Sbjct: 584 ANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCI 643

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
           +YQM+YGKPPYG+FQG NRL AIMNPDVKIP+PE  S    IP++ I+ +++CL RNP  
Sbjct: 644 IYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMKACLYRNPDK 703

Query: 733 RVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFK 792
           R T+D++LS   + P  ++   + DLI+NAV YG ++ H++ + + ++ + V  K A++K
Sbjct: 704 RWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVDTVLRKFADYK 763

Query: 793 L 793
           +
Sbjct: 764 I 764

>Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON}
           YDL028C (REAL)
          Length = 769

 Score =  521 bits (1341), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 313/790 (39%), Positives = 443/790 (56%), Gaps = 159/790 (20%)

Query: 57  TSNHTEDQSQSTVFT-MVNKQFQPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNEESLMK 115
           TS HT   SQST+F   +    Q SMTTMNT   E               N L++     
Sbjct: 86  TSGHTSTSSQSTLFGRYLRNSHQTSMTTMNTSDIEMSVG-----------NSLDK----- 129

Query: 116 DDTHSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRF-ITSRLSSLGPAKR--NLSTSFN 172
                 + ++ K L+Q+MKE++   T+K + +R++RF I++R + LGPAKR   L + F+
Sbjct: 130 ------SFERIKNLRQNMKEDI---TSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD 180

Query: 173 VDSPSESRVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQHST 232
            D    S                     +   S  ++S   G+R                
Sbjct: 181 DDVADSS-------------NQLISISRETTESPLADSYQAGFR---------------- 211

Query: 233 PSHDENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRK 292
                        + ++ YE+IDF DLNP QY+KK+NL + +LP IS++YF+RQ+EEN++
Sbjct: 212 ----------GTRKKDMKYESIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQ 261

Query: 293 TVLRKATSGTLALKREFTQYRRT--------------QTARQPRRK-------------- 324
             LRK +S  L  +   +    +               ++ QPRRK              
Sbjct: 262 AALRKHSSRELLSRNRSSSTSLSSGNSLANKDASITFNSSSQPRRKVSTGSFSSKSSVEI 321

Query: 325 ---HNFGTDKTSLQDPLSSPLQKNQLVFQEVDREL---ANKREALKPLDVNNPSS----S 374
                   + +++  P + P+ K   +++E+ R       KRE L+ + +N   +     
Sbjct: 322 RKTFKENVNASNINSP-NGPVHK---IYKEISRNKDPDCEKREVLRNISINANHADNILQ 377

Query: 375 QEAKRPKY--------ENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVI 426
           QE KR K         EN+ V    +  F+ HR AP P  +K   KVEIVEP ++     
Sbjct: 378 QENKRLKRSLDDAIINENEDVNVKNQEVFY-HRPAPKPPVTK---KVEIVEPARTATS-- 431

Query: 427 PLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXX 486
                    SS  N                        ITVN + YEK+ELL        
Sbjct: 432 ---------SSNRN-----------------------MITVNDSQYEKIELLGRGGSSRV 459

Query: 487 XXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFL 546
                  +KVYALKRVSFD FD+SSIDGFKGEIELL+KL++++RV++L+DY MG G+L+L
Sbjct: 460 YKVKGSGNKVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDEKRVIQLLDYEMGDGLLYL 519

Query: 547 LMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG 606
           +MECG+HDLSQ+L QR  +  D  FVR++ +EM++C+KVVHDA IVHSDLKPANFV VKG
Sbjct: 520 IMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKG 579

Query: 607 MLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQ---AKWKVGKP 663
           +LKIIDFGIANAVP+HTVNIYR+ QIGTPNYMAPE LVAMN+T+N+  +    KWKVG+P
Sbjct: 580 ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRP 639

Query: 664 SDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIR 723
           SD+WSCGCI+YQM+YGKPPYG+FQG NRL AIMNPDVKIP+PE  S    IP++ I+ ++
Sbjct: 640 SDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMK 699

Query: 724 SCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSED 783
           +CL RNP  R T+D++L+   + P  +++  + DLI+NAV YG ++  ++++ + ++ E 
Sbjct: 700 ACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVET 759

Query: 784 VWNKLAEFKL 793
           V  K A++K+
Sbjct: 760 VLRKFADYKI 769

>Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  520 bits (1338), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 303/764 (39%), Positives = 427/764 (55%), Gaps = 154/764 (20%)

Query: 78  QPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEEL 137
           Q SMTTMNT                      N+  +   ++   + ++ + L+Q+MKE++
Sbjct: 108 QTSMTTMNT----------------------NDIEINVGNSLDKSFERIRNLRQNMKEDM 145

Query: 138 YNSTTKSSNKRNRRF-ITSRLSSLGPAKR--NLSTSFNVDSPSESRVXXXXXXXXXXXXX 194
              T+K + +R++RF I++R + LGPAKR   L+  F+ + P+ S               
Sbjct: 146 ---TSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFDEEVPNSS--------------- 187

Query: 195 XXXXXXDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKDPSANLQPNINYENI 254
                                     N+ +       T   D NK      + N++YE+I
Sbjct: 188 --------------------------NLPINPRETIETLLEDSNKSGFRESKKNMDYESI 221

Query: 255 DFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTLALKREFTQYRR 314
           +FGDLNP QY+KK+NLP+ +LP IS++YF++Q+EENR+  LRK +S  L  K   +    
Sbjct: 222 EFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSSRELLYKNRSSSTSL 281

Query: 315 TQTARQPRRKHNFGTDKTSL------------------------------QDPLSSPLQK 344
           +     P + ++     +SL                                  +SP+  
Sbjct: 282 SSNNLLPSKDNSITFINSSLPRRKISTGSSSSKSSIEIRRALKENIDTSNNSSFNSPIHN 341

Query: 345 NQLVFQEVDREL---ANKREALKPLDVNNPSS----SQEAKRPKYENDHVPEDYRP---- 393
              + +E+ R     + KR  L+ + +N   +     Q+ KR K   D V  +       
Sbjct: 342 ---IHKEISRNKDSDSEKRGVLRNISINANHADNILQQDNKRLKRSLDDVITNENENKKI 398

Query: 394 -PFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNGSF 452
              F HR AP P  +K   KVEIVEP KS              SS  N+           
Sbjct: 399 QEVFYHRPAPKPPVTK---KVEIVEPAKS-------------ASSSNNRS---------- 432

Query: 453 DTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXXXXXXXXDHKVYALKRVSFDEFDESSI 512
                       ITVN + YEK+ELL               +K+YALKRVSFD FD+SS+
Sbjct: 433 -----------MITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRVSFDAFDDSSV 481

Query: 513 DGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFV 572
           DGFKGEIELL+KL++++RV++L+DY MG G+L+L+MECG+HDLSQ+L QRS +P D  FV
Sbjct: 482 DGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFV 541

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQI 632
           R++ +EM+ C+KVVHDA IVHSDLKPANFV VKG+LKIIDFGIANAVP+HTVNIYR+ QI
Sbjct: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQI 601

Query: 633 GTPNYMAPETLVAMNFTR---NDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
           GTPNYMAPE LVAMN+T+   N  E  KWKVG+PSD+WSCGCI+YQM+YGKPPYG+FQG 
Sbjct: 602 GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQ 661

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVT 749
           NRL AIMNPDVKIP+PE  S    IP++ I+ +++CL RNP  R T+D++LS   + P  
Sbjct: 662 NRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFM 721

Query: 750 VTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
           ++   + DLIKNAV YG ++  ++++ + ++ E V  K +++K+
Sbjct: 722 ISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765

>TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.162
           YDL028C
          Length = 774

 Score =  517 bits (1331), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 268/570 (47%), Positives = 357/570 (62%), Gaps = 61/570 (10%)

Query: 249 INYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTLALKRE 308
           I+Y  I+ GDLNP+Q LKKYNLPS EL  ISK+YFE+QKEENRK +++K +         
Sbjct: 241 IDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGF--- 297

Query: 309 FTQYRRTQTARQPRRKHNFGTDKTSLQDPLSSPLQKNQLVFQEVD-----------RELA 357
            T       + +  R+ +F T   +    + S    N ++                 E  
Sbjct: 298 MTSISSNSVSSKISRQSSFHTTTNNRHSSMVSKQDTNAILMNTTSTRSDEKVMKPLNEYE 357

Query: 358 NKREALKPLDVNNP--SSSQEAKRP-----KYEND--HVPEDYRPPFFSHRKAPSPHDSK 408
             R+ L  +D+N     ++ E KRP      YE    H+ E       +  K  +  D+K
Sbjct: 358 PDRKVLASIDINKNINVNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVEKPHTFQDNK 417

Query: 409 P----FKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPT 464
                 KKVEIVEPP S                                T +++S ++  
Sbjct: 418 EGQKIVKKVEIVEPPTSM-------------------------------TNRKSSKSI-- 444

Query: 465 ITVNGTAYEKVELLXXXXXXXX-XXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLK 523
           ++VN   YE++ELL               +++VYALKRV FDEFD++S+D FKGEIELLK
Sbjct: 445 VSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGEIELLK 504

Query: 524 KLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCV 583
           KLEN++RVVKLI Y M  GVL+L+MECG+HDLSQ+L QR+ +P D +F+RY+ +EM+KCV
Sbjct: 505 KLENEKRVVKLIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCV 564

Query: 584 KVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETL 643
           KVVHDA IVHSDLKPANFV VKG+LKIIDFGIANAVPDHTVNIYRD QIGTPNYMAPE L
Sbjct: 565 KVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEAL 624

Query: 644 VAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIP 703
           VA+N   N  ++ +W+VGKPSD+WSCGCI+YQM YG+PPYG FQ  NRL AIMNP+VKI 
Sbjct: 625 VALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIV 684

Query: 704 YPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAV 763
           + EK S    +P++ +DT+++CL R+P  R T D++L  + +NPV VT + + DLI+NAV
Sbjct: 685 FSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAV 744

Query: 764 NYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
            YG DQ  V+ +++ EL++DV N+LA+F+L
Sbjct: 745 YYGSDQGQVSEDKITELADDVLNRLADFRL 774

>CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa]
           {ON} similar to uniprot|P54199 Saccharomyces cerevisiae
           YDL028c Serine/threonine protein kinase
          Length = 774

 Score =  483 bits (1244), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 312/794 (39%), Positives = 432/794 (54%), Gaps = 154/794 (19%)

Query: 54  TTHTSN---HTEDQSQSTVFTMVNKQFQPSMTTMNTVVKEXXXXXXXXXXXXXKYNKLNE 110
            TH+++   + ED S ST+F       QPS TT +   ++                    
Sbjct: 80  VTHSASSPLYFEDTSPSTMFVQSQASAQPSATTYDISSQD-------------------- 119

Query: 111 ESLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFI--TSRLSSLGPAKRNLS 168
                D + S    K K  Q ++K+EL   TT+ S +R RRF+  T+R + LGPA RNL+
Sbjct: 120 ---YSDSSKSFI--KLKSKQDTLKQEL---TTRYSERRTRRFLHATNRTTKLGPALRNLT 171

Query: 169 T---SFNVDSPSESRVXXXXXXXXXXXXXXXXXXXDIENSHTSNSSNTGYRYHDHNIFLE 225
           +   + N ++  ++++                     E S  ++S +T   Y D   F +
Sbjct: 172 SPALAINDNNSIDNKMN--------------------ETSKVNSSFDTNNAYVD---FHQ 208

Query: 226 THRQ--HSTPSHDENKDPS--ANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKV 281
           T +    S   H+  KD       Q N +Y +I+  + NP QY+K +NLP+ EL  ISK 
Sbjct: 209 TKQDIYTSGEEHNNTKDNGKIGATQQN-DYSDINIHECNPIQYMKMHNLPTSELSKISKA 267

Query: 282 YFERQKEENRKTVLRKAT---SGTLALKREFTQYRRTQTARQPRRKHNFGTDKTSLQD-- 336
           YFE+QKEENRK  L+      S    LK     +   ++ ++    HN     T ++D  
Sbjct: 268 YFEKQKEENRKKALKNVNMKQSLNYDLKHYSNSFPSIESGKENNLIHN-----TEIEDFN 322

Query: 337 --------------------PLSSPLQKNQLVFQE---VDRELAN-------KREALKPL 366
                               P+S+   ++  +  E   + + L+N       +REAL+ +
Sbjct: 323 GRGHSTNNHSSSYLSNSHSHPVSTQFVESANIELEKPTLKKSLSNADSYRHTQREALQNI 382

Query: 367 DVNN--PSSSQEAKRPKYENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPKSTVE 424
           DVN+     + + KR K     + +         +K       +  K+VEIVEPP ST  
Sbjct: 383 DVNSNVRDGAIDYKRQKIA---LKDSEFDGILDKKKY------RGIKRVEIVEPPTST-- 431

Query: 425 VIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXX 484
                                           R       ++VNGT YE+VELL      
Sbjct: 432 --------------------------------RPPSRKNVVSVNGTEYERVELLGRGGSS 459

Query: 485 XXXXXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVL 544
                    ++VYALK+VSFDEFDESS++GFKGEI LLK+L+N+ RVV+L D+ MG GVL
Sbjct: 460 NVYKVRGLKNRVYALKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVL 519

Query: 545 FLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV 604
           +LLMECG++DLSQVL QR+  PFD EF+RYH +EM+ CVKVVHDA IVHSDLKPANFVFV
Sbjct: 520 YLLMECGDYDLSQVLHQRANQPFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFV 579

Query: 605 KGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTR-NDG----EQAKWK 659
           KG+LKIIDFGIANAVPDHTVNIYRD QIGTPNYMAPE LVA N+T  NDG    +  KWK
Sbjct: 580 KGILKIIDFGIANAVPDHTVNIYRDMQIGTPNYMAPEALVANNYTADNDGKYDQKTNKWK 639

Query: 660 VGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVI 719
           +GKP+D+WSCGCI+YQM+YGKPPY  +QG  RL +IM+P+VKI Y E     TVIP   +
Sbjct: 640 IGKPADIWSCGCIIYQMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLAL 699

Query: 720 DTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEE 779
           + ++ CL RNP  R +  Q+L    +NP+ V++ FI +LI  AV+YG  +  V+  R+E 
Sbjct: 700 ELMQYCLMRNPEERWSALQILDSPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEA 759

Query: 780 LSEDVWNKLAEFKL 793
           L++ V  +LA+F++
Sbjct: 760 LTDSVLARLADFRM 773

>KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3.162
           YDL028C
          Length = 765

 Score =  462 bits (1190), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 255/576 (44%), Positives = 347/576 (60%), Gaps = 85/576 (14%)

Query: 245 LQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTLA 304
           + P ++Y NI FGDLNP+QY+ KYN+P  ELP ISKVY E++KEENR+  LRK +S +L 
Sbjct: 248 MTPQVDYSNIVFGDLNPFQYVNKYNIPMEELPQISKVYIEKRKEENRRVALRKHSSSSLN 307

Query: 305 LKREFTQYRRTQTARQPRRKHN-------FG-----TDKTSLQDPL--SSPLQKNQ---- 346
           +    +QY   +     + + N        G     +D+T    PL   +P+Q N+    
Sbjct: 308 VVSNSSQYWANKGNYDDKSEENEKPVADLLGPAIRHSDQTGTSGPLPPRTPVQLNESNHN 367

Query: 347 LVFQEVD---------RELANKREALKPLDVNNPSSSQEAKRPKYENDHVPEDYRPPFFS 397
           ++ QE+           +L  KRE L  L+VN      E K+PK   +++ +  +P    
Sbjct: 368 VMKQELPAHNNENYNVNKLIRKREVLANLNVN--QKEPELKKPK---NNLEQLDKPAII- 421

Query: 398 HRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKR 457
                        K+VEI EP  S                                 KK 
Sbjct: 422 -------------KRVEIQEPKPS---------------------------------KKN 435

Query: 458 TSYAVPTITVNGTAYEKVELLXXXXXXXXXXXXXXDHKVYALKRVSFDEFDESSIDGFKG 517
           TS     I +N   YEK+ELL                KV+ALKRV+ D F+ESS++ FKG
Sbjct: 436 TS-----IVINNEEYEKIELLGSGGSSKVYKVRDSSKKVFALKRVAIDMFEESSVESFKG 490

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           EI LL+KL+N++RVV+L +Y +   VL+L+MECG++DLS +L +R   P DTEFVRY+ +
Sbjct: 491 EIALLEKLKNQERVVQLYNYALESSVLYLIMECGDYDLSVMLRERLNKPLDTEFVRYYAR 550

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNY 637
           E+  CVKVVHD  IVHSDLKPANF+FVKG LKIIDFGIANAVP+HTVNIYR+ QIGTPNY
Sbjct: 551 EISHCVKVVHDVGIVHSDLKPANFIFVKGTLKIIDFGIANAVPEHTVNIYRETQIGTPNY 610

Query: 638 MAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMN 697
           MAPE LVAMN+T  +   ++WKVGKPSDVWS GCI+YQMVYGKPPY +FQGN+R+ AI+ 
Sbjct: 611 MAPEALVAMNYTNGESNVSRWKVGKPSDVWSLGCIIYQMVYGKPPYASFQGNDRIRAIIK 670

Query: 698 PDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHD 757
           P VKI YP     G  +P ++I+ I+ CL R+P  RV +D +L+   ++P+ V++ F+ D
Sbjct: 671 PSVKIEYPSVKE-GVTVPNSIIELIKVCLNRDPNKRVDVDGMLNSTFLSPILVSEAFVRD 729

Query: 758 LIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793
           L+KNAV YG  Q  V+   ++ L+ DV  KL+E+++
Sbjct: 730 LVKNAVEYGIKQGDVSITTIDALANDVIEKLSEYRI 765

>TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.162
           YDL028C
          Length = 980

 Score =  452 bits (1163), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 228/424 (53%), Positives = 279/424 (65%), Gaps = 47/424 (11%)

Query: 380 PKYENDHVPED---YRPP--FFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGCD 434
           P  + DH+P      RPP  F      P P   +  KKVEI+EP                
Sbjct: 594 PMQDIDHLPSSQPPVRPPPHFIPSLSQPQPQQVR--KKVEIIEP---------------- 635

Query: 435 VSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXXXXXXXXDH 494
                                K  +Y  P I VN   YEKV LL               +
Sbjct: 636 -------------------EAKIHNYQKPIIIVNNIEYEKVALLGRGGSSKVYKVKGPKN 676

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHD 554
             YALKRV FDEFD+SSI+GFKGEIELLKKLE+++RVV+L DY M  G L L+MECG+ D
Sbjct: 677 SYYALKRVLFDEFDDSSIEGFKGEIELLKKLEHEERVVRLFDYKMENGTLHLIMECGDLD 736

Query: 555 LSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFG 614
           LS++L QRSK P D EF+RY+ +EM+KCV+VVH+ DIVHSDLKPANFV V  +LKIIDFG
Sbjct: 737 LSRILHQRSKQPLDLEFIRYYSREMLKCVQVVHNNDIVHSDLKPANFVLVGSVLKIIDFG 796

Query: 615 IANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQA-----KWKVGKPSDVWSC 669
           IANAVPDHTVNIYR+ QIGTPNYMAPE LV+MN T N+ E A     +WKVGKPSDVWSC
Sbjct: 797 IANAVPDHTVNIYRECQIGTPNYMAPEALVSMNLTSNENENAQKPVNRWKVGKPSDVWSC 856

Query: 670 GCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERN 729
           GCILYQM YGKPPYG +QG NRL AIMNP+V+I YPE       IPR+ IDT+++CL R+
Sbjct: 857 GCILYQMFYGKPPYGHYQGQNRLLAIMNPEVEIKYPEFTPNNEPIPRSAIDTMKACLYRD 916

Query: 730 PISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLA 789
           P  R TI++LL+    +P+ VT FF+ DLIKN+V YG D+K+++NE +E++S+DV N+L 
Sbjct: 917 PSKRFTIEELLNNPFFSPIMVTPFFLQDLIKNSVRYGIDRKNISNEELEKMSDDVLNRLR 976

Query: 790 EFKL 793
           EF L
Sbjct: 977 EFIL 980

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 43/61 (70%)

Query: 250 NYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTLALKREF 309
           +Y +I+F  LNP QY +K++LP  ELP ++K Y ++Q+EENRK VL++ ++  + L  + 
Sbjct: 319 DYSSIEFNGLNPMQYWRKHDLPPSELPKLNKAYLQKQREENRKAVLKQRSTSRMILSNKM 378

Query: 310 T 310
           T
Sbjct: 379 T 379

>NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {ON}
           Anc_3.162
          Length = 641

 Score =  360 bits (925), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/546 (37%), Positives = 314/546 (57%), Gaps = 45/546 (8%)

Query: 255 DFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTL---ALKREFTQ 311
           + G+LNP+QYLKK NLP+ EL  ++K+Y  R+ +E R    +   +  +   + + E  Q
Sbjct: 134 ELGELNPFQYLKKNNLPTKELSRLTKLYCNRKLDETRSKKTQAIDAHEMNSSSDQLEKRQ 193

Query: 312 YRRTQTARQPRRKHNF--GTDKTSLQDPLSSPLQKNQLVFQEVDRELANKREALKPLDVN 369
            + T T R    K+       K  L+   S  LQ  + + Q     + N+++AL      
Sbjct: 194 RKVTTTTRSIYDKNRIIPSNVKNRLKKGTSGKLQSGR-IHQPYHLSVRNEQKALSQCQQE 252

Query: 370 NPSSSQEAK--RPKYENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIP 427
            P+++++AK    K  ++ V  DY    ++ +     H + P  K+E   P     + +P
Sbjct: 253 MPTANEQAKLISKKLVSERV--DYLIRDYNSKIQNKKHQTIP--KIEAPVP-----QSVP 303

Query: 428 LKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLXXXXXXXXX 487
            ++             N ++   S  T +  S               VELL         
Sbjct: 304 SQA-------------NLMSKQWSRITDEELSI--------------VELLGKGGSSKVY 336

Query: 488 XXXXXDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLL 547
                  K YALK++  +E DE+     + EIELLK+L  ++RVVKLI+Y +   ++ +L
Sbjct: 337 KVQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVL 396

Query: 548 MECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM 607
           MECG  DLS VL +R   PFD  FVR   +EMI+C+K VHD+DIVHSDLKPANF+FVKG 
Sbjct: 397 MECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGT 456

Query: 608 LKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVW 667
           LK+IDFGIAN + D+T+N+YR+ Q+GTPNYMAPETL++ N++ N      WK+GKPSD+W
Sbjct: 457 LKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSNN-NNNLLWKIGKPSDIW 515

Query: 668 SCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLE 727
           S GCILYQM YG PPY +F G++RL AIMNP+++I YP +   G  +P++++  I++CL 
Sbjct: 516 SYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLN 575

Query: 728 RNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNK 787
           R+P  R T D++   +  NP+ ++K F+  LI NA+NYG + +++  +R++ LS +V +K
Sbjct: 576 RDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSK 635

Query: 788 LAEFKL 793
           L+   L
Sbjct: 636 LSTLNL 641

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 130/268 (48%), Gaps = 30/268 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +VYA+K ++ D  D   ++  + EI+ L  L+    + +    ++    L+++ME C   
Sbjct: 47  RVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGG 105

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            L  +L +  KI  D +++    +E++  +K +H  +++H D+K AN +   +G +K+ D
Sbjct: 106 SLRSLL-RPGKI--DEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCD 162

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  V  +  ++ R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 163 FGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 209

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I+    K P  E  S+ T    ++ + I  CL+ +P  
Sbjct: 210 TYEIATGNPPYCDVEALRAMQLII--KSKPPRLEDRSYST----SLKEFIALCLDEDPKE 263

Query: 733 RVTIDQLLSGALI-----NPVTVTKFFI 755
           R++ D LL    I      P ++ K  I
Sbjct: 264 RLSADDLLKSKFIRAHKATPTSILKELI 291

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 130/268 (48%), Gaps = 30/268 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +VYA+K ++ D  D   ++  + EI+ L  L+    + +    ++    L++LME C   
Sbjct: 47  RVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDTSLWILMEYCAGG 105

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            L  +L +  KI  D +++    +E++  +K +H  +++H D+K AN +   +G +K+ D
Sbjct: 106 SLRSLL-RPGKI--DEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGSVKLCD 162

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  V  +  ++ R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 163 FGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 209

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I+    K P  E  S+ +    ++ + I  CL+ +P  
Sbjct: 210 TYEIATGNPPYCDVEALRAMQLII--KSKPPRLEGRSYSS----SLKEFIALCLDEDPKE 263

Query: 733 RVTIDQLLSGALI-----NPVTVTKFFI 755
           R++ D LL    I      P ++ K  I
Sbjct: 264 RLSADDLLRSKFIKTHRATPTSILKELI 291

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 87/316 (27%), Positives = 145/316 (45%), Gaps = 42/316 (13%)

Query: 496 VYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHD 554
           VYA+K ++ D  DE  ++  + EI+ L  L+    V +    ++    L+++ME C    
Sbjct: 66  VYAIKVLNLDS-DEDEVEDVQREIQFLASLKQLPNVTRYYGSYLKNTSLWIIMEYCAGGS 124

Query: 555 LSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDF 613
           L  +L +  KI  D +++    +E++  +K +H  +I+H D+K AN +   +G +K+ DF
Sbjct: 125 LRSLL-RPGKI--DEKYIGVIMRELLVALKFIHKDNIIHRDIKAANVLITNEGGVKLCDF 181

Query: 614 GIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCIL 673
           G+A  +   T  + R    GTP +MAPE ++       +G     KV    D+WS G   
Sbjct: 182 GVAAQLNQRT--LRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGITA 228

Query: 674 YQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISR 733
           Y++  G PPY   +    +  I     K P  E  ++  +I     + I  CL+ +P  R
Sbjct: 229 YEISTGNPPYCDVEALRAMQLIT--KSKPPRLEGRNYTPLIK----EFIALCLDEDPNER 282

Query: 734 VTIDQLLSGALI-----NPVTVTKFFI--HDLIKNAVN----YGCD------QKHVNNER 776
           ++ D+LL    I      P  V K  I  + L ++  N     G D      QK      
Sbjct: 283 LSADELLKSKFIKAHKTTPTIVLKELITRYLLFRDKNNRESVIGVDDDNNKRQKQSETPV 342

Query: 777 VEELSEDVWNKLAEFK 792
           V E S++  N   +FK
Sbjct: 343 VAESSDNTENSQLDFK 358

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 128/267 (47%), Gaps = 30/267 (11%)

Query: 496 VYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHD 554
           VYA+K ++ D  DE  ++  + EI+ L  L+    + +    ++    L+++ME CG   
Sbjct: 60  VYAIKVLNLDS-DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNTSLWIIMEYCGGGS 118

Query: 555 LSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDF 613
           L  +L +  KI  D +++    +E++  +K +H  +++H D+K AN +    G +K+ DF
Sbjct: 119 LRSLL-RPGKI--DEKYIGVIMREILIALKYIHKDNVIHRDIKAANVLINNDGSIKLCDF 175

Query: 614 GIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCIL 673
           G+A  +  +     R    GTP +MAPE ++       +G     K    +D+WS G   
Sbjct: 176 GVAAQL--NQTKSRRQTMAGTPYWMAPEVIM-------EGVYYDTK----ADIWSTGITA 222

Query: 674 YQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISR 733
           Y++  G PPY   +    +  I     K P  E  ++  +I     + I +CL+ +P  R
Sbjct: 223 YEVTTGNPPYCDVEALRAMQLIAKS--KPPRLEGRNYSALIK----EFIATCLDEDPSER 276

Query: 734 VTIDQLLSGALIN-----PVTVTKFFI 755
            T D+LL  A I      P ++ K  I
Sbjct: 277 PTADELLKTAFIKTYKPLPTSILKELI 303

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 124/253 (49%), Gaps = 25/253 (9%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +VYA+K ++ D  D   ++  + EI+ L  L+    + +    ++    L+++ME C   
Sbjct: 47  RVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEYCAGG 105

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            L  +L +  KI  D +++    +E++  +K +H  +++H D+K AN +   +G +K+ D
Sbjct: 106 SLRSLL-RPGKI--DEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCD 162

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  V  +  ++ R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 163 FGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 209

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I+    K P  E  S+      ++ + I  CL+ +P  
Sbjct: 210 TYEIATGNPPYCDVEALRAMQLII--KSKPPRLEGRSYSP----SLKEFIALCLDEDPKE 263

Query: 733 RVTIDQLLSGALI 745
           R++ D LL    I
Sbjct: 264 RLSADDLLRSKFI 276

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 113/231 (48%), Gaps = 35/231 (15%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L+KL   + + KL      +  L+ L+E   H D   ++ +   +  +    RY+  ++I
Sbjct: 177 LQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSL--NETCARYYASQII 234

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVN---------IYRDN 630
             V  +H+  I+H D+KP N +  K M +K+ DFG A  +P+   N         +Y  +
Sbjct: 235 DAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKS 294

Query: 631 Q--IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQG 688
           +  +GT  Y++PE L+  N+T +             D+W+ GCILYQM+ GKPP   F+ 
Sbjct: 295 KSFVGTAEYVSPE-LLNDNYTDSR-----------CDIWAFGCILYQMLAGKPP---FKA 339

Query: 689 NNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
            N  Y      +KI Y    +F    P+ V D ++  L R+P  R+TI Q+
Sbjct: 340 ANE-YLTFQKVMKIQY----AFTAGFPQIVKDLVKKLLVRDPNDRLTIKQI 385

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 129/268 (48%), Gaps = 30/268 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +V+A+K ++ D  D   ++  + EI+ L  L+    + +    ++    L+++ME C   
Sbjct: 47  RVFAIKVLNLDS-DSDEVEDVQREIQFLASLKQIHNITRYYGSYLKDTSLWIIMEYCAGG 105

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            L  +L +  KI  D +++    +E++  +K +H  +++H D+K AN +   +G +K+ D
Sbjct: 106 SLRSLL-RPGKI--DEKYIGVIMREVLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCD 162

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  V  +  ++ R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 163 FGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 209

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I+    K P  E  S+      ++ + I  CL+ +P  
Sbjct: 210 TYEIATGNPPYCEVEALRAMQLII--KSKPPRLEGRSYSP----SLKEFIALCLDEDPKE 263

Query: 733 RVTIDQLLSGALI-----NPVTVTKFFI 755
           R++ D LL    I      P ++ K  I
Sbjct: 264 RLSADDLLKSKFIKNHKTTPTSILKELI 291

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 133/268 (49%), Gaps = 30/268 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +VYA+K ++ D   E  ++  + EI+ L  L+    + +    ++    L+++ME C   
Sbjct: 40  QVYAIKVLNLDS-SEDEVEDVQREIQFLASLKQIPNITRYYGSYLRGTSLWIIMEYCAGG 98

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            L  +L +  KI  D +++    +E++  +KV+H  +++H D+K AN +   +G +K+ D
Sbjct: 99  SLRSLL-RPGKI--DEKYIGVIMRELLVALKVIHKDNVIHRDIKAANVLITNEGQVKLCD 155

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  +  +  ++ R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 156 FGVAAQL--NQTSLRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 202

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I+    K P  E+ ++    P+ + + I  CL+ +P  
Sbjct: 203 AYEIATGNPPYCDVEALRAMQLIIKS--KPPRLEERNY---TPQ-LKEFIALCLDEDPQE 256

Query: 733 RVTIDQLLSGALI-----NPVTVTKFFI 755
           R++ ++LL    I      P T+ K  I
Sbjct: 257 RLSAEELLKTKFIKTHKATPTTILKELI 284

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 112/234 (47%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L N   V++L D       L++++E  E  +L  +L +R  +P + E +
Sbjct: 74  GIEREIVIMKLL-NHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLP-ENEAI 131

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +KI DFG+A      T +   +  
Sbjct: 132 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAAL---ETEDKLLETS 187

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG ILY ++ G+ P+    GN R
Sbjct: 188 CGSPHYAAPEIVSGIPYH-----------GFASDVWSCGVILYALLTGRLPFDEEDGNIR 236

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   PE D     I +   + I   L  NP  R+T   +L   L+
Sbjct: 237 NLLLKVQAGQFEMPEDDE----ISKEAQNLISKILVVNPAERITARDILKHPLL 286

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 109/230 (47%), Gaps = 33/230 (14%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIK 581
           L+KL   + +++L      +  L+ L+E   H     L ++     + +  RY+  ++I 
Sbjct: 176 LQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLALIKKYG-SLNEQCARYYASQIID 234

Query: 582 CVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDH-----------TVNIYRD 629
            V  +H   I+H D+KP N +  K M +K+ DFG A  +P+             +N    
Sbjct: 235 AVDSLHTIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARSK 294

Query: 630 NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
           + +GT  Y++PE L   N +  D            D+W+ GCIL+QMV GKPP   F+ +
Sbjct: 295 SFVGTAEYVSPELL---NDSYTDSR---------CDIWAFGCILFQMVAGKPP---FKAS 339

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
           N  Y      +KI Y    +F    P+ + D ++  L + P  R+TI+Q+
Sbjct: 340 NE-YLTFQKVMKIQY----AFTAGFPQIIKDLVKKLLVKEPNDRLTIEQI 384

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 111/231 (48%), Gaps = 35/231 (15%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L+KL   + +++L      +  L+ L+E   H D   ++ +   +  +    RY+  ++I
Sbjct: 177 LQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSL--NEICARYYASQII 234

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVN---------IYRDN 630
             V  +H   I+H D+KP N +  K M +K+ DFG A  +P+   N         +Y  +
Sbjct: 235 DAVDSLHSIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKS 294

Query: 631 Q--IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQG 688
           +  +GT  Y++PE L   N +  D            D+W+ GCILYQM+ GKPP   F+ 
Sbjct: 295 KSFVGTAEYVSPELL---NDSYTDSR---------CDIWAFGCILYQMLAGKPP---FKA 339

Query: 689 NNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
            N  Y      +KI Y    +F    P+ V D ++  L R+P  R+ I+Q+
Sbjct: 340 ANE-YLTFQKVMKIQY----AFTAGFPQIVKDLVKKLLVRDPNDRLAIEQI 385

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 96.7 bits (239), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 110/231 (47%), Gaps = 35/231 (15%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L+KL   + +++L      +  L+ L+E   H D   ++ +   +  + +  RY+  ++I
Sbjct: 177 LQKLNGTKGIIRLFFTFQDEASLYFLLEYASHGDFLGLIKKYGSL--NEKCARYYASQII 234

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVN---------IYRDN 630
             V  +H   I+H D+KP N +  K M +K+ DFG A  +P+   N         +Y  +
Sbjct: 235 DAVDSLHAIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARS 294

Query: 631 Q--IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQG 688
           +  +GT  Y++PE L   N +  D            D+W+ GCILYQMV GKPP   F+ 
Sbjct: 295 KSFVGTAEYVSPELL---NDSYTDSR---------CDIWAFGCILYQMVAGKPP---FKA 339

Query: 689 NNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
            N  Y      +KI Y    +F    P    D ++  L R P  R+T++Q+
Sbjct: 340 ANE-YLTFQKVMKIQY----AFTAGFPLIAKDLVKKLLVREPNDRLTVEQI 385

>TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3.177
           YAR019C
          Length = 1295

 Score = 97.1 bits (240), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 125/260 (48%), Gaps = 29/260 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +V A+K+V++D  ++  ++    EI LLK L N + +VK   +      L++L+E C   
Sbjct: 103 QVIAIKQVNYD--NDEELNDIMSEINLLKNL-NHKHIVKYHGFMQKSDTLYILLEYCAHG 159

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIID 612
            L  +++    IP + +  +Y  Q +   V  +H   ++H D+K AN +  K   +K+ D
Sbjct: 160 SLKNLISSSKGIP-EKDAQQYIIQTLYGLV-YLHAQGVIHRDIKAANILLDKDNTVKLAD 217

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG++  V + T+ +      G+ N+MAPE L       N G          SD+WS G  
Sbjct: 218 FGVSTRVGNATMAM---TLAGSLNWMAPEIL------GNKGASTL------SDIWSLGAT 262

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
           + +++ G PP+      N  YAI N D  IP PE          T ID +  C ++N   
Sbjct: 263 VVELITGNPPFHNLVDINIYYAIEN-DNYIP-PEG-----AFSETAIDFLNLCFKKNMYR 315

Query: 733 RVTIDQLLSGALINPVTVTK 752
           R T  QLL+   + P+T  K
Sbjct: 316 RPTAQQLLNHKWLQPMTSPK 335

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 130/268 (48%), Gaps = 30/268 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           ++YA+K ++ D  DE  ++  + E++ L  L+    + +    ++    L+++ME C   
Sbjct: 61  QIYAIKVLNLDS-DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDTSLWIIMEYCAGG 119

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            L  +L +  KI  D +++    +E++  +K +H  +++H D+K AN +   +G +K+ D
Sbjct: 120 SLRSLL-RPGKI--DEKYIGVIMRELLVALKYIHKDNVIHRDIKAANVLITNEGSVKLCD 176

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  +   T  + R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 177 FGVAAQLNQST--LRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 223

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I     K P  E  S+  ++     + I  CL+ +P  
Sbjct: 224 AYEIATGNPPYCEVEALRAMQLIT--KSKPPRLESRSYTPLLK----EFIALCLDEDPKE 277

Query: 733 RVTIDQL-----LSGALINPVTVTKFFI 755
           R++ ++L     +    + PV++ K  I
Sbjct: 278 RLSAEELSKTKFIKAHKLTPVSILKELI 305

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 117/242 (48%), Gaps = 30/242 (12%)

Query: 508 DESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIP 566
           D S+  G + EI ++K L +   V+ L +    +  L+L++E     +L   L  + K+ 
Sbjct: 200 DNSNRYGIEREIVIMK-LVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLT 258

Query: 567 FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTV 624
            + E VRY F+++I+ V+  H  +I H DLKP N +  K   ++KI DFG+A        
Sbjct: 259 -ELEAVRY-FKQIIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAAL---QVS 313

Query: 625 NIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYG 684
           N       G+P+Y +PE  + M  T N G         PSDVWSCG IL+ ++ G  P+ 
Sbjct: 314 NTLLKTSCGSPHYASPE--IVMGKTYNGG---------PSDVWSCGIILFALLTGHLPFN 362

Query: 685 TFQGNNRLYAIMNPDVKIP-YPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGA 743
                  L  + N   ++P Y  KD+          D I   L  NP +R+T +Q+L   
Sbjct: 363 DDSIKKLLIKVQNGRYQMPNYLSKDA---------KDLISRILLVNPKARLTTEQILEHP 413

Query: 744 LI 745
           LI
Sbjct: 414 LI 415

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 110/234 (47%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L+L++E  E  +L  +L +R  +P + E +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-EHEAI 134

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  V   H   IVH DLKP N +   K  +KI DFG+A      T     +  
Sbjct: 135 RF-FRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETS 190

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R
Sbjct: 191 CGSPHYAAPEIVSGIPYQ-----------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   P  D     I R   D IR  L  +P  R+    +L   L+
Sbjct: 240 TLLLKVQKGEFEMPSDDE----ISREAQDLIRKILTVDPERRIKTRDILKHPLL 289

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 128/268 (47%), Gaps = 30/268 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           ++YA+K ++ D  DE  ++  + EI+ L  L+    + +    ++    L+++ME C   
Sbjct: 66  QIYAIKVLNLDS-DEDEVEDVQREIQFLASLKQLPNITRYYGSYLKDTSLWIIMEYCAGG 124

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            L + L +  KI  D +++    +E++  +K +H  +I+H D+K AN +   +G +K+ D
Sbjct: 125 SL-RTLLRPGKI--DEKYIGVITREILIALKYIHKDNIIHRDIKAANVLITNEGSIKLCD 181

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  +   T    R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 182 FGVAAQLNQSTKR--RQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 228

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I     K P  E  ++  ++     + +  CL+ +P  
Sbjct: 229 TYEIATGNPPYCEIEALRAMQLIT--KSKPPRLEGRNYSPLLK----EFVALCLDEDPKE 282

Query: 733 RVTIDQLLSGALI-----NPVTVTKFFI 755
           R++ + LL    I      PV++ K  I
Sbjct: 283 RMSAEDLLKTKFIKAHKLTPVSILKELI 310

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 109/234 (46%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L+L++E  E  +L  +L +R  +P + E +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  V   H   IVH DLKP N +   K  +KI DFG+A      T     +  
Sbjct: 135 RF-FRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETS 190

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R
Sbjct: 191 CGSPHYAAPEIVSGIPYQ-----------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   P  D     I R   D I   L  +P  R+    +L   L+
Sbjct: 240 TLLLKVQKGEFELPSDDE----ISREAQDLISRILTVDPERRIKTRDILKHPLL 289

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 109/227 (48%), Gaps = 22/227 (9%)

Query: 521 LLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           ++ KL N   V++L D       L+L++E  E  +L  +L +R  +P + E VR  F+++
Sbjct: 81  IIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP-ENEAVR-AFRQI 138

Query: 580 IKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPNYM 638
           I  +   H   +VH DLKP N +    + +KI DFG+A    +  +    +   G+P+Y 
Sbjct: 139 IIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKL---LETSCGSPHYA 195

Query: 639 APETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNP 698
           APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R   +   
Sbjct: 196 APEIISGLPYE-----------GFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ 244

Query: 699 DVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             +   P+ D     I +   D +   L  +P  R+TI ++L   L+
Sbjct: 245 KGEFEMPDDDE----ITKEAQDLLARLLTVDPSKRITIREILKHPLL 287

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 109/234 (46%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L+L++E  E  +L  +L +R  +P + E +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  V   H   IVH DLKP N +   K  +KI DFG+A      T     +  
Sbjct: 135 RF-FRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETS 190

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R
Sbjct: 191 CGSPHYAAPEIVSGIPYQ-----------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   P  D     I R   D I   L  +P  R+    +L   L+
Sbjct: 240 ALLLKVQKGEFELPSDDE----ISREAQDLISKILTVDPERRIKARDILKHPLL 289

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 123/253 (48%), Gaps = 25/253 (9%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +VYA+K ++ D  DE  ++  + E++ L  ++    +      ++    L++++E C   
Sbjct: 53  QVYAIKVLNLDS-DEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTTLWIIIEYCAGG 111

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            L + L +  KI  D +++    +E++  +K +H  +++H D+K AN +   +G +K+ D
Sbjct: 112 SL-RTLLRPGKI--DEKYIGIIMREVLIALKYIHKDNVIHRDIKAANVLITNEGHVKLCD 168

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  +  +  ++ R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 169 FGVAAQL--NQSSLKRQTMAGTPYWMAPEVIM-------EGVSYDTKV----DIWSLGIT 215

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I     K P  E   +  ++     + I  CL+ +P  
Sbjct: 216 TYEIATGNPPYCDVEALRAMQLITK--SKPPRLEGRHYSPMLK----EFIALCLDEDPKE 269

Query: 733 RVTIDQLLSGALI 745
           R++ D LL   LI
Sbjct: 270 RLSADDLLKSKLI 282

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 111/234 (47%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L++++E  E  +L  +L +R  +P + E +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +KI DFG+A      T +   +  
Sbjct: 135 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEDKLLETS 190

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  +DVWSCG IL+ ++ G+ P+    GN R
Sbjct: 191 CGSPHYAAPEIISGLPYH-----------GLETDVWSCGIILFALLTGRLPFDEEDGNIR 239

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   P  D     I R   D I   L  +P  R+   ++L   L+
Sbjct: 240 NLLLKVQSGQFEMPGNDE----ISREAQDLISKILTVDPKKRIKTREILKHPLV 289

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 127/268 (47%), Gaps = 30/268 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +V+A+K ++ D  DE  ++  + E++ L  ++    + +    ++    L++++E C   
Sbjct: 50  QVFAIKVLNLDS-DEDEVEDVQREVQFLASMKQVPNITQYYGSYLKDTTLWIIIEYCAGG 108

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIID 612
            L + L +  KI  D +++    +E++  +K +H  +++H DLK AN +    G +K+ D
Sbjct: 109 SL-RTLLRPGKI--DEKYIGVIMRELLIALKFIHRDNVIHRDLKAANVLITNDGQVKLCD 165

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  +  +  N  R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 166 FGVAAQL--NQSNSRRHTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 212

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y+   G PPY   +    +  I     K P  E  S+  ++     + I  CL+ +P  
Sbjct: 213 TYEAATGNPPYCEVEALRAMQLITK--SKPPRLEGRSYSPLLK----EFIALCLDEDPKE 266

Query: 733 RVTIDQLLSGALI-----NPVTVTKFFI 755
           R++ ++LL    I      P T+ K  I
Sbjct: 267 RLSAEELLKTKFIKAHKATPTTLLKQLI 294

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 108/229 (47%), Gaps = 33/229 (14%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L++L N + +VKL      +  L+ L+E   + D   V+ +   +  D    RY+  ++I
Sbjct: 234 LQRLNNSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDC--TRYYSAQII 291

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAV---------PDHTVNIYRDN 630
             +K +H   I+H D+KP N +  K M +KI DFG A  +         P+  +     +
Sbjct: 292 DGIKYLHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKS 351

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
            +GT  Y++PE L       ND       V    D+W+ GC+++QM+ GKPP   F+  N
Sbjct: 352 FVGTAEYVSPELL-------NDS-----YVDARCDIWAFGCMVFQMIAGKPP---FKATN 396

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
             Y      +K+ Y    +F    P  V D ++  L + P  R+TI Q+
Sbjct: 397 E-YLTFQKVMKVQY----AFTAGFPVVVRDLVKRILLKVPEQRLTIPQI 440

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 114/226 (50%), Gaps = 30/226 (13%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L++L N + +++L      +  L+ L+E   + DL  ++ +   +  + E   Y+  ++I
Sbjct: 226 LQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSL--NEECCCYYGAQII 283

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIA----NAVPDHTVNIYRDNQ--IG 633
             +K +H   I+H D+KP N +  K M +KI DFG A    N  P  + ++   ++  +G
Sbjct: 284 DAIKFMHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVG 343

Query: 634 TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLY 693
           T  Y++PE L+  N+T  D           SD+W+ GCI++QM+ GKPP   F+  N  Y
Sbjct: 344 TAEYVSPE-LLNDNYT--DAR---------SDIWAFGCIVFQMIAGKPP---FKATNE-Y 387

Query: 694 AIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
                 +K+ Y    +F    P  V D ++  L + P  R+TI+ +
Sbjct: 388 LTFQKVMKVQY----AFTAGFPTVVRDLVKRILIKAPEQRLTIEAI 429

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 112/235 (47%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL +   ++ L +    +  LFL++E  E  +L   L  + K+P + E V
Sbjct: 116 GIEREI-IIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLP-EQEAV 173

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++I+ V   H+ +I H DLKP N +  K    +KI DFG+A      T N   + 
Sbjct: 174 HY-FRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAAL---ETTNKLLET 229

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++  N+            G PSDVWSCG IL+ ++ G  P+       
Sbjct: 230 SCGSPHYASPEIVMGKNYH-----------GSPSDVWSCGIILFALLTGHLPFNDDNIKK 278

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  + +    +P          I     D I   L  +P  R+TI+++L   LI
Sbjct: 279 LLLKVQSGKYHMPQN--------ISSEAQDLISKILIVDPRGRITINEVLQHPLI 325

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 109/234 (46%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L+L++E  E  +L  +L +R  +P + E +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  V   H   IVH DLKP N +   K  +KI DFG+A      T     +  
Sbjct: 135 RF-FRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETS 190

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R
Sbjct: 191 CGSPHYAAPEIVSGIPYQ-----------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   P  D     + R   D I   L  +P  R+    +L   L+
Sbjct: 240 TLLLKVQKGQFELPSDDE----VSREAQDLICKILTVDPKRRIKARDILKHPLL 289

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 114/227 (50%), Gaps = 31/227 (13%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L++L+N + ++ L      +  L+ L+E   + DL  ++ +   +  + +  +Y+  ++I
Sbjct: 207 LQRLKNTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSV--NEKCTQYYAAQII 264

Query: 581 KCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVN------IYRDNQ-I 632
             +  +HD  ++H DLKP N +  V   +K+ DFG A  +   + +      + R N  +
Sbjct: 265 DALGFMHDKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFV 324

Query: 633 GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRL 692
           GT  Y++PE L       ND       V    D+W+ GCIL+QM+ GKPP   F+ NN  
Sbjct: 325 GTAEYVSPELL-------NDNY-----VDFRCDIWAFGCILFQMIAGKPP---FKANNE- 368

Query: 693 YAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
           Y      +K+ +    +F    P TV D +++ L +NP  R+ I+Q+
Sbjct: 369 YLTFQKVMKVQF----AFTAGFPMTVRDLVKNILIKNPERRLLINQI 411

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 114/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + ++ME   ++L 
Sbjct: 73  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVMEYAGNELF 131

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  D    R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 132 DYIVQRDKMSEDE--ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 189

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 190 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 235

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    IP        T+I + +I         NP++R++
Sbjct: 236 MLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQGASTLIKKMLI--------VNPLNRIS 287

Query: 736 IDQLL 740
           I +++
Sbjct: 288 IQEIM 292

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 139/295 (47%), Gaps = 42/295 (14%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 66  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 124

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR+K+    +  R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 125 DYIVQRNKM--SEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 182

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 183 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 228

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTV--IPRTV----IDTIRSCLERN 729
           M+  + P+               D  IP   K+    V  +P+ +     D I+  L  N
Sbjct: 229 MLCRRLPFD--------------DESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLIVN 274

Query: 730 PISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDV 784
           P++R++I +++       V + ++ +   +K    +  ++K  N E VEE+ +++
Sbjct: 275 PLNRISIHEIMQDEWFK-VDLAEYLVPQDLKQQEQF--NKKSGNEENVEEIDDEM 326

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 116/245 (47%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E  +H+L 
Sbjct: 57  ALKIINKKVLSKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYADHELF 115

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  + E  R+ FQ++I  V+  H   IVH DLKP N +  +   +KI DFG+
Sbjct: 116 DYIVQREKMS-ENEGRRF-FQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGL 173

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 174 SNIITDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 219

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           ++  + P+           I N    IP    +   ++I + +I         NP++R+T
Sbjct: 220 LLCRRLPFDDESIPTLFKNINNGVYTIPNFLSEGAASLIKKMLI--------VNPMNRIT 271

Query: 736 IDQLL 740
           I  ++
Sbjct: 272 IGDII 276

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 124/286 (43%), Gaps = 79/286 (27%)

Query: 512 IDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRS------- 563
           ++  + EI +LKKL N + +V LID    +    L+ME C   DL+ ++ +R+       
Sbjct: 175 LENLEIEISILKKL-NHKHIVNLIDCQRNKNDFLLIMEYCSLGDLTFLIKKRNELIINHP 233

Query: 564 -------KIP--------FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF----- 603
                  K P         +  FV  + Q++   +K +   +++H D+KP N +      
Sbjct: 234 LLNQIFQKFPSPNPDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYT 293

Query: 604 -----------------VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAM 646
                               +LKI DFG A  +P+ ++    +   G+P YMAPE L   
Sbjct: 294 DYHDQQTFKKLGYIGISCLPILKIADFGFARFLPNTSL---AETLCGSPLYMAPEIL--- 347

Query: 647 NFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR---LYAIMNPDVKIP 703
           N+ + + +         +D+WS G +LY+MVYGKPP   F+ NN    L  I   +  IP
Sbjct: 348 NYQKYNAK---------ADLWSVGTVLYEMVYGKPP---FKANNHLELLKKIKRTNDNIP 395

Query: 704 YPE----KDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
           +P      D    +I R         L+ +PI R++  +     LI
Sbjct: 396 FPSYIEIDDDMKFLISR--------LLKFDPIKRMSFQEFFENNLI 433

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 113/233 (48%), Gaps = 33/233 (14%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           E   L+KL N   VV+L      +  L+ L+E   + D   ++ +   +  D    RY+ 
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSL--DETCARYYA 284

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIA-------NAV--PDHTVNI 626
            ++I  +  +H   I+H D+KP N +    M +K+ DFG A       N+V  P++ ++ 
Sbjct: 285 AQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLST 344

Query: 627 YRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTF 686
              + +GT  Y++PE L+  +FT        ++     D+W+ GCIL+QM+ GKPP   F
Sbjct: 345 RSKSFVGTAEYVSPE-LLNDSFT-------DYRC----DIWAFGCILFQMIAGKPP---F 389

Query: 687 QGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
           +  N  Y      +K+ Y    +F    P  + D ++  L +N   R+TI Q+
Sbjct: 390 KATNE-YLTFQKVMKVQY----AFTPGFPLIIRDLVKKILVKNLDRRLTISQI 437

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 113/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   +++L D    +  + +++E   H+L 
Sbjct: 69  ALKIINRKVLSKSDMQGRIEREIAYLRLLRHPH-IIRLYDVIKSKDEIIMIIEYAHHELF 127

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  +    R  FQ++I  V   H   IVH DLKP N +  +   +KI DFG+
Sbjct: 128 DYIVQRDKMSENE--ARKFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGL 185

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 186 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 231

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P    D   ++I + +I         NPI+R++
Sbjct: 232 MLCRRLPFDDESIPILFKNISNGIYTLPNFLSDGAASLIKKMLI--------VNPINRIS 283

Query: 736 IDQLL 740
           I +++
Sbjct: 284 ISEIM 288

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 140/297 (47%), Gaps = 31/297 (10%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 72  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIIVIEFASNELF 130

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+    +  R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 131 DYIIQRDKM--SEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGL 188

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 189 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 234

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+   +    L+  ++  V I  P+  S G        + I+  L  NP++R++
Sbjct: 235 MLCRRLPFDD-ESIPVLFKNISNGVYI-LPKFLSLGAA------NLIKKMLIVNPLNRIS 286

Query: 736 IDQLLSGALINPVTVTKFFIHDLIK--NAVNY-GCDQKHVNNERVEELSEDVWNKLA 789
           I ++        V +    I D +K  N  ++ G     + + + EE+ +D+ N L+
Sbjct: 287 ISEIFKDEWFQ-VDLPDHLIPDYLKGGNGDDFEGKGNDAMEDNQPEEIDDDLVNALS 342

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 113/235 (48%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL     ++ L +    +  L+L++E  E  +L   L  R K+P + E +
Sbjct: 110 GIEREI-IIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLP-EQEAI 167

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++++ V   H+ +I H DLKP N +  K    +KI DFG+A      T N   + 
Sbjct: 168 HY-FKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAAL---ETTNRLLET 223

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++   +            G PSDVWSCG IL+ ++ G  P+       
Sbjct: 224 SCGSPHYASPEIVMGQKYH-----------GSPSDVWSCGIILFALLTGHLPFNDDNVRK 272

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  + +   ++P        + + +   D I   L  +P  R+T+D++L   L+
Sbjct: 273 LLLKVQHGRYQMP--------SNVSKEAKDLISKILVVDPEKRITVDKILEHPLL 319

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 112/234 (47%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L N   V++L D       L++++E  E  +L  +L +R  +P + E V
Sbjct: 75  GIEREITIMKLL-NHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLP-ENEAV 132

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +K+ DFG+A      + +   +  
Sbjct: 133 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETS 188

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG ILY ++ G+ P+    GN R
Sbjct: 189 CGSPHYAAPEIVSGLPYH-----------GFESDVWSCGVILYALLTGRLPFDEDDGNIR 237

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   P+KD     I     D I   L  +P  R+   ++L   L+
Sbjct: 238 KLLLKVQSGEFEMPDKDE----ISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 110/234 (47%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L D       L++++E  E  +L  +L ++  +P + E V
Sbjct: 80  GIEREIIIMKLLRHAN-VLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP-EKEAV 137

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +KI DFG+A      T +   +  
Sbjct: 138 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ETEDKLLETS 193

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R
Sbjct: 194 CGSPHYAAPEIVSGIPYH-----------GFESDVWSCGVILFALLTGRLPFDEEDGNIR 242

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   P+ D       R   D I   L  +P  R+   ++L   L+
Sbjct: 243 NLLLKVQSGQFEMPDDDEMS----RDAQDLISRILTVDPTKRIKTREILKHPLL 292

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 111/235 (47%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL +   V+ L +    +  L+L++E  E  +L   L  R K+P + E V
Sbjct: 113 GIEREI-IIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLP-EQEAV 170

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGML--KIIDFGIANAVPDHTVNIYRDN 630
            Y F+++++ V   H  +I H DLKP N +  K  L  KI DFG+A      T +   + 
Sbjct: 171 HY-FKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAAL---ETTDKLLET 226

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++   +            G PSDVWSCG IL+ ++ G  P+       
Sbjct: 227 SCGSPHYASPEIVMGQKYH-----------GSPSDVWSCGIILFALLTGHLPFNDDNVKK 275

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  + +   ++P          I     D I   L  +P  R+TID++L   L+
Sbjct: 276 LLLKVQSGKYQMPQN--------ISNEAKDLIAKILIVDPAMRITIDEVLEHPLL 322

>SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1071

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 110/227 (48%), Gaps = 29/227 (12%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L++L N + V+KL      +  L+ L+E   + D   V+ +   +  + E  RY+  +M+
Sbjct: 234 LQRLNNSRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSL--NEECCRYYGAQML 291

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAV---PDHTVNIYRDNQ--IGT 634
             +  +H   +VH D+KP N +  + M +K+ DFG A  +        N+ + ++  +GT
Sbjct: 292 DAIDFIHKNGVVHRDIKPENILLDEHMKVKLTDFGTAKLLDRDEKSGYNLLKKSRSFVGT 351

Query: 635 PNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYA 694
             Y++PE L       ND       V    D+W+ GCILYQM+ GKPP   F+  N  Y 
Sbjct: 352 AEYVSPELL-------NDN-----CVNYKCDIWAFGCILYQMIAGKPP---FKATNE-YL 395

Query: 695 IMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLS 741
                +K+ Y    +F    P  + D ++  L ++P +R+   Q+ S
Sbjct: 396 TFQKVMKVQY----AFTAGFPLVIRDLVKQLLVKSPEARLNASQVKS 438

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score = 89.7 bits (221), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 115/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E  +H+L 
Sbjct: 69  ALKIINKKILAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKEDIIMVIEYADHELF 127

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  +    R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 128 DYIVQRDKMSENE--ARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGL 185

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 186 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 231

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P         +I R +I         NP++R++
Sbjct: 232 MLCRRLPFDDDSIPVLFKNISNGIYTLPKFLSPGAANLIKRMLI--------VNPLNRIS 283

Query: 736 IDQLL 740
           +++++
Sbjct: 284 MNEIM 288

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 114/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 81  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 139

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  D    R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 140 DYIVQRDKMSEDE--ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 197

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 198 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 243

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P        ++I R +I         NP++R++
Sbjct: 244 MLCRRLPFDDESIPVLFKNISNGVYSLPKFLSPGAASLIKRMLI--------VNPLNRIS 295

Query: 736 IDQLL 740
           I +++
Sbjct: 296 IHEIM 300

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 114/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 95  ALKIINKKVLAKSDMQGRVEREISFLRLLRHPH-IIKLYDVIKSKDEIIMVIEYANNELF 153

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
           + + QR K+  +    R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 154 EYIVQRDKMTENE--ARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGL 211

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 212 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 257

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P          +     + I+  L  NP++R++
Sbjct: 258 MLCRRLPFDDDSIPALFKNISNGIYTLP--------KFLSEGAANLIKKMLIVNPLNRIS 309

Query: 736 IDQLL 740
           + +++
Sbjct: 310 MTEII 314

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 126/259 (48%), Gaps = 35/259 (13%)

Query: 495  KVYALKRVSFDEF---DESSI---DGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLM 548
            ++ A+K+V+  EF   DES+I   +  K E+  LK L N   +V+ + +    G+  L +
Sbjct: 1062 EMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NHVNIVQYLGFEEKNGIYSLFL 1120

Query: 549  E-CGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-G 606
            E      +  ++    +  FD + +R+  +++++ +  +H   I+H D+K  N +    G
Sbjct: 1121 EYVAGGSVGSLIRMYGR--FDDQLIRHLTKQVLEGLAYLHSKGILHRDMKADNLLLDNDG 1178

Query: 607  MLKIIDFGIANAVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKP 663
            + KI DFGI+      + NIY ++ +   GT  +MAPE +   +     G  AK      
Sbjct: 1179 VCKISDFGISR----KSNNIYSNSDMTMRGTVFWMAPEMVDTAH-----GYSAK------ 1223

Query: 664  SDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIP--RTVIDT 721
             D+WS GC++ +M  GK P+  F+    ++ I       P P+ D+   V P  ++ +D 
Sbjct: 1224 VDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKTAPPIPD-DTKDLVSPAGQSFLD- 1281

Query: 722  IRSCLERNPISRVTIDQLL 740
               C E +P  R T D L+
Sbjct: 1282 --QCFEIDPEMRPTADSLV 1298

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 116/247 (46%), Gaps = 27/247 (10%)

Query: 520 ELLKKLENK-QRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQ 577
           E+L   E+K   +V  ID ++ +G L+++ME  E   L+ V+T           +    +
Sbjct: 665 EILVMRESKHSNIVNFIDSYLAKGDLWIVMEYMEGGSLTDVVTH---CLLSEGQIGAVCR 721

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           E +K ++ +H   ++H D+K  N +  +KG +K+ DFG    + ++  N+ R   +GTP 
Sbjct: 722 ETLKGLQFLHSKGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINEN--NLKRTTMVGTPY 779

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           +MAPE +            ++ + G   D+WS G ++ +M+ G+PPY        LY I 
Sbjct: 780 WMAPEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIA 827

Query: 697 -NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFI 755
            N   K+  PE       +  T+   +  CL+ +P  R T  +LL    I  +      +
Sbjct: 828 TNGTPKLKEPE------ALSDTLTKFLDWCLKVDPSERATATELLDDPFITEIAEDNSSL 881

Query: 756 HDLIKNA 762
             L+K A
Sbjct: 882 SPLVKLA 888

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 116/236 (49%), Gaps = 27/236 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D    +  L++++E  E  +L  +L +R  +P + E V
Sbjct: 85  GIEREI-IIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPLP-ENEAV 142

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +KI DFG+A      + +   +  
Sbjct: 143 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETS 198

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG ILY ++ G+ P+    GN R
Sbjct: 199 CGSPHYAAPEIVSGLPYH-----------GFESDVWSCGVILYALLTGRLPFDEDNGNIR 247

Query: 692 --LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             L  + + + ++P  ++      I     D I   L  +P  R+   ++L   L+
Sbjct: 248 SLLLKVQSGEYEMPGNDE------ISSEAQDLIAKILTVDPDRRIKTREILKHPLL 297

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 112/235 (47%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL +   V+ L +    +  L+L++E  E  +L   L  + K+P ++E +
Sbjct: 120 GIEREI-IIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLP-ESEAI 177

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVF--VKGMLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++++ V   H  +I H DLKP N +    K  +KI DFG+A      T +   + 
Sbjct: 178 HY-FKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAAL---ETSDKLLET 233

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++   +            G PSDVWSCG IL+ ++ G  P+       
Sbjct: 234 SCGSPHYASPEIVLGRKYH-----------GSPSDVWSCGIILFALLTGHLPFNDDNVKK 282

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  + +   ++P          +     D I   L  +P  R+TIDQ+L   L+
Sbjct: 283 LLLKVQSGKYQMPQ--------WLSVEAKDLISRILVVDPNRRITIDQILQHELL 329

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 120/251 (47%), Gaps = 39/251 (15%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 76  ALKIINKKILAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIIVIEFASNELF 134

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  +    R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 135 DYIIQRDKMSENE--ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGL 192

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 193 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 238

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKD-SFGT-VIPRTVIDTIRSCLER----N 729
           M+  + P+               D  IP   K+ S G  ++P+ +     S ++R    N
Sbjct: 239 MLCRRLPFD--------------DESIPVLFKNISNGVYILPKFLSPGASSLIKRMLIVN 284

Query: 730 PISRVTIDQLL 740
           P++R++I +++
Sbjct: 285 PLNRISIHEIM 295

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 112/232 (48%), Gaps = 32/232 (13%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           E   L++L N + +++L      +  L+ L+E   + D   ++ +   +  + E   Y+ 
Sbjct: 218 EKNALQRLNNSRGIIRLYFTFQDEASLYFLLEYAPNGDFLSIMKKYGSL--NEECTCYYS 275

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIA------NAVPDHTVNIYRD 629
            ++I  +K +H   I+H D+KP N +  K M +K+ DFG A      +     T +++  
Sbjct: 276 AQIIDAIKFLHQRGIIHRDIKPENILLDKEMKVKLTDFGTAKLLDGKSQASGETYDLHTR 335

Query: 630 NQ--IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQ 687
           ++  +GT  Y++PE L       ND     W V    D+W+ GCI++QM+ GKPP   F+
Sbjct: 336 SKSFVGTAEYVSPELL-------ND----NW-VDYRCDIWAFGCIVFQMIAGKPP---FK 380

Query: 688 GNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
             N  Y      +K+ Y    +F    P  V D ++  L R P  R++I Q+
Sbjct: 381 ATNE-YLTFQKVMKVQY----AFTAGFPVVVRDLVKRILLRQPDQRLSIPQI 427

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 108/231 (46%), Gaps = 33/231 (14%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L++L N + +++L      +  L+ L+E   + D   V+ +   +  + E   Y+  +++
Sbjct: 222 LQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDFLSVMKKYGSL--NEECACYYGAQIL 279

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVN--------IYRDNQ 631
             +  +H   I+H D+KP N +  K M +KI DFG A  + + T          + R   
Sbjct: 280 DAIGFMHTRGIIHRDIKPENILMDKDMKVKITDFGTAKILDEKTNGNNKTSYELLTRSKS 339

Query: 632 -IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
            +GT  Y++PE L   N   +D            D+W+ GCILYQM+ GKPP   F+  N
Sbjct: 340 FVGTAEYVSPELL---NDNYSDSR---------CDIWAFGCILYQMIAGKPP---FKATN 384

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLS 741
             Y      +K+ Y    +F    P  + D I+  L + P  R+TI Q+ S
Sbjct: 385 E-YLTFQKVMKVQY----AFTAGFPTIIRDLIKRILLKVPEQRLTIGQIKS 430

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 113/236 (47%), Gaps = 27/236 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L++++E  E  +L  +L ++  +  + E V
Sbjct: 89  GIEREI-IIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLA-ENEAV 146

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +KI DFG+A      T +   +  
Sbjct: 147 RF-FRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADFGMAAL---ETEDKLLETS 202

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN-- 689
            G+P+Y APE +  + +            G  +D+WSCG IL+ ++ G+ P+    GN  
Sbjct: 203 CGSPHYAAPEIVSGLPYN-----------GLETDIWSCGVILFALLTGRLPFDEEDGNIR 251

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
           N L  +   + ++P  ++ S          D I   L  NP  R+   ++L   L+
Sbjct: 252 NLLLKVQKGEFEMPGSDELSL------EAQDLIGKILTVNPKQRIKTREILKHPLL 301

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 128/269 (47%), Gaps = 30/269 (11%)

Query: 494 HKVYALKRVSFD-EFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGE 552
            +VYA+K ++ D E DE  ++  + E++ L  L+    +++    ++    L+++M+   
Sbjct: 69  QQVYAIKVLNLDSESDE--VEDVQREVQFLSSLKQFPNIIRYFGSYLKDTNLWIIMDYCA 126

Query: 553 HDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKII 611
               + L +  KI  D +++    +E++  ++ +H  +++H D+K AN +   +G +K+ 
Sbjct: 127 GGSIRTLLRPGKI--DEKYIGIIMREILIALQYIHKDNVIHRDIKAANVLVTNEGKVKLC 184

Query: 612 DFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGC 671
           DFG+A  +  +   + R    GTP +MAPE ++         E A +     +D+WS G 
Sbjct: 185 DFGVAAQL--NQTKLRRQTMAGTPYWMAPEVIM---------EGAYYDTK--ADIWSLGI 231

Query: 672 ILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
             Y++  G PPY   +    +  I     K    E  S+ T    ++ + I  CL+ +P 
Sbjct: 232 TAYEIATGNPPYCEIEALRAMQLITKS--KPARLEGRSYST----SLKEFIALCLDEDPK 285

Query: 732 SRVTIDQLLSGALIN-----PVTVTKFFI 755
            R++ ++L     I      P T+ K  I
Sbjct: 286 ERLSAEELQKTKFIKSQRAVPTTILKELI 314

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 110/234 (47%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L++++E  E  +L  +L +R  +P + E V
Sbjct: 72  GIEREI-IIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLP-ENEAV 129

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +K+ DFG+A      + +   +  
Sbjct: 130 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAAL---ESKDKLLETS 185

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG ILY ++ G+ P+    GN R
Sbjct: 186 CGSPHYAAPEIVSGLPYH-----------GFESDVWSCGVILYALLTGRLPFDEEDGNIR 234

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     K   P  D     I     D I   L  +P  R+   ++L   L+
Sbjct: 235 NLLLKVQSGKFEMPGDDE----ISSEAQDLIARILTVDPEQRIKTREILKHPLL 284

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 119/251 (47%), Gaps = 39/251 (15%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E  +++L 
Sbjct: 71  ALKIINRKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYADNELF 129

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+    +  R  FQ++I  V   H   IVH DLKP N +  + + +KI DFG+
Sbjct: 130 DYIVQRDKM--SEQEARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 187

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 188 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 233

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTV--IPRTVIDTIRSCLER----N 729
           M+  + P+               D  IP   K+    +  +PR + +   S +++    N
Sbjct: 234 MLCRRLPFD--------------DESIPVLFKNINNGIYTLPRFLSEGASSLIKKMLIVN 279

Query: 730 PISRVTIDQLL 740
           P++R++I +++
Sbjct: 280 PLNRISIHEIM 290

>Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W
           (REAL)
          Length = 1081

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 112/229 (48%), Gaps = 33/229 (14%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L+KL N   VV+L      +  L+ L+E   + D   ++ +   I  D     Y+  ++I
Sbjct: 232 LQKLNNSLSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSI--DENCACYYAAQII 289

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIA-------NAV--PDHTVNIYRDN 630
             +  +H   I+H D+KP N +  + M +K+ DFG A       N+V  P + ++    +
Sbjct: 290 DAIDYLHSNGIIHRDIKPENILLDEEMRIKLTDFGTAKLLSPTSNSVSKPKYDLSTRSKS 349

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
            +GT  Y++PE L+  +FT        ++     D+W+ GCIL+QM+ GKPP   F+  N
Sbjct: 350 FVGTAEYVSPE-LLNDSFT-------DYRC----DIWAFGCILFQMIAGKPP---FKATN 394

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
             Y      +K+ Y    +F    P  + D ++  L +N   R+TI+Q+
Sbjct: 395 E-YLTFQKVMKVQY----AFTPGFPLVIRDLVKRILVKNLDQRLTINQI 438

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 112/245 (45%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 62  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 120

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+P   +  R  FQ++I  V   H   IVH DLKP N +  + + +KI DFG+
Sbjct: 121 DYIVQRDKMP--EQEARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 178

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWS G ILY 
Sbjct: 179 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSSGVILYV 224

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    IP          + +     I+  L  NP++R+T
Sbjct: 225 MLCRRLPFDDESIPVLFKNISNGVYTIP--------NFLSQGAASLIKKMLIVNPVNRIT 276

Query: 736 IDQLL 740
           + +++
Sbjct: 277 VHEIM 281

>TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3.338
           YPR054W
          Length = 430

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 113/242 (46%), Gaps = 39/242 (16%)

Query: 493 DHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGV----LFLLM 548
           ++ + A+K+++   + E  I     E++ +K     + +V L+D  +        L+   
Sbjct: 85  NNALLAVKKITNIFYKEILIKRAIRELKFIKYFRGHKNIVSLLDVDIVLDAPYDGLYCYQ 144

Query: 549 ECGEHDLSQVLTQRSKIPFDTEF-VRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKG 606
           E  ++DL++V+     +   TEF ++Y F +++  +K +H AD++H DLKP N +  + G
Sbjct: 145 ELIDYDLAKVVHSSVLL---TEFHIKYFFYQILCGLKYIHSADVLHRDLKPGNILCTLNG 201

Query: 607 MLKIIDFGIANAV----------------PDHTVNIYRDNQIGTPNYMAPETLVAMNFTR 650
            LKI DFG+A  +                P    N+   N + T  Y APE +++ N   
Sbjct: 202 TLKICDFGLARGISQTVLQKANRQNSTNEPVQYYNLDITNYVATRWYRAPELILSHN--- 258

Query: 651 NDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSF 710
                   +  K  D+WSCGCIL +  YG+ P   F G + ++ I      I  P K+  
Sbjct: 259 --------EYDKSIDIWSCGCILAEF-YGRKP--VFMGKDAMHQIFEIIKVIGSPSKELL 307

Query: 711 GT 712
            T
Sbjct: 308 ET 309

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 113/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 82  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 140

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+    +  R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 141 DYIVQRDKM--SEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 198

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 199 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 244

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P         +I R +I         NP++R++
Sbjct: 245 MLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLI--------VNPLNRIS 296

Query: 736 IDQLL 740
           I +++
Sbjct: 297 IHEIM 301

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 113/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 82  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 140

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+    +  R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 141 DYIVQRDKM--SEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 198

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 199 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 244

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P         +I R +I         NP++R++
Sbjct: 245 MLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLI--------VNPLNRIS 296

Query: 736 IDQLL 740
           I +++
Sbjct: 297 IHEIM 301

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 110/231 (47%), Gaps = 38/231 (16%)

Query: 517  GEIELLKKLENK--QRVVKLIDYHMGQGVLFLLM----ECGEHDLSQVLTQRSKIPFDTE 570
             EI+++  L  K  + +++L+D+       ++      E G  DL  ++   S +   TE
Sbjct: 1173 SEIQIMATLNKKPHENILRLLDFFEDDEYYYIETPVHGETGSIDLFDLIEFTSNM---TE 1229

Query: 571  F-VRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYR 628
            F ++  F++++  VK +HD  IVH D+K  N +   KG +KIIDFG A  V     +++ 
Sbjct: 1230 FEIKLLFKQVVSGVKHLHDQGIVHRDIKDENIIVDNKGFIKIIDFGSAAYVKSGPFDVF- 1288

Query: 629  DNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQG 688
               +GT +Y APE L    +            GKP D+W+ G +LY +V+ + P+     
Sbjct: 1289 ---VGTIDYAAPEVLGGNPYE-----------GKPQDIWALGILLYTIVFKENPFYNID- 1333

Query: 689  NNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
                  I+  D+K   PE       I +  I+ I+  L RN   R TID +
Sbjct: 1334 -----EILEGDLKFNDPEN------ISQDCIELIKLILNRNVFKRPTIDDI 1373

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 106/233 (45%), Gaps = 31/233 (13%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           E   L++L N + +VKL      +  L+ L+E   + D   ++ +   +  D     Y+ 
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESSLYFLLEYAPNGDFLSIMKKYGSLNEDCAC--YYS 272

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIA-------NAVPDHTVNIYR 628
            ++I  +  +H   IVH D+KP N +  K   +K+ DFG A       N    + +    
Sbjct: 273 AQIIDAIDFLHSKGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRS 332

Query: 629 DNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQG 688
            + +GT  Y++PE L       ND       V    D+W+ GCIL+QM+ GKPP   F+ 
Sbjct: 333 KSFVGTAEYVSPELL-------NDNY-----VDYRCDIWAFGCILFQMIAGKPP---FKA 377

Query: 689 NNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLS 741
            N  Y      +K+ Y    +F    P  V D ++  L + P  R+TI Q+ S
Sbjct: 378 TNE-YLTFQKVMKVQY----AFTAGFPLVVRDLVKGILIKQPAQRLTIPQIKS 425

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 111/235 (47%), Gaps = 25/235 (10%)

Query: 511  SIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDT 569
            +++  K E+  LK L++   +V+ + + M   +  L +E      +  ++    +  FD 
Sbjct: 1181 TVEAMKSEVSTLKDLDH-LNIVQYLGFEMKHNIYSLFLEYVAGGSVGSLIRMYGR--FDD 1237

Query: 570  EFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGIANAVPDHTVNIYR 628
            + +R+   ++++ +  +H   I+H D+K  N +  + G+ KI DFGI+    D    IY 
Sbjct: 1238 KLIRHLTNQVLEGLSYLHSQGILHRDMKADNLLLDQDGICKISDFGISKKSED----IYS 1293

Query: 629  DNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGT 685
            ++++   GT  +MAPE +         G  AK       D+WS GC++ +M  GK P+  
Sbjct: 1294 NSEMTMRGTVFWMAPEMV-----DTKQGYNAK------VDIWSLGCVVLEMFAGKRPWSN 1342

Query: 686  FQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLL 740
            F+    +Y I       P PE D+   + P T  + +  C   +P  R T  QLL
Sbjct: 1343 FEVVTAMYKIGQSKSAPPIPE-DTKDLISP-TAKNFLNQCFHIDPKERPTAGQLL 1395

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 110/234 (47%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L++++E  E  +L  +L QR  +P + E V
Sbjct: 74  GIEREI-IIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLP-ENEAV 131

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +K+ DFG+A      + +   +  
Sbjct: 132 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETS 187

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG ILY ++ G+ P+    GN R
Sbjct: 188 CGSPHYAAPEIVSGLPYH-----------GFESDVWSCGVILYALLTGRLPFDEEDGNIR 236

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     K   P +D     I     D I   L   P  R+   ++L   L+
Sbjct: 237 NLLLKVQSGKYEIPGEDE----ISPEARDLIVQILTVEPEQRIKTREILKHPLL 286

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 110/234 (47%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L++++E  E  +L  +L  R  +P + E V
Sbjct: 83  GIEREI-IIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPLP-ENEAV 140

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +KI DFG+A      + +   +  
Sbjct: 141 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETS 196

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R
Sbjct: 197 CGSPHYAAPEIVSGLPYH-----------GFESDVWSCGIILFALLTGRLPFDEEDGNIR 245

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     K   P+ +     I     D I   L  +P +R+    +L   L+
Sbjct: 246 NLLLKVQSGKFEMPDTNE----ISGEAQDLIAKILTVDPAARIKSRGILKHPLL 295

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 105/227 (46%), Gaps = 22/227 (9%)

Query: 521 LLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           ++ KL +   V+ L D       L+L++E  E  +L  +L  R  +P + E ++  F+++
Sbjct: 79  VIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALP-EREAMKC-FRQI 136

Query: 580 IKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPNYM 638
           I  V   H   IVH DLKP N +      +K+ DFG+A    D  +    +   G+P+Y 
Sbjct: 137 IIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAAL---LETSCGSPHYA 193

Query: 639 APETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNP 698
           APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R   +   
Sbjct: 194 APEIVSGLPYE-----------GFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQ 242

Query: 699 DVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             +   P+     T I +   D I   L  +P  R+ I  +LS  L+
Sbjct: 243 RGQFEMPDD----TEISKDAQDLISKILVVDPAQRIKIRDILSHPLL 285

>KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944)
           [915 bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 127/274 (46%), Gaps = 56/274 (20%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++   +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-DNIVRLFDVIHTENKLTLVFEFMDNDLKK 91

Query: 558 VLTQRSKI----PFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            +  R+K       + + V+Y   ++++ V   H+  I+H DLKP N +   +G LK+ D
Sbjct: 92  FMDNRNKGNSHKGLEMDLVKYFQWQLLQGVAFCHENRILHRDLKPQNLLINNRGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+    +RN             D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMG---SRN--------YCTSIDIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN------RLYAIMNPDVKIPYPEKDSFGT------------ 712
           CIL +M+ GKP    F G+N       ++  M   V+  +P+                  
Sbjct: 197 CILAEMIMGKP---LFPGSNDEEQLKLIFDTMGTPVEQTWPQVTQLAKYNPLLPPHMPRD 253

Query: 713 -----------VIPRTVIDTIRSCLERNPISRVT 735
                      V+   V+D +   L+ NP +R++
Sbjct: 254 LKQLLQNNTEEVLDDNVVDLLHGLLQLNPDARLS 287

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 105/229 (45%), Gaps = 29/229 (12%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFVRYHF 576
           E   L+++ N + +VKL      +  L+ L+E C   D   ++ +   +  +     Y+ 
Sbjct: 227 EKNALQRINNSKMIVKLFFTFQDESSLYFLLEYCPNGDFLSLMKKYGSL--NETVACYYS 284

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIY-----RDN 630
            ++I  +  +H   I+H D+KP N +  K   +K+ DFG A  +   T N +       +
Sbjct: 285 AQVIDAIDYLHTNGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKS 344

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
            +GT  Y+APE L       ND       V    DVW+ GCILYQM+ GKPP   F+  N
Sbjct: 345 FVGTAEYVAPELL-------NDSF-----VDYRCDVWAFGCILYQMIAGKPP---FKATN 389

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
             Y      +K+ Y    +F    P  + D ++  L ++   R +I Q+
Sbjct: 390 E-YLTFQKVMKVQY----AFTAGFPLIIRDLVKKILVKDLNQRPSISQI 433

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 97/190 (51%), Gaps = 19/190 (10%)

Query: 496 VYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHD 554
           VYA+K ++ D  D   ++  + EI+ L  L+    + +    ++    L+++ME C    
Sbjct: 69  VYAIKVLNLDS-DSDEVEDVQREIQFLASLKQVPNITRYYGSYLQDTNLWIIMEYCAGGS 127

Query: 555 LSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDF 613
           L  +L  R  +  D +++    +E++  ++ +H  +++H D+K AN +   +G +K+ DF
Sbjct: 128 LRTLL--RPGM-IDEKYIGVIMRELLTALQCIHKDNVIHRDIKAANVLITNEGKVKLCDF 184

Query: 614 GIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCIL 673
           G+A  +  +  ++ R    GTP +MAPE ++       +G     KV    D+WS G   
Sbjct: 185 GVAAQL--NQTSLRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGITA 231

Query: 674 YQMVYGKPPY 683
           Y++  G PPY
Sbjct: 232 YEIATGNPPY 241

>KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 302
           aa] {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 302

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 124/279 (44%), Gaps = 56/279 (20%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAVREISLMKELKH-ENIVRLYDVIHTENKLTLVFEFMDNDLKK 91

Query: 558 VLTQR----SKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            +  R    +   F+   V+Y   ++++ V   H+  I+H DLKP N +   KG LK+ D
Sbjct: 92  YMDSRIVGNTPYGFEMSLVKYFEWQLLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYSTSIDIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN------RLYAIMNPDVKIPYPEKDSFGTVIPR-------- 716
           CIL +M+ G+P    F G N       ++  M    +  +P   +     PR        
Sbjct: 197 CILAEMITGRP---LFPGTNDEEQLKLIFETMGTPTERTWPGVSTLPKYNPRLPQHLPKD 253

Query: 717 ---------------TVIDTIRSCLERNPISRVTIDQLL 740
                          T+ID +   L+ NP  R++  Q L
Sbjct: 254 LGALLQSQTREKMELTLIDLLYGLLQLNPDRRLSAKQAL 292

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 113/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 83  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 141

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+    +  R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 142 DYIVQRDKM--SEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 199

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWSCG ILY 
Sbjct: 200 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSCGVILYV 245

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P         +I R +I         NP++R++
Sbjct: 246 MLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLI--------VNPLNRIS 297

Query: 736 IDQLL 740
           I +++
Sbjct: 298 IHEIM 302

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 110/235 (46%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL +   V+ L +    +  LFL++E     +L   L  R ++P + E +
Sbjct: 103 GIEREI-IIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLP-EKEAI 160

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++I+     H  +I H DLKP N +  K    +KI DFG+A      T N   + 
Sbjct: 161 HY-FRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAAL---QTSNKLLET 216

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++  N+            G PSDVWSCG IL+ ++ G  P+       
Sbjct: 217 SCGSPHYASPEIVMGKNYN-----------GGPSDVWSCGIILFALLTGHLPFNDDNIKR 265

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  +     ++P          +     D I   L  +P  R++I+++L+  L+
Sbjct: 266 LLLKVQAGKYQMPQ--------SVSSGAQDLISRILVVDPDKRISINEILAHPLL 312

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 108/235 (45%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K + ++  V+ L +    +  LFL++E     +L   L  + K+P + E V
Sbjct: 161 GIEREIVIMKLISHRN-VMGLFEVWENKNDLFLVLEYVDGGELFDYLVSKGKLP-EWEAV 218

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++I+ V   H  +I H DLKP N +  K   ++KI DFG+A        N   + 
Sbjct: 219 HY-FKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGMAAL---ELPNKLLET 274

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++   +            G PSDVWSCG IL+ ++ G  P+       
Sbjct: 275 SCGSPHYASPEIVMGKPYH-----------GGPSDVWSCGIILFALLTGHLPFNDDNIRK 323

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  + +   ++P          I     D I   L  NP  R+ I  +L   LI
Sbjct: 324 LLLKVQSGRFRLPRN--------ISLEAQDLIAKILVVNPRQRIKISDILKHPLI 370

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 109/234 (46%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L++++E  +  +L  +L +R  +P + E +
Sbjct: 78  GIEREI-IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP-EKEAI 135

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F++++  +   H   IVH DLKP N +   K  +KI DFG+A      T +   +  
Sbjct: 136 RF-FRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ETEDKLLETS 191

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R
Sbjct: 192 CGSPHYAAPEIVSGIPYH-----------GFASDVWSCGVILFALLTGRLPFDDEDGNIR 240

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   P  D     I     D I   L  +P  R+    +L   L+
Sbjct: 241 NLLLQVQSGRYEMPGDDE----ISPDAQDLIARILTVDPEQRIKARDILKHPLL 290

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 106/229 (46%), Gaps = 26/229 (11%)

Query: 521 LLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           ++ KL +   V+ L D       L+L++E  E  +L  +L  R  +P + E ++  F+++
Sbjct: 79  VIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLP-EREAIKC-FKQI 136

Query: 580 IKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPNYM 638
           I  +   H   IVH DLKP N +      +KI DFG+A    D  +    +   G+P+Y 
Sbjct: 137 IIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGM---LETSCGSPHYA 193

Query: 639 APETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR--LYAIM 696
           APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R  L  + 
Sbjct: 194 APEIVSGLPYE-----------GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQ 242

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
               ++P   +      I     D IR  L  +P  R+ I  +LS  L+
Sbjct: 243 KGQFEMPNNAE------ISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 117/248 (47%), Gaps = 22/248 (8%)

Query: 495 KVYALKRVSFDEF-DESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH 553
           K++A K V+      E +      EI++ K + +   +V+ ID       +++L+E   +
Sbjct: 102 KIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHFN-IVQFIDCFEDDTNVYILLEICPN 160

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIID 612
                L +R K+  + E VR+   +++  VK +H   ++H DLK  N  F K   LKI D
Sbjct: 161 GSLMDLLKRRKVLTEPE-VRFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGD 219

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  + +     Y     GTPNY+APE L      ++ G   +       D+WSCG +
Sbjct: 220 FGLAAVLANDRERKY--TVCGTPNYIAPEVLTG----KHTGHSYE------VDIWSCGVM 267

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
           +Y ++ GKPP+   + N     I   D   P  +       I +  +  IR  L  +P+ 
Sbjct: 268 IYALLIGKPPFQAKEVNIIYERIKCGDYVFPRDK------CISQEALTLIRDILSIDPLE 321

Query: 733 RVTIDQLL 740
           R ++D+++
Sbjct: 322 RPSLDEII 329

>KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 362

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 100/193 (51%), Gaps = 31/193 (16%)

Query: 518 EIELLKKLENKQRVVKLID------YHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEF 571
           E++LLK   + + ++ ++D      +H  + V +L+ E  E DL +++ Q++      + 
Sbjct: 59  ELKLLKFFHSHENIISVLDIVRPTSWHKFEAV-YLVQELMETDLQKIINQQN---LSEDH 114

Query: 572 VRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDN 630
           ++Y   ++++ +K +H A ++H DLKP+N +      LK+ DFG+A  +     +  R+N
Sbjct: 115 IQYFVYQILRALKSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQS--REN 172

Query: 631 QIG-------TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY 683
            +G       T  Y APE +++             +     D+WSCGCIL +M+ GKP +
Sbjct: 173 MVGFMTEYVATRWYRAPEIMLSFQ-----------EYTTAMDIWSCGCILAEMIMGKPLF 221

Query: 684 GTFQGNNRLYAIM 696
                +++L+ I+
Sbjct: 222 PGKDYHHQLWIIL 234

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 110/234 (47%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L D       L++++E  E  +L  +L +R  +P + E +
Sbjct: 76  GIEREIIIMKLLRHPN-VLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLP-EKEAI 133

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +    + +KI DFG+A      T +   +  
Sbjct: 134 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAAL---ETKDKMLETS 189

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R
Sbjct: 190 CGSPHYAAPEIVSGVPYH-----------GFQSDVWSCGVILFALLTGRLPFDEEDGNIR 238

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     +   P+ D     I +   D I   L  +P  R+    +L   L+
Sbjct: 239 NLLLKVQSGEYEMPDDDE----ISKEAQDLIGRILTVDPEQRIKTRDILKHPLL 288

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 122/250 (48%), Gaps = 26/250 (10%)

Query: 495 KVYALKRVSFDEF-DESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGE 552
           K++A K V+      E +      EI++ K + +   VV+ ID       +++L+E C  
Sbjct: 114 KIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHFN-VVQFIDCFEDDTNVYILLEICPN 172

Query: 553 HDLSQVLTQRSKIPFDTE-FVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKI 610
             L ++L +R  +   TE  VRY   ++   +K +H   ++H DLK  N  F K   LKI
Sbjct: 173 GSLMELLKKRRTV---TEPEVRYFMTQICGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKI 229

Query: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
            DFG+A  + +     Y     GTPNY+APE L+     ++ G   +       D+WS G
Sbjct: 230 GDFGLAAVLANDRERKY--TVCGTPNYIAPEVLMG----KHSGHSYE------VDIWSIG 277

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNP 730
            ++Y ++ GKPP+ +   N     I N D   P   KD + +   +T+I  I   L  +P
Sbjct: 278 VMIYALLIGKPPFQSKDVNMIYERIKNRDFAFP---KDKYISNEAKTLIHDI---LSTDP 331

Query: 731 ISRVTIDQLL 740
           + R +I++++
Sbjct: 332 LERPSIEEII 341

>Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON}
           complement(6075..7199) [1125 nt, 375 aa]
          Length = 374

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 94/192 (48%), Gaps = 24/192 (12%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGV-----LFLLMECGEHDLSQVLTQ--RSKIPFDTE 570
           E++LLK   N + ++ ++D      +     ++++ E  E DL +V+    R   P   +
Sbjct: 59  ELKLLKYFHNHENIISILDKVRPISIDNLNAVYIVQELMETDLQKVIVNNNRKNTPLSDD 118

Query: 571 FVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPD-----HTV 624
            ++Y   ++++ +K +H A ++H DLKP+N +      LKI DFG++  +        T+
Sbjct: 119 HIQYFTYQVLRALKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLASSSDSKETL 178

Query: 625 NIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYG 684
             +    + T  Y APE ++              +     D+WSCGCIL +MV GKP + 
Sbjct: 179 VGFMTEYVATRWYRAPEIMLTFQ-----------EYTTAMDIWSCGCILAEMVSGKPLFP 227

Query: 685 TFQGNNRLYAIM 696
               +++L+ I+
Sbjct: 228 GRDYHHQLWLIL 239

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 131/289 (45%), Gaps = 29/289 (10%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 58  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVVKSKDEIVMVIEYAGNELF 116

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  + E  R+ FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 117 DYIVQRDKMS-ENEARRF-FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 174

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D   N  R    G+PNY APE +             K   G   DVWS G ILY 
Sbjct: 175 SNIMTDG--NFLR-TSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSSGVILYV 220

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P         +I R +I         NP++R+T
Sbjct: 221 MLCRRLPFDDESIPVLFKNISNGIYTLPKFLSPGAANLIKRMLI--------VNPLNRIT 272

Query: 736 IDQLLSGALINPVTVTKFFI-HDLIKNAVNYGCDQKHVNNERVEELSED 783
           I +++       V +  + I  DL   A N+G D +       EE  +D
Sbjct: 273 IHEIMQDEWFK-VDMQDYLIPPDLKNEAENHGHDGEQQGQNDAEEEVDD 320

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 103/217 (47%), Gaps = 30/217 (13%)

Query: 531 VVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDA 589
           ++KL      +  L+ L+E   + D   ++ +   +  + E  RY+  +++  +  +H  
Sbjct: 265 IIKLFFTFQDEANLYFLLEYAPNGDFLSIMKKYGSL--NEECARYYGAQILNGIYFLHRH 322

Query: 590 DIVHSDLKPANFVFVKGM-LKIIDFGIA------NAVPDHTVNIYRDNQIGTPNYMAPET 642
            I+H D+KP N +  K M +K+ DFG A      +   ++ +     + +GT  Y++PE 
Sbjct: 323 GIIHRDIKPENILLDKSMKVKLTDFGTAKLLNRKDGTEEYDLTTRSKSFVGTAEYVSPEL 382

Query: 643 LVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKI 702
           L       ND     W V    D+W+ GCIL+QM+ GKPP   F+  N  Y      +K+
Sbjct: 383 L-------NDS----W-VDHKCDIWAFGCILFQMIAGKPP---FKATNE-YLTFQKVMKV 426

Query: 703 PYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
            Y    +F    P  V D ++  L + P  R+TI Q+
Sbjct: 427 QY----AFTAGFPMVVRDLVKQILVKKPEHRLTIPQI 459

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 113/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + ++ME   ++L 
Sbjct: 88  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVMEYAGNELF 146

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  +    R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 147 DYIVQRDKMSENE--ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 204

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWS G ILY 
Sbjct: 205 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSSGVILYV 250

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    IP        ++I R +I         NP++R++
Sbjct: 251 MLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQGASSLIKRMLI--------VNPLNRIS 302

Query: 736 IDQLL 740
           I +++
Sbjct: 303 ISEIM 307

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 124/251 (49%), Gaps = 19/251 (7%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           K +A+K +S  +    +IDG   E+E+L++L N  R+V+L  ++      +LLME     
Sbjct: 212 KTFAVKIISKRKV-MGNIDGVTRELEVLRRL-NHPRIVRLKGFYEDDESYYLLMEFVSGG 269

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG---MLKI 610
           DL   +     +  D    R   +++++ VK +H   I H DLKP N +  +    M+KI
Sbjct: 270 DLMDFVAAHGSVGEDAG--REITKQVLEAVKYIHGMGISHRDLKPDNILIEQDDPVMVKI 327

Query: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
            DFG+A    + T   +     GT  Y+APE +   N    D  Q K K     D+WS G
Sbjct: 328 TDFGLAKIQGNGT---FMKTFCGTLAYVAPEVISGKN--SEDKSQNKNKYSSLVDMWSIG 382

Query: 671 CILYQMVYGKPPY-GTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERN 729
           C++Y ++ G  P+ G+ Q  ++LY  ++       P KD   +   R  ID++   L+ N
Sbjct: 383 CLVYVILTGHLPFSGSTQ--DQLYKQISRGSYHEGPLKDFRISDEARNFIDSL---LQVN 437

Query: 730 PISRVTIDQLL 740
           P  R+T ++ L
Sbjct: 438 PKDRLTAEKAL 448

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 121/248 (48%), Gaps = 27/248 (10%)

Query: 518  EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
            EI ++K+ ++K  +V  ID ++ +G L+++ME  E   L+ V+T           +    
Sbjct: 1072 EIIVMKESKHKN-IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVC 1127

Query: 577  QEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTP 635
            +E +  +K +H   ++H D+K  N +  ++G +K+ DFG    +  + V++ R   +GTP
Sbjct: 1128 RETLNGLKFLHSKGVIHRDIKSDNILLSMQGDIKLTDFGFCAQI--NEVHLKRTTMVGTP 1185

Query: 636  NYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAI 695
             +MAPE +            ++ + G   D+WS G ++ +M+ G+PPY        LY I
Sbjct: 1186 YWMAPEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 1233

Query: 696  M-NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFF 754
              N   ++  PEK      +   + + + +CL+ +P  R T  +LL   LI  V      
Sbjct: 1234 ATNGTPELKEPEK------LSSILHNFLDACLKVDPEVRATATELLETELITEVASENIS 1287

Query: 755  IHDLIKNA 762
            +  L+K A
Sbjct: 1288 LAPLVKVA 1295

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 102/220 (46%), Gaps = 30/220 (13%)

Query: 531 VVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDA 589
           VV  I+ H+ +G L+++ME  E   L+ V+T           +    +E ++ +K +H  
Sbjct: 574 VVNFINAHLSKGNLWIVMEYMEGGSLTDVVTH---CLLSEGQIGAVCRETLEGLKFLHSK 630

Query: 590 DIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNF 648
            ++H D+K  N +  +KG +K+ DFG    + D  +++ R   +GTP +MAPE +     
Sbjct: 631 GVIHRDIKSDNVLLSMKGDIKLTDFGFCAQIND--IDLNRTTMVGTPYWMAPEVV----- 683

Query: 649 TRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM---NPDVKIPYP 705
                  ++ + G   D+WS G ++ +M+ G+PPY        LY I     P +K P  
Sbjct: 684 -------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNEAPLKALYLIATNGTPKLKEPEN 736

Query: 706 EKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             D F   + R        CL   P  R +  +LL+   +
Sbjct: 737 LSDVFSNFLDR--------CLRVEPEERASAIELLADEFV 768

>TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON}
           Anc_8.482 YPL031C
          Length = 305

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 123/280 (43%), Gaps = 58/280 (20%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  + DL  
Sbjct: 35  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEYMDKDLKN 92

Query: 558 VLTQR----SKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            +  R    S    +   V+Y   ++ + V   H+  I+H DLKP N +   KG LK+ D
Sbjct: 93  YMDSRTSGNSTRGLELSLVKYFQWQLFEGVTFCHENKILHRDLKPQNLLINNKGQLKLGD 152

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +     ++ T  Y AP+ L+                    D+WSCG
Sbjct: 153 FGLARAFGIPVNTFS----TEVVTLWYRAPDVLMGSR-----------SYSTSIDMWSCG 197

Query: 671 CILYQMVYGKPPYGTFQGNN------RLYAIMN-PDVKIPYPEKDSF------------- 710
           CIL +M+ GKP    F G N       ++ IM  PD ++ +P   S              
Sbjct: 198 CILAEMITGKP---LFPGTNDEEQLKLIFDIMGTPDEQL-WPAVTSLPKYNRNLPKKEPK 253

Query: 711 ----------GTVIPRTVIDTIRSCLERNPISRVTIDQLL 740
                       ++   VID +   L+ NP +R+T  Q L
Sbjct: 254 DLKKLLQAHTKEIVDDQVIDLVTGLLQLNPDARLTAKQAL 293

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 109/235 (46%), Gaps = 38/235 (16%)

Query: 521 LLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           L+ K      +V  ID ++ +G L+++ME  E   L+ V+T           +    +E 
Sbjct: 714 LVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVSRET 770

Query: 580 IKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYM 638
           +K ++ +H   ++H D+K  N +  + G +K+ DFG    +  + +N+ R   +GTP +M
Sbjct: 771 LKGLQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWM 828

Query: 639 APETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM-- 696
           APE +            ++ + G   D+WS G ++ +M+ G+PPY        LY I   
Sbjct: 829 APEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATN 876

Query: 697 -NPDVKIPYPEKDSFGTVIPRTVIDTIRS----CLERNPISRVTIDQLLSGALIN 746
             P++K    + DS          D ++S    CL  NP  R T  QLLS   I+
Sbjct: 877 GTPELK----DADSLS--------DDLKSFLGWCLHVNPDERATASQLLSDPFIS 919

>Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W
           (REAL)
          Length = 1082

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 109/230 (47%), Gaps = 35/230 (15%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L+KL N   VV+L      +  L+ L+E   + D   ++ +   +  D     Y+  ++I
Sbjct: 233 LQKLNNSHSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKNGSL--DENCACYYGAQII 290

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQ-------- 631
             +  +H   I+H D+KP N +  + M +K+ DFG A  + D TV+     +        
Sbjct: 291 DAIDYLHSNGIIHRDIKPENILLDEEMRIKLTDFGTAKLL-DSTVSSTSKQKYDLSTRSK 349

Query: 632 --IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
             +GT  Y++PE L+  +FT        ++     D+W+ GCIL+QM+ GKPP   F+  
Sbjct: 350 SFVGTAEYVSPE-LLNDSFT-------DYRC----DIWAFGCILFQMIAGKPP---FKAT 394

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
           N  Y      +K+ Y    +F    P  + D ++  L +N   R+TI Q+
Sbjct: 395 NE-YLTFQKVMKVQY----AFTPGFPLIIRDLVKKILIKNLDQRLTISQI 439

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 109/235 (46%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L +       L+L++E     +L   L  + K+  ++E V
Sbjct: 181 GIEREIVIMKLLSHPN-VMALYEVWENNNELYLVLEYVDGGELFDYLVSKGKLT-ESEAV 238

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++I  +   H  +I H DLKP N +  K   ++KI DFG+A        N     
Sbjct: 239 HY-FKQIINGISYCHSFNICHRDLKPENLLLDKKRRIIKIADFGMAAL---QVSNRLLQT 294

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++   +            G PSD+WSCG IL+ ++ G  P+       
Sbjct: 295 SCGSPHYASPEIVMGKCYN-----------GAPSDIWSCGIILFALLTGHLPFNDDNIKK 343

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  + N   ++P        + I +   + I   L  +P  R++ +Q+LS  L+
Sbjct: 344 LLIKVQNGRYQMP--------SYISQEAKNLISRILVVDPSKRISTEQILSHPLL 390

>CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {ON}
           similar to uniprot|P41808 Saccharomyces cerevisiae
           YPR054w SMK1 sporulation-specific MAP kinase or
           uniprot|Q00772 Saccharomyces cerevisiae YHR030c SLT2
           ser/thr
          Length = 432

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 93/189 (49%), Gaps = 28/189 (14%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQG----VLFLLMECGEHDLSQVLTQRSKIPFDTEFVR 573
           EI+ +   +  + +V LID  + Q      L+   E  ++DL++V+    ++   +EF  
Sbjct: 121 EIKFMNYFKGHKHIVNLIDIEIVQDKPYDGLYCYQELIDYDLARVIHSSVQL---SEFHI 177

Query: 574 YHFQEMIKC-VKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRD-- 629
            HF   I C VK +H AD++H DLKP N +  V G LKI DFG+A  V    VN      
Sbjct: 178 QHFIYQILCGVKYIHSADVIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNKNSKPN 237

Query: 630 ---NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTF 686
              N + T  Y APE +++ N           +  K  D+WS GCIL +  YG+ P   F
Sbjct: 238 EITNYVATRWYRAPELILSNN-----------EYTKSVDMWSVGCILAEF-YGRRP--IF 283

Query: 687 QGNNRLYAI 695
            G + ++ +
Sbjct: 284 MGKDSIHQV 292

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 120/248 (48%), Gaps = 22/248 (8%)

Query: 495 KVYALKRVSFDEF-DESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH 553
           K++A K V+      E +      EI++ K + +   +V+ +D       +++L+E   +
Sbjct: 102 KIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHTN-IVQFVDCFEDDTNVYILLEICPN 160

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIID 612
                L +R K+  + E VR+   +++  VK +H   ++H DLK  N  F K   LK+ D
Sbjct: 161 GSLMDLLKRRKMLTEPE-VRFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGD 219

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  + +     Y     GTPNY+APE L      ++ G   +       D+WSCG +
Sbjct: 220 FGLAAVLANDRERKY--TVCGTPNYIAPEVLTG----KHTGHSYE------VDIWSCGVM 267

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
           +Y ++ GKPP+   + N     I   D   P   KD F  + P  ++  I+  L  +P+ 
Sbjct: 268 IYALLIGKPPFQAKEVNIIYERIKCGDFVFP---KDKF--ISPEALV-LIKDILSIDPLE 321

Query: 733 RVTIDQLL 740
           R ++D+++
Sbjct: 322 RPSLDEII 329

>TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {ON}
           Anc_4.184 YGR040W
          Length = 366

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 94/190 (49%), Gaps = 22/190 (11%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGV-----LFLLMECGEHDLSQVLTQRSKIPFDTEFV 572
           EI+LL+   + + ++ ++D      +     ++L+ E  E DL +++   +  P   + +
Sbjct: 59  EIKLLRYFHDHENIISILDMIRPTTIDKMNAVYLVQELMETDLQRIINSHAANPLSDDHI 118

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPD-----HTVNI 626
           +Y   ++++ +K +H A ++H DLKP+N +      LK+ DFG++  +        T+  
Sbjct: 119 QYFTYQILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSSDSRETLVG 178

Query: 627 YRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTF 686
           +    + T  Y APE ++              +     D+WSCGCIL ++V GKP +   
Sbjct: 179 FMTEYVATRWYRAPEIMLTFR-----------EYTTAMDIWSCGCILAELVSGKPLFPGR 227

Query: 687 QGNNRLYAIM 696
             +++L+ I+
Sbjct: 228 DYHHQLWLIL 237

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 112/236 (47%), Gaps = 25/236 (10%)

Query: 511  SIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDT 569
            ++D  + E+  LK L++   +V+ + +    G+  L +E      +  ++    +  FD 
Sbjct: 1186 TVDALRLEVSTLKDLDH-LNIVQYLGFEAKNGIYSLFLEYVAGGSVGSLIRMYGR--FDD 1242

Query: 570  EFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGIANAVPDHTVNIYR 628
              +R+   ++++ +  +H   I+H D+K  N +  + G+ KI DFGI+    D    IY 
Sbjct: 1243 ILIRHLTIQVLQGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSND----IYS 1298

Query: 629  DNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGT 685
            ++++   GT  +MAPE +         G  AK       D+WS GCI+ +M  GK P+  
Sbjct: 1299 NSEMTMKGTVFWMAPEMV-----DTKQGYSAK------VDIWSLGCIVLEMFAGKRPWSN 1347

Query: 686  FQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLS 741
            F+    ++ I       P PE D+   +I     + +  C E +P  R T D+LLS
Sbjct: 1348 FEVVAAMFKIGQAKSAPPIPE-DTL-PLISENAKEFLDCCFEIDPEKRPTADKLLS 1401

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 108/235 (45%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL +   V+ L +    +  LFL++E     +L   L  R ++  + E +
Sbjct: 103 GIEREI-IIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLS-EKEAI 160

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++I+     H  +I H DLKP N +  K    +KI DFG+A      T N   + 
Sbjct: 161 HY-FRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAAL---QTSNKLLET 216

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE  + M  T N G         PSDVWSCG IL+ ++ G  P+       
Sbjct: 217 SCGSPHYASPE--IVMGKTYNGG---------PSDVWSCGIILFALLTGHLPFNDDNIKR 265

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  +     ++P          I     D I   L  +P  R+TI+ +LS  LI
Sbjct: 266 LLLKVQAGKYQMPQ--------AISLEAQDLISRILVVDPNKRITINDILSHPLI 312

>KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON}
           Anc_8.482 YPL031C
          Length = 306

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 128/269 (47%), Gaps = 39/269 (14%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  + DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEYMDKDLKK 91

Query: 558 VLTQR----SKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIID 612
            +  R    + +  +   V+Y   ++++ +   H+  I+H DLKP N +   KG LKI D
Sbjct: 92  YMDSRTVGNAPVGLELHLVKYFQWQLLEGLAFCHENKILHRDLKPQNLLINKKGQLKIGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYSTSIDIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNNR------LYAIMNPDVKIPYPEKDS---FGTVIPRTVIDT 721
           CIL +M+ GKP    F G N       ++  M    +  +P   S   +    P+ +   
Sbjct: 197 CILAEMITGKP---LFPGTNEEEQLKLIFETMGTPNEQSWPGISSLPKYNPGFPQHLPKN 253

Query: 722 IRSCLERNPISRV--TIDQLLSGAL-INP 747
           ++S L+ +  S +  T+  LL G L +NP
Sbjct: 254 LKSILQAHCASDLDDTLIALLHGLLQLNP 282

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 133/295 (45%), Gaps = 32/295 (10%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 59  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIVMVIEYAGNELF 117

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  D    R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 118 DYIVQRDKMNEDE--ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 175

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWS G ILY 
Sbjct: 176 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSSGVILYV 221

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P         +I R +I         NP++R+T
Sbjct: 222 MLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASNLIKRMLI--------VNPLNRIT 273

Query: 736 IDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAE 790
           I +++       V + ++ I   +KN           +N+ +EE+ + + + L++
Sbjct: 274 IHEIMQDEWFK-VGMPEYLIPPELKNE----SSNAQASNDNIEEVDDSLVSTLSK 323

>AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, 303
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPL031C (PHO85); 1-intron
          Length = 303

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 128/278 (46%), Gaps = 52/278 (18%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  ++DL +
Sbjct: 36  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEFMDNDLKK 93

Query: 558 VLTQR--SKIP--FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            +  R   ++P   +   V+Y   ++++ V   H+  I+H DLKP N +   KG LK+ D
Sbjct: 94  FMDSRLDREMPRGLELSLVKYFQWQLLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGD 153

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 154 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYCTSIDIWSCG 198

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIM--------------------NPDVKIPYPEKDSF 710
           CIL +M+ GK  +     + +L  I                     NP + + YP KD  
Sbjct: 199 CILAEMIMGKALFPGTNDDEQLKLIFETMGTPTEQTWVGVSQLPKYNPQIPL-YPNKDIK 257

Query: 711 GTV-------IPRTVIDTIRSCLERNPISRVTIDQLLS 741
             +       I   +++ I+  L+ NP  R++  Q LS
Sbjct: 258 QLLQATTKEQISDVLVNLIQGLLQLNPSMRLSAQQALS 295

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 114/247 (46%), Gaps = 25/247 (10%)

Query: 496 VYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDL 555
           VYA+K +S  E D   +   + EI+ L  L+    + +    ++    L+++ME      
Sbjct: 67  VYAIKVLSL-ESDLDEVADIQREIQFLVSLKQVPNITRYYASYLKDTSLWIIMEYCAGGS 125

Query: 556 SQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFG 614
            + L +  KI  D +++    +E++  +  +H  +++H D+K AN +   +G +K+ DFG
Sbjct: 126 VRTLLRPGKI--DEKYIAVIMRELLVALHYIHKDNVIHRDIKAANLLITNEGNVKLCDFG 183

Query: 615 IANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILY 674
           +A  +  +T  + R    GTP +MAPE ++       +G     K    +D+WS G   Y
Sbjct: 184 VAAQLNQNT--MRRQTMAGTPYWMAPEVIM-------EGISYDTK----ADIWSVGITAY 230

Query: 675 QMVYGKPPYGTFQGNNRLYAIMNPD-VKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISR 733
           ++  G PP+   +    +  I      ++     D         + + I  CL+ +P  R
Sbjct: 231 EIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPL-------LKEFIAMCLDEDPQER 283

Query: 734 VTIDQLL 740
            T D+LL
Sbjct: 284 PTADKLL 290

>TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 bp,
           304 aa] {ON} Anc_8.482 YPL031C
          Length = 304

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 103/200 (51%), Gaps = 27/200 (13%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEYMDNDLKK 91

Query: 558 VLTQRS----KIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            +  R+        +   V+Y   ++++ V   H++ I+H DLKP N +   KG LK+ D
Sbjct: 92  YMDSRTVGNNPQGLELSLVKYFHWQLLEGVSFCHESKILHRDLKPQNLLINNKGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+    +R              D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMG---SRTYSTSI--------DMWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN 690
           CIL +M+ GKP    F G N
Sbjct: 197 CILAEMITGKP---LFPGTN 213

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 115/236 (48%), Gaps = 27/236 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L++++E  E  +L  +L ++  +P + E +
Sbjct: 75  GIEREI-IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP-ENEAI 132

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +    + +KI DFG+A      T +   +  
Sbjct: 133 RF-FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL---ETEDKLLETS 188

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN-- 689
            G+P+Y APE +  + +            G  +DVWSCG IL+ ++ G+ P+    GN  
Sbjct: 189 CGSPHYAAPEIVSGLPYH-----------GLETDVWSCGVILFALLTGRLPFDEEDGNIR 237

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
           N L  +   + ++P  ++      I +   D +   L  +P  R+   ++L   L+
Sbjct: 238 NLLLKVQKGEFEMPGDDE------ISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 112/256 (43%), Gaps = 49/256 (19%)

Query: 503  SFDEFDESSIDGFKGEIELLKKL-----------ENKQRVVKL-IDYHMGQGVLFLLMEC 550
            S DE   S ++  K E+  LK L           ENK  V  L ++Y  G  V  L+   
Sbjct: 1184 SQDETTLSVLEALKSEVSTLKDLDHVNIVQYLGFENKNHVYSLFLEYVAGGSVGSLIRLF 1243

Query: 551  GEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLK 609
            G               FD + +R+   ++++ +  +H   I+H D+K  N +  V G+ K
Sbjct: 1244 GR--------------FDEDLIRFLAVQVLRGLAYLHSKGILHRDMKADNLLLDVDGICK 1289

Query: 610  IIDFGIANAVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDV 666
            I DFGI+      + NIY ++ +   GT  +MAPE +         G  AK       D+
Sbjct: 1290 ISDFGISK----KSNNIYSNSDMTMRGTVFWMAPEMV-----DTKQGYSAK------VDI 1334

Query: 667  WSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPE-KDSFGTVIPRTVIDTIRSC 725
            WS GC++ +M  GK P+  F+    ++ I       P PE      +   ++ +D   +C
Sbjct: 1335 WSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQKLLSAEAKSFLD---AC 1391

Query: 726  LERNPISRVTIDQLLS 741
             E +P  R T D LLS
Sbjct: 1392 FEIDPEKRPTADDLLS 1407

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 120/257 (46%), Gaps = 31/257 (12%)

Query: 495  KVYALKRVSFDEFDE------SSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLM 548
            ++ A+K+V   EF        S+++  + E+ LLK L++   +V+ + +     +  L +
Sbjct: 1362 EMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLLKDLDHIN-IVQYLGFEKKNNIYSLFL 1420

Query: 549  E-CGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKG 606
            E      +  ++    +  FD   +R+   +++  +  +H   I+H D+K  N +   +G
Sbjct: 1421 EYVAGGSIGSLIRMYGR--FDESLIRHSTTQILAGLSYLHSKGILHRDMKADNILLDGEG 1478

Query: 607  MLKIIDFGIANAVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKP 663
            + KI DFGI+    D    IY ++++   GT  +MAPE +         G  AK      
Sbjct: 1479 ICKISDFGISRKSKD----IYSNSEMTMRGTVFWMAPEMV-----DTKQGYSAK------ 1523

Query: 664  SDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIR 723
             D+WS GCI+ +M  GK P+   +    ++ I       P PE D+   +I +   D + 
Sbjct: 1524 VDIWSLGCIILEMFAGKRPWSNLEVVAAMFKIGQSKSAPPIPE-DTL-PLISQDGRDFLD 1581

Query: 724  SCLERNPISRVTIDQLL 740
             C + +P  R T +Q+L
Sbjct: 1582 DCFKIDPEKRPTAEQML 1598

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 109/234 (46%), Gaps = 36/234 (15%)

Query: 522 LKKLENK-QRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           L+KL N    ++KL      +  L+ L+E   + DL  +L +     FD     Y   ++
Sbjct: 311 LQKLNNSINGIIKLYCTFQDEANLYFLLEYASNGDLLTLLKKYGS--FDETSTIYFTAQI 368

Query: 580 IKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHT---------VNIYRD 629
           I  +  +H   I+H D+KP N +  K   +K+ DFG A  +              N+   
Sbjct: 369 IDSIHYIHSMGIIHRDIKPENILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLER 428

Query: 630 NQ--IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQ 687
           ++  +GT  Y++PE L+  ++T +             D+W+ GCIL+Q++ GKPP   F+
Sbjct: 429 SKSFVGTAEYVSPE-LLTDSYTDSR-----------CDIWAFGCILFQLIAGKPP---FK 473

Query: 688 GNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLS 741
             N  Y      +K+ Y    +F    P  + D I+  L +NP +R+TI Q+ S
Sbjct: 474 ATNE-YLTFQKIIKLQY----AFTAGFPTILRDLIKKILIKNPNNRLTIHQIKS 522

>SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 368

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 97/195 (49%), Gaps = 29/195 (14%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGV-----LFLLMECGEHDLSQVLTQ---RSKIPFDT 569
           E++LLK   + + ++ ++D      +     ++L+ E  E DL +++      S  P   
Sbjct: 59  ELKLLKFFHDHENIISVLDIVRPTSLAKFDAVYLVQELMETDLHRIIANSNGHSGTPLSD 118

Query: 570 EFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYR 628
           + ++Y   +M++ +K +H A ++H DLKP+N +      LK+ DFG+A  +   + +  R
Sbjct: 119 DHIQYFVYQMLRALKAMHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSSNS--R 176

Query: 629 DNQIG-------TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKP 681
           +N +G       T  Y APE ++              +     D+WSCGCIL +M+ GKP
Sbjct: 177 ENLVGFMTEYVATRWYRAPEIMLTFQ-----------EYTTAMDIWSCGCILAEMITGKP 225

Query: 682 PYGTFQGNNRLYAIM 696
            +     +++L+ I+
Sbjct: 226 LFPGRDYHHQLWLIL 240

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 105/226 (46%), Gaps = 30/226 (13%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L++L + + ++KL      +  L+ L+E   + D   V+ +   +  D     Y+  +++
Sbjct: 215 LQRLNDGRGIIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKYGSLNQDCSV--YYSAQIL 272

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAV-PDHTVNIY-----RDNQIG 633
             +  +H   ++H D+KP N +  K M +K+ DFG A  V  D T   Y       + +G
Sbjct: 273 DAIDYLHQKGVIHRDIKPENILLDKDMKVKLTDFGTAKLVEKDETTQTYNLLERSKSFVG 332

Query: 634 TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLY 693
           T  Y++PE L       ND       V    D+W+ GCIL+QM+ GKPP   F+  N  Y
Sbjct: 333 TAEYVSPELL-------NDNY-----VDYKCDIWAFGCILFQMIAGKPP---FKATNE-Y 376

Query: 694 AIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
                 +K+ Y    +F    P  + D I+  L +NP  R+   Q+
Sbjct: 377 LTFQKVMKVQY----AFTAGFPLIIRDLIKQILVKNPEQRLDTLQV 418

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 107/235 (45%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L +    +  L+L++E     +L   L  R ++  + E V
Sbjct: 162 GIEREIVIMK-LISHANVLGLYEVWENKSELYLVLEYVDGGELFDYLVSRGRL-CEREAV 219

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK--GMLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++I+ V   H  +I H DLKP N +  K    +KI DFG+A        N     
Sbjct: 220 HY-FKQIIQGVSYCHAFNICHRDLKPENLLLDKKNSTIKIADFGMAAL---EVSNKLLQT 275

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++   +            G PSDVWSCG IL+ ++ G  P+       
Sbjct: 276 SCGSPHYASPEIVMGKQYH-----------GGPSDVWSCGIILFALLTGHLPFNDDSIKK 324

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  + +   ++P          + +   D I   L  NP  R+T +++L   LI
Sbjct: 325 LLLKVQSGKYQMPQN--------LSKEAQDLIAKILTVNPAKRLTTEEILRHPLI 371

>SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} similar
           to uniprot|P27636 Saccharomyces cerevisiae YAR019C CDC15
           Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p
          Length = 912

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 115/254 (45%), Gaps = 33/254 (12%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           K  A+K + +D  +E  ++    EI+LLK L +   +VK   +   +  L +L+E C   
Sbjct: 64  KEVAIKVIEYD--NEEELNDHMLEIDLLKNLRHPN-IVKYHGFIQKRHQLCILLEYCSRG 120

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIID 612
            L  V  Q    P D +  R + Q+ ++ ++ +H   ++H D+K AN +   +  +K+ D
Sbjct: 121 SLRDVFKQH---PIDEQQARVYVQQTLQGLQYLHSQGVIHRDIKAANLLLDAQNTVKLAD 177

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG++       VN       G+PN+M+PE ++    T              SDVWS G  
Sbjct: 178 FGVST-----RVNSLAMTYAGSPNWMSPEVMLGKGAT------------TVSDVWSLGAT 220

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
           + +++ G PP+         YAI+N    + YP        + R   D I  C ++N   
Sbjct: 221 VVEILTGNPPFHNLVNEAACYAIVN---DVYYPP-----AWLSRPCCDFIHRCFQKNMFK 272

Query: 733 RVTIDQLLSGALIN 746
           R +  +LL  A + 
Sbjct: 273 RPSATELLKHAWVG 286

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 112/244 (45%), Gaps = 25/244 (10%)

Query: 503  SFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQ 561
            S DE   S ++  + E+  LK L++   +V+ + +     V  L +E      +  ++  
Sbjct: 1184 SQDETTLSVLEALRSEVATLKDLDHTN-IVQYLGFENKNYVYSLFLEYVAGGSVGSLIRL 1242

Query: 562  RSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVP 620
              K  FD   +R+   ++++ +  +H   I+H D+K  N +  V G+ KI DFGI+    
Sbjct: 1243 YGK--FDENLIRFLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISK--- 1297

Query: 621  DHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMV 677
              + NIY ++ +   GT  +MAPE +         G  AK       D+WS GC++ +M 
Sbjct: 1298 -KSNNIYSNSDMTMRGTVFWMAPEMV-----DTKQGYSAK------VDIWSLGCVVLEMF 1345

Query: 678  YGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTID 737
             GK P+   +    ++ I       P PE      +I     + + +C E NP  R T D
Sbjct: 1346 AGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQ--KIISAEGKEFLDACFEINPEKRPTAD 1403

Query: 738  QLLS 741
            +LLS
Sbjct: 1404 ELLS 1407

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 109/229 (47%), Gaps = 26/229 (11%)

Query: 521 LLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           L+ K      +V  ID ++ +G L+++ME  E   L+ V+T           +    +E 
Sbjct: 376 LVMKGSKHSNIVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVCRET 432

Query: 580 IKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYM 638
           +K ++ +H   ++H D+K  N +  + G +K+ DFG    +  + VN+ R   +GTP +M
Sbjct: 433 LKGLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI--NEVNLKRTTMVGTPYWM 490

Query: 639 APETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM-N 697
           APE +            ++ + G   D+WS G ++ +M+ G+PPY        LY I  N
Sbjct: 491 APEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATN 538

Query: 698 PDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALIN 746
              K+  PE       +  T+ + +  CL+ +P  R    +LLSG  I+
Sbjct: 539 GTPKLKDPEN------LSDTLKEFLGWCLKVDPEDRANAAELLSGTFIS 581

>CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} similar
           to uniprot|P38147 Saccharomyces cerevisiae YBR274w CHK1
           regulats inhibitory Cdk phosphorylation of PDS1
          Length = 528

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 91/170 (53%), Gaps = 18/170 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           E+ L  K      V+++ID ++G   L++++E  +  DL   +     +  D +  +++F
Sbjct: 64  EVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDLFDKI--EPDVGVDPDVAQFYF 121

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAV--PDHTVNIYRDNQIG 633
           Q++I+ +  +HD  + H D+KP N +   KG LK+ DFG+A+     D T+ +  D Q G
Sbjct: 122 QQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLASQFRRKDGTLRVSTD-QRG 180

Query: 634 TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY 683
           +P YMAPE L +  +  N            +D+WS G +L+ ++ G+ P+
Sbjct: 181 SPPYMAPEILSSQGYYAN-----------ITDIWSAGVLLFVLLTGEIPW 219

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 106/226 (46%), Gaps = 30/226 (13%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L++L + + V+KL      +  L+ L+E   + D   V+ +   +    E   Y+  +++
Sbjct: 210 LQRLNDGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSL--SQECAVYYSAQIL 267

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPD----HTVNIYRDNQ--IG 633
             +  +H   IVH D+KP N +  K M +K+ DFG A  +       T N+   ++  +G
Sbjct: 268 DAIDYLHHKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVG 327

Query: 634 TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLY 693
           T  Y++PE L       ND       V    D+W+ GCIL+QM+ GKPP   F+  N  Y
Sbjct: 328 TAEYVSPELL-------NDNY-----VDYKCDIWAFGCILFQMIAGKPP---FKATNE-Y 371

Query: 694 AIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
                 +K+ Y    +F    P  + D I+  L ++P  R+   Q+
Sbjct: 372 LTFQKVMKVQY----AFTAGFPLVIRDLIKKILVKSPEQRLDASQI 413

>ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 366

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 94/190 (49%), Gaps = 22/190 (11%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGV-----LFLLMECGEHDLSQVLTQRSKIPFDTEFV 572
           EI+LL    + + ++ ++D      +     ++L+ E  E DL ++++  S  P   + +
Sbjct: 59  EIKLLSYFHDHENIISILDKVRPTSIDKMNAVYLVQELMETDLQRIISNISTNPLSDDHI 118

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPD-----HTVNI 626
           +Y   ++++ +K +H A ++H DLKP+N +      LK+ DFG++  +        T+  
Sbjct: 119 QYFTYQILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSSDSRETLVG 178

Query: 627 YRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTF 686
           +    + T  Y APE ++              +     D+WSCGCIL ++V GKP +   
Sbjct: 179 FMTEYVATRWYRAPEIMLTFQ-----------EYTTAMDIWSCGCILAELVSGKPLFPGR 227

Query: 687 QGNNRLYAIM 696
             +++L+ I+
Sbjct: 228 DYHHQLWLIL 237

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 115/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 66  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 124

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  + E  R+ FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 125 DYIVQRDKMS-ENEARRF-FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 182

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWS G ILY 
Sbjct: 183 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSSGVILYV 228

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    IP          + +   + I+  L  NP++R+T
Sbjct: 229 MLCRRLPFDDESIPVLFKNISNGVYSIP--------KFLSQGAANLIKRMLIVNPLNRIT 280

Query: 736 IDQLL 740
           I +++
Sbjct: 281 IHEIM 285

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 114/237 (48%), Gaps = 32/237 (13%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L++    +  L+L++E     +L   L  + K+  + E V
Sbjct: 172 GIEREIVIMK-LISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLS-EPEAV 229

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIAN-AVPDHTVNIYRD 629
            Y F ++I+ V   H  +I H DLKP N +  K   ++KI DFG+A   +P+  +    +
Sbjct: 230 HY-FTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELPNKLL----E 284

Query: 630 NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
              G+P+Y +PE ++   +            G PSDVWSCG IL+ ++ G  P+      
Sbjct: 285 TSCGSPHYASPEIVMGKPYH-----------GGPSDVWSCGIILFALLTGHLPFNDDNIK 333

Query: 690 NRLYAIMNPDVKI-PYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             L  +     ++ PY   D+          D I   L  NP  R+TI+++L+  LI
Sbjct: 334 KLLLKVQAGRFQLPPYLTNDAK---------DLITRILVTNPEKRLTINEILNHPLI 381

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 130/299 (43%), Gaps = 72/299 (24%)

Query: 497 YALKRVSFDEF-DESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHD 554
           +A+K VS  +  ++  ++  + EI +LKK+ N   +VKLID        +L+ME C   D
Sbjct: 72  FAIKIVSRSKLKNKKLLENLEIEIAILKKI-NHPHIVKLIDCERTTTDFYLIMEYCALGD 130

Query: 555 LSQVLTQR--------------SKIPFDTE--------FVRYHFQEMIKCVKVVHDADIV 592
           L+ ++ +R               K P   E        F+  + Q++   +K +   ++V
Sbjct: 131 LTFLIKKRHELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLV 190

Query: 593 HSDLKPANFVFVKGM----------------------LKIIDFGIANAVPDHTVNIYRDN 630
           H D+KP N + +  +                      LKI DFG A  +P+ ++    + 
Sbjct: 191 HRDIKPQNLLLLTPLINYNDSKAFKKLGFIGIYELPILKIADFGFARFLPNTSM---AET 247

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P YMAPE L   N+ + + +         +D+WS G +LY+M YG PP   F+ +N
Sbjct: 248 LCGSPLYMAPEIL---NYQKYNAK---------ADLWSVGTVLYEMCYGTPP---FKASN 292

Query: 691 RL---YAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALIN 746
            L     I   + KI +P        I   +   I   L  +P  R+  D+  +  L+N
Sbjct: 293 HLELYKKIKRSNNKINFPN----YIQIQNDMKILISKLLTFDPQRRIEFDEFFNNNLVN 347

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 107/233 (45%), Gaps = 36/233 (15%)

Query: 521 LLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           L+ K    Q +V  ID ++ +G L+++ME  E   L+ V+T           +    +E 
Sbjct: 670 LVMKGSKHQNIVNFIDSYVLKGDLWVVMEYMEGGSLTDVVTH---CILTEAQIGAVCRET 726

Query: 580 IKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYM 638
           ++ ++ +H   ++H D+K  N +  + G +K+ DFG    +  + +N+ R   +GTP +M
Sbjct: 727 LRGLQFLHSKGVIHRDIKSDNILLSMNGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWM 784

Query: 639 APETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM-- 696
           APE +            ++ + G   D+WS G ++ +M+ G+PPY        LY I   
Sbjct: 785 APEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATN 832

Query: 697 -NPDVKIP---YPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             P +K P    PE  SF           +  CL  NP +R +  +LL    I
Sbjct: 833 GTPKLKEPEVLSPELKSF-----------LAWCLNVNPDTRASATELLRDVFI 874

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 113/236 (47%), Gaps = 27/236 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L++++E  E  +L  +L ++  +  + E +
Sbjct: 73  GIEREI-IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQ-EQEAI 130

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQ 631
           R+ F+++I  +   H   IVH DLKP N +   K  +KI DFG+A      T +   +  
Sbjct: 131 RF-FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEDKLLETS 186

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN-- 689
            G+P+Y APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN  
Sbjct: 187 CGSPHYAAPEIVSGIPYH-----------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 235

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
           N L  + + + ++P  ++      I     D +   L  +P  R+    +L   L+
Sbjct: 236 NLLLKVQSGEFEMPSDDE------ISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285

>KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]
           {ON} similar to uniprot|P41808 Saccharomyces cerevisiae
           YPR054W SMK1 Mitogen-activated protein kinase required
           for spore morphogenesis that is expressed as a middle
           sporulation-specific gene
          Length = 439

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 123/269 (45%), Gaps = 55/269 (20%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQ----GVLFLLMECGEHDLSQVLTQRSKIPFDTEFVR 573
           E++ +   +  + +V LID  +        L+   E  ++DL++V+   S + F +EF  
Sbjct: 123 ELKFMSYFKGHRNIVSLIDLEIVNEEPYSGLYCYQELVDYDLARVI--HSNVLF-SEFHI 179

Query: 574 YHFQEMIKC-VKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAV-PDHTV----NI 626
            HF   I C +K +H AD++H DLKP N +  + G +KI DFG+A  + P  TV    + 
Sbjct: 180 KHFLYQILCGMKYIHSADVIHRDLKPGNILCSITGEIKICDFGLARGISPSFTVAGGISN 239

Query: 627 YRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTF 686
           +  N + T  Y APE +++             +  K  D+W+ GCIL +  YG+ P   F
Sbjct: 240 HITNYVATRWYRAPELILSHK-----------RYSKSVDMWAVGCILAEF-YGRKP--VF 285

Query: 687 QGNNRLYAIMNPDVKIPYPEK------------DSFGTVIPR---------------TVI 719
            GN+ L+ +M     +  P++            D F T  P+                 +
Sbjct: 286 MGNDSLHQVMEIQKILGTPKQIVIRTYGSSRCYDIFSTSKPQYKKTPWCEIFPYASSEAV 345

Query: 720 DTIRSCLERNPISRVTIDQLLSGALINPV 748
           D +   ++ NP +R+T+++ L    +  V
Sbjct: 346 DLMERLIDWNPEARLTVEEALDHPFLQQV 374

>Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 102/200 (51%), Gaps = 27/200 (13%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEFMDNDLKK 91

Query: 558 VLTQRS--KIP--FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIID 612
            +  R+    P   +   V+Y   ++++ +   H++ I+H DLKP N +   KG LK+ D
Sbjct: 92  YMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHESKILHRDLKPQNLLINKKGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYSTSIDIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN 690
           CIL +M+ GKP    F G N
Sbjct: 197 CILAEMITGKP---LFPGTN 213

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 108/232 (46%), Gaps = 34/232 (14%)

Query: 527 NKQRVVKLI-DYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKV 585
           N   ++KL   +H  + + F+L      +L Q+L  + +  F+  + ++   ++I  ++ 
Sbjct: 69  NHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGR--FNEAWTKHFMCQLIDALEY 126

Query: 586 VHDADIVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLV 644
           +H   +VH DLKP N +   +G L I DFG+A+ +          + +GT  Y++PE L+
Sbjct: 127 IHGCKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELLL 186

Query: 645 --AMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYA---IMNPD 699
               NF               SD+W+ GC+LYQ   G PP   F+G N L A   I+N D
Sbjct: 187 QNKSNFC--------------SDIWAVGCMLYQFTQGTPP---FRGENELAAFEKIVNLD 229

Query: 700 VKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVT 751
               Y        ++ + + D +   L  +P SR T+ Q+ + A    +  T
Sbjct: 230 YHWIY--------MVSQHITDLVSKILVLDPDSRYTLPQIKNHAWFQGIDWT 273

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 135/290 (46%), Gaps = 36/290 (12%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +VYA+K ++ D   E  ++  + E++ L  L+    + +     + +  L+++ME C   
Sbjct: 47  QVYAIKVLNLD-CPEDEVEDVQKEVQFLSSLKQVPNITQYYGSFLYETKLWVIMEYCAGG 105

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIID 612
            L + L +  KI  D +++    + ++  +  +H  +++H D+K AN +   G  +K+ D
Sbjct: 106 SL-RTLLRPGKI--DEKYLGVIVRNLLVALLYIHKDNVIHRDIKAANVLITNGGHVKLCD 162

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  +   T N  R    GTP +MAPE ++       +G     K    +D+WS G  
Sbjct: 163 FGVAAQL--TTANHKRQTMAGTPYWMAPEVIM-------EGVYYNTK----ADIWSLGIT 209

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I     K P  E  ++  ++     + I  CL+ +P +
Sbjct: 210 TYEIATGNPPYCDVEALRAMQLITKS--KPPRLEGRNYSPLLK----EFIALCLDEDPEA 263

Query: 733 RVTIDQLLSGALI-----NPVTVTKFFIHDLIKNAVNYGCDQKHVNNERV 777
           R T ++LL+  L+     + VT+ K  I   +         +KH N E V
Sbjct: 264 RPTAEELLTTKLVKTHKGSSVTILKELISRYLL------FSEKHKNRESV 307

>TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1121

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 105/234 (44%), Gaps = 39/234 (16%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L++L N + VVKL      +  L+ L+E   + D   V+ +   +  + E   Y+  ++I
Sbjct: 295 LQRLNNSRTVVKLFFTFQDEAHLYFLLEYAPNGDFLSVMKKYGTL--NEECACYYGAQII 352

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQ-------- 631
             +  +H   I+H D+KP N +    M +K+ DFG A  + D    +  +N         
Sbjct: 353 DAIHFIHSKGIIHRDIKPENILLDGDMKVKLTDFGTAKIL-DPVTKVNNNNSKTATFDLL 411

Query: 632 ------IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGT 685
                 +GT  Y+ PE L       ND     ++     D+W+ GCIL+QM+ GKPP   
Sbjct: 412 TRSKSFVGTAEYVTPELL-------NDS-YTDYRC----DIWAFGCILFQMIAGKPP--- 456

Query: 686 FQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
           F+  N  Y      +K+ Y    +F    P  + D ++  L + P  R+TI  +
Sbjct: 457 FKATNE-YLTFQKVMKVQY----AFTAGFPVVIRDLVKKILLKQPSQRLTISAI 505

>NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 bp,
           311 aa] {ON} Anc_8.482
          Length = 311

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 127/279 (45%), Gaps = 56/279 (20%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEYMDNDLKK 91

Query: 558 VLTQR----SKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIID 612
            +  R    S    +   V+Y   ++++ +   H+  I+H DLKP N +   KG LK+ D
Sbjct: 92  YMDSRTVGNSPRGLELNLVKYFQWQLLEGLAFCHENKILHRDLKPQNLLINKKGALKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+    +R              D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMG---SRTYSTSI--------DIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN------RLYAIMNPDVKIPYPEKDS-------FGTVIPR- 716
           CIL +M+ GKP    F G+N       ++  M    +  +P   +       F   +P+ 
Sbjct: 197 CILAEMITGKP---LFPGSNDEEQLKLIFETMGTPTEATWPGVSALPKYNPNFPQRLPKD 253

Query: 717 ---------------TVIDTIRSCLERNPISRVTIDQLL 740
                           VID +   L+ NP  R++  Q L
Sbjct: 254 LRMVLQPYCKEPLDDNVIDLLHGLLQLNPDMRLSAKQAL 292

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
            similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 118/250 (47%), Gaps = 31/250 (12%)

Query: 518  EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
            EI ++K  ++K  +V  ID ++ +G L+++ME  E   L+ V+T           V    
Sbjct: 881  EILVMKGSKHKN-IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCILTEGQIAAVS--- 936

Query: 577  QEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTP 635
            +E ++ +  +H   ++H D+K  N +  + G +K+ DFG    +  +  N+ R   +GTP
Sbjct: 937  RETLRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQI--NESNLKRTTMVGTP 994

Query: 636  NYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAI 695
             +MAPE +            ++ + G   D+WS G ++ +M+ G+PPY        LY I
Sbjct: 995  YWMAPEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 1042

Query: 696  M---NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTK 752
                 P +K    +  S  +V+ R     +  CL  NP +R T  +LLS  LI  V    
Sbjct: 1043 ATNGTPKLK----DAGSLSSVLKR----FLNWCLHVNPENRATAVELLSDKLITEVADDN 1094

Query: 753  FFIHDLIKNA 762
              +  L+K A
Sbjct: 1095 KSLAPLVKLA 1104

>Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 aa]
           {ON} similar to Ashbya gossypii AGL242C 1-intron
          Length = 301

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 130/278 (46%), Gaps = 52/278 (18%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEFMDNDLKK 91

Query: 558 VLTQR--SKIP--FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            +  R   ++P   +   V+Y   ++++ V   H+  I+H DLKP N +   KG LK+ D
Sbjct: 92  FMDSRVDREMPRGLELSLVKYFQWQLLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+    +R+             D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMG---SRS--------YCTSIDIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIM--------------------NPDVKIPYPEKDSF 710
           CIL +M+ GK  +     + +L  I                     NP + + YP KD  
Sbjct: 197 CILAEMIMGKALFPGTNDDEQLKLIFETLGTPTEQMWPGASQLPDYNPQIPL-YPPKDLK 255

Query: 711 GTVIPRT-------VIDTIRSCLERNPISRVTIDQLLS 741
             + P T       +I  +   L+ NP  R++  Q L+
Sbjct: 256 QLLQPTTNEKISDILISLLHGLLQLNPDMRLSAQQALN 293

>Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113W
           (REAL)
          Length = 435

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 104/216 (48%), Gaps = 23/216 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE  + + + + D E          D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 182 YRAPE--IMLTWQKYDVE---------VDIWSAGCIFAEMIEGKP---LFPGKDHVHQFS 227

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
                +  P KD   T+     +  + S   R+PIS
Sbjct: 228 IITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIS 263

>TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {ON}
           Anc_5.591 YDR466W
          Length = 808

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 116/259 (44%), Gaps = 37/259 (14%)

Query: 495 KVYALKRVS----FDEFDESSIDGFKGEIELLKKLENKQRVVKLI-DYHMGQGVLFLLME 549
           K YA+K  S      E     ++  K  + LL K  N   ++KL   +H  Q + F+L  
Sbjct: 38  KAYAIKVCSKNHIIKENKVKYVNIEKNTLNLLGK-TNHPGIIKLYYTFHDKQNLYFVLDY 96

Query: 550 CGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GML 608
               +L  +L  ++   FD  + ++   ++I  ++ +H   I+H DLKP N +  K G L
Sbjct: 97  AKGGELLSLLHIQTNGTFDELYSKHFMVQIIDTLEYIHSCGIIHRDLKPENLLLDKWGKL 156

Query: 609 KIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWS 668
            I DFG A+   + +      + +GT  Y++PE L+          Q K+     SDVW+
Sbjct: 157 MITDFGAASPPANMST---CSSFVGTAEYVSPELLLF--------NQCKFA----SDVWA 201

Query: 669 CGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSF-----------GTVIPRT 717
            GCILYQ + G PP   F+G N L       V + YP  ++              +    
Sbjct: 202 LGCILYQFINGTPP---FRGENEL-KTFEKIVSLDYPWNNNNNNLLLHPNNNTANLTNPQ 257

Query: 718 VIDTIRSCLERNPISRVTI 736
           +I+  R  L  NP  R+TI
Sbjct: 258 IINLTRKILTLNPNDRITI 276

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 113/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 78  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 136

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+    E  R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 137 DYIVQRDKM--SEEEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 194

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWS G ILY 
Sbjct: 195 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSSGVILYV 240

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P    +    +I R +I         NP++R++
Sbjct: 241 MLCRRLPFDDESIPVLFKNISNGVYTLPKFLSEGAAGLIKRMLI--------VNPLNRIS 292

Query: 736 IDQLL 740
           I +++
Sbjct: 293 ILEIM 297

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 122/268 (45%), Gaps = 30/268 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           ++ A+K ++ D   E  ++  + EI+ L  L+    +      ++    L+++ME C   
Sbjct: 50  QICAIKVLNLDT-SEDEVEDVQKEIQFLSSLKQVPNITHYYGSYLYDTKLWIIMEYCAGG 108

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIID 612
            L + L +  KI  D +++    +E++  +  +H  +++H D+K AN +    G +K+ D
Sbjct: 109 SL-RTLLRPGKI--DEKYIGVIMRELLVALLYIHKDNVIHRDIKAANVLITNDGRVKLCD 165

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  +     N+ R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 166 FGVAAQLTQS--NVRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 212

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I     K P  E   +  ++     + I  CL+ +P  
Sbjct: 213 TYEITTGNPPYCDVEALRAMQLITKS--KPPRLEGRQYSPLLK----EFIALCLDEDPKE 266

Query: 733 RVTIDQLLSGALI-----NPVTVTKFFI 755
           R+  + LL    I     +P ++ K  I
Sbjct: 267 RLAAEDLLKTRFIKTHKSSPTSILKELI 294

>Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113W
           (REAL)
          Length = 431

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 104/216 (48%), Gaps = 23/216 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE  + + + + D E          D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 182 YRAPE--IMLTWQKYDVE---------VDIWSAGCIFAEMIEGKP---LFPGKDHVHQFS 227

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
                +  P KD   T+     +  + S   R+PIS
Sbjct: 228 IITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIS 263

>YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,
           305 aa] {ON}  PHO85Cyclin-dependent kinase, with ten
           cyclin partners; involved in regulating the cellular
           response to nutrient levels and environmental conditions
           and progression through the cell cycle
          Length = 305

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 129/279 (46%), Gaps = 56/279 (20%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEFMDNDLKK 91

Query: 558 VLTQRS--KIP--FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIID 612
            +  R+    P   +   V+Y   ++++ +   H+  I+H DLKP N +  K G LK+ D
Sbjct: 92  YMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYSTSIDIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN------RLYAIMN-------PDV-KIP--------YPEKD 708
           CIL +M+ GKP    F G N       ++ IM        P V K+P         P +D
Sbjct: 197 CILAEMITGKP---LFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRD 253

Query: 709 SFGTVIPRT-------VIDTIRSCLERNPISRVTIDQLL 740
               + P T       ++D +   L+ NP  R++  Q L
Sbjct: 254 LRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQAL 292

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 117/246 (47%), Gaps = 33/246 (13%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLS 556
           A+K++ F+  DES ++    EI+LLK L + Q +V+   +      L++++E C    L 
Sbjct: 37  AIKQIEFE--DESELNEHMLEIDLLKNLRH-QNIVEYRGFIQKAHELYIILEYCARGSLR 93

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGI 615
            +L     +  DT  V Y  Q +   ++ +H+  ++H D+K AN +  + G++K+ DFG+
Sbjct: 94  DILKHGPLLEDDT--VNYVTQTLYG-LQYLHEQGVIHRDIKAANLLLTEEGIVKLADFGV 150

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +       +N       G+PN+MAPE +         G+ A       SD+WS G  + +
Sbjct: 151 ST-----RINRMAMTYAGSPNWMAPEVMT--------GQGA----STVSDIWSLGATVVE 193

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           ++ G PP+      +  YAI+N +   P          +     D +  C ++N   R T
Sbjct: 194 LLTGNPPFHNLVNESACYAIVNEEYIPPL--------TLSAECKDFLSRCFQKNMFKRAT 245

Query: 736 IDQLLS 741
             +LL+
Sbjct: 246 AQELLA 251

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 109/235 (46%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L +    +  L+L++E     +L   L  + K+  + E V
Sbjct: 182 GIEREIVIMK-LISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLS-EKEAV 239

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++I+ V   H  +I H DLKP N +  K    +KI DFG+A        N     
Sbjct: 240 HY-FKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAAL---ELPNKLLQT 295

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++  ++            G PSDVWSCG IL+ ++ G  P+       
Sbjct: 296 SCGSPHYASPEIVMGKSYH-----------GGPSDVWSCGIILFALLTGHLPFNDDNIKK 344

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  +     ++P        T+ P    D I   L  +P  R+T D++L+  LI
Sbjct: 345 LLLKVQAGKFRMP-------STLSPEAQ-DLISRILVIDPSKRITTDRILNHPLI 391

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 115/262 (43%), Gaps = 47/262 (17%)

Query: 495  KVYALKRVSFDEFDESSIDGFKGEIELLKKL-----------ENKQRVVKL-IDYHMGQG 542
            +V   K  S DE   S++D  K E+  LK L           ENK  +  L ++Y  G  
Sbjct: 1284 QVEVPKYSSQDEAIMSTVDAIKSEVSTLKDLDHLNIVQYLGFENKDNIYSLFLEYVAGGS 1343

Query: 543  VLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFV 602
            V  L+   G               FD   +R+   ++++ +  +H   I+H D+K  N +
Sbjct: 1344 VGSLIRIYGR--------------FDEPLIRHLNIQVLRGLAYLHARGILHRDMKADNLL 1389

Query: 603  FVK-GMLKIIDFGIANAVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKW 658
              + G+ KI DFGI+    D    IY ++ +   GT  +MAPE +         G  AK 
Sbjct: 1390 LDQDGVCKISDFGISRKSKD----IYSNSDMTMRGTVFWMAPEMV-----DTKQGYSAK- 1439

Query: 659  KVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTV 718
                  D+WS GCI+ +M  GK P+  F+    ++ I       P PE D+   +I    
Sbjct: 1440 -----VDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGKSKSAPPIPE-DTL-PLISAEG 1492

Query: 719  IDTIRSCLERNPISRVTIDQLL 740
             + + +C E +P  R T D+LL
Sbjct: 1493 REFLDACFEIDPDKRPTADELL 1514

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 109/249 (43%), Gaps = 51/249 (20%)

Query: 511  SIDGFKGEIELLKKL-----------ENKQRVVKL-IDYHMGQGVLFLLMECGEHDLSQV 558
            +++  + E+  LK L           ENK  +  L ++Y  G  V  L+   G       
Sbjct: 1224 TVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR------ 1277

Query: 559  LTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGIAN 617
                    FD   +R+   +++K +  +H   I+H D+K  N +  + G+ KI DFGI+ 
Sbjct: 1278 --------FDESLIRHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISR 1329

Query: 618  AVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILY 674
               D    IY ++ +   GT  +MAPE +         G  AK       D+WS GCI+ 
Sbjct: 1330 KSKD----IYSNSDMTMRGTVFWMAPEMVDT-----KQGYSAK------VDIWSLGCIVL 1374

Query: 675  QMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTV--IPRTVIDTIRSCLERNPIS 732
            +M  GK P+   +    ++ I       P PE D+   +  + R+ +D   +C E NP  
Sbjct: 1375 EMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPE-DTLPLISQVGRSFLD---ACFEINPEE 1430

Query: 733  RVTIDQLLS 741
            R T  +LLS
Sbjct: 1431 RPTATELLS 1439

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 115/254 (45%), Gaps = 25/254 (9%)

Query: 494 HKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGE 552
            +VYA+K ++ D   E  ++  + EI+ L  L+    +      ++    L+++ME C  
Sbjct: 39  QQVYAIKVLNLDN-TEDEVEDIRKEIQFLSSLKQTPNITHYYGSYLIDTKLWVIMEYCAG 97

Query: 553 HDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKII 611
             L  +L  R  I  + +++    +E++  +  +H  +++H D+K AN +    G +K+ 
Sbjct: 98  GSLRTLL--RPGI-IEEKYIGVIMREILVALISIHRDNVIHRDIKAANILIANNGSVKLC 154

Query: 612 DFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGC 671
           DFG+A  +    +   R    GTP +MAPE ++       +G     KV    D+WS G 
Sbjct: 155 DFGVAAQLSQSMLK--RQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGI 201

Query: 672 ILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
             Y++  G PPY   +    +  I     K P  E   +     + + + I  CL+ +P 
Sbjct: 202 TAYEIATGNPPYCHMEAIRAMQMITK--SKPPRLEGREYS----QPLKEFIALCLDEDPK 255

Query: 732 SRVTIDQLLSGALI 745
            R   ++L    LI
Sbjct: 256 ERPYAEELFKSKLI 269

>Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113W
           (REAL)
          Length = 435

 Score = 82.4 bits (202), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 104/216 (48%), Gaps = 23/216 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE  + + + + D E          D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 182 YRAPE--IMLTWQKYDVE---------VDIWSAGCIFAEMIEGKP---LFPGKDHVHQFS 227

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
                +  P KD   T+     +  + S   R+PIS
Sbjct: 228 IITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIS 263

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 119/251 (47%), Gaps = 39/251 (15%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 70  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 128

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  + E  R+ FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 129 DYIVQRDKMS-ENEARRF-FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 186

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWS G ILY 
Sbjct: 187 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSSGVILYV 232

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTV--IPRTV----IDTIRSCLERN 729
           M+  + P+               D  IP   K+    V  IP+ +     + I+  L  N
Sbjct: 233 MLCRRLPFD--------------DESIPVLFKNISNGVYSIPKFLSPGAANLIKKMLIVN 278

Query: 730 PISRVTIDQLL 740
           P++R+TI +++
Sbjct: 279 PLNRITIHEIM 289

>ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 304

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 126/271 (46%), Gaps = 43/271 (15%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++   VV+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-DNVVRLYDVIHTENKLTLVFEYMDNDLKK 91

Query: 558 VLTQRS----KIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            +  R+        +   V+Y   ++++     H+  I+H DLKP N +   KG LK+ D
Sbjct: 92  YMDSRTVGNNPQGLELNLVKYFQWQLMEGAAFCHENKILHRDLKPQNLLINNKGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYSTSIDMWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN------RLYAIMNPDVKIPYPEKDS-------FGTVIPRT 717
           CIL +MV GKP    F G N       ++ IM    +  +P   S       F   +PR 
Sbjct: 197 CILAEMVTGKP---LFPGTNDEEQLKLIFDIMGTPNESTWPGVSSLPKFNLNFPQKLPRD 253

Query: 718 VIDTIRSCLERNPISRVTIDQLLSGAL-INP 747
           +   ++ C  + P+    ID LL G L +NP
Sbjct: 254 LRSILQVC-SKEPLDDNLID-LLHGLLQLNP 282

>TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa]
           {ON} Anc_4.184 YGR040W
          Length = 363

 Score = 81.6 bits (200), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 96/190 (50%), Gaps = 25/190 (13%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGV-----LFLLMECGEHDLSQVLTQRSKIPFDTEFV 572
           EI+LLK   + + ++ ++D      +     ++L+ E  E DL +++  + K+ +D   +
Sbjct: 59  EIKLLKYFNDHENIISILDQVKPNSIETFNSVYLVQELMETDLQKIIVNQ-KLSYD--HI 115

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDH-----TVNI 626
           +Y   ++++ +K +H A ++H DLKP+N +      LK+ DFG++  +        T+  
Sbjct: 116 QYFIYQILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSDNSKDTLVG 175

Query: 627 YRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTF 686
           +    + T  Y APE ++              K     D+WSCGCIL +M+ GKP +   
Sbjct: 176 FMTEYVATRWYRAPEIMLTFQ-----------KYTTAMDIWSCGCILAEMISGKPLFPGR 224

Query: 687 QGNNRLYAIM 696
             +++++ I+
Sbjct: 225 DYHHQIWLIL 234

>Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 129/280 (46%), Gaps = 58/280 (20%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEFMDNDLKK 91

Query: 558 VLTQRS--KIP--FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIID 612
            +  R+    P   +   V+Y   ++++ +   H+  I+H DLKP N +   KG LK+ D
Sbjct: 92  YMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKKGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYSTSIDIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN------RLYAIM-----------------NPDVKIPYPEK 707
           CIL +M+ GKP    F G N       ++ IM                 NP+V+   P +
Sbjct: 197 CILAEMITGKP---LFPGTNDEEQLKLIFDIMGTPSESLWPAVTKLPKYNPNVQHRTP-R 252

Query: 708 DSFGTVIPRT-------VIDTIRSCLERNPISRVTIDQLL 740
           D    + P T       ++D +   L+ NP  R++  Q L
Sbjct: 253 DLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQAL 292

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 110/250 (44%), Gaps = 51/250 (20%)

Query: 510  SSIDGFKGEIELLKKL-----------ENKQRVVKL-IDYHMGQGVLFLLMECGEHDLSQ 557
            S+++  + E+  LK L           ENK  +  L ++Y  G  V  L+   G      
Sbjct: 1220 STVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR----- 1274

Query: 558  VLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGIA 616
                     FD   +++   +++K +  +H   I+H D+K  N +  + G+ KI DFGI+
Sbjct: 1275 ---------FDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGIS 1325

Query: 617  NAVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCIL 673
                D    IY ++ +   GT  +MAPE +         G  AK       D+WS GCI+
Sbjct: 1326 RKSKD----IYSNSDMTMRGTVFWMAPEMV-----DTKQGYSAK------VDIWSLGCIV 1370

Query: 674  YQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTV--IPRTVIDTIRSCLERNPI 731
             +M  GK P+   +    ++ I       P PE D+   +  I R  +D   +C E NP 
Sbjct: 1371 LEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPE-DTLPLISQIGRNFLD---ACFEINPE 1426

Query: 732  SRVTIDQLLS 741
             R T ++LLS
Sbjct: 1427 KRPTANELLS 1436

>Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {ON}
            YNR031C (REAL)
          Length = 1376

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 116/249 (46%), Gaps = 41/249 (16%)

Query: 515  FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRY 574
             K E+ +L+ L N   VV+     + +  + + ME  E      L +  +I  D    + 
Sbjct: 1120 IKEEMNVLEML-NHPNVVQYYGVEVHRDKVNIFMEYCEGGSLAALLEHGRIE-DEMVTQV 1177

Query: 575  HFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIAN--------AVPDHTVN 625
            +  E+++ +  +H + +VH D+KP N +    G++K +DFG A         A+ + T+N
Sbjct: 1178 YTLELLEGLTYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTFVETSTRAMRNATIN 1237

Query: 626  I-----------YRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILY 674
                        Y D  +GTP YMAPET+         G  AK K+G   DVW+ GC++ 
Sbjct: 1238 DLDLPESEPETNYMDGMMGTPMYMAPETI--------SGSAAKGKLG-ADDVWALGCVVL 1288

Query: 675  QMVYGKPPYGTFQGNNRLYAIMNPDVK--IP-YPEKDSFGTVIPRTVIDTIRSCLERNPI 731
            +MV G+ P+         +AIM       IP +P KD   T   R  ++    CL ++P 
Sbjct: 1289 EMVTGRRPWSNLDNE---WAIMYHVAAGHIPQFPNKDEV-TSKGRAFLE---RCLVQDPA 1341

Query: 732  SRVTIDQLL 740
            SR +  +LL
Sbjct: 1342 SRASAVELL 1350

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 124/268 (46%), Gaps = 26/268 (9%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHD 554
           KV+A+K ++ D  D + I   + EI+ L  L     +      ++    ++++ME     
Sbjct: 30  KVFAIKVLNLD-CDINEIQDIQNEIKFLSLLRYAPNITYYYHSYLINRKIWIIMEYCNGG 88

Query: 555 LSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDF 613
             + L +  +  F+  ++    +E++  ++ +H  +I+H D+K AN +  + G +K+ DF
Sbjct: 89  SVRNLIKIGR--FNEIYISVILRELLYALEYIHHDNIIHRDIKAANILINQNGGIKLCDF 146

Query: 614 GIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCIL 673
           GIA  +        R    GTP +MAPE ++         E + +     +D+WS G   
Sbjct: 147 GIAAKL--EFSKPKRQTMAGTPYWMAPEVII---------ESSLYDTK--ADIWSVGITA 193

Query: 674 YQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISR 733
           Y++  G PPY  +     +  I    +K P  E    G +  +++ + I  CL+ +P  R
Sbjct: 194 YEITTGNPPYCEYDATKAMQLIT--KLKPPRLE----GKMYSKSLKEFIALCLDEDPSER 247

Query: 734 VTIDQLLSGALINPV--TVTKFFIHDLI 759
           +T  +LL    I     T TK  I DLI
Sbjct: 248 LTSTKLLETEFIKEYQETPTKILI-DLI 274

>Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa]
           {ON} (32671..32687,32861..33767) [924 nt, 308 aa]
          Length = 307

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 125/279 (44%), Gaps = 56/279 (20%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++   +V+L D    +  L L+ E  + DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-DNIVRLYDVIHTENKLTLVFEYMDKDLKK 91

Query: 558 VLTQR----SKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            +  R    S    +   V+Y   ++ + +   H+  I+H DLKP N +   KG LK+ D
Sbjct: 92  YMDSRTTGNSPQGLELSLVKYFQWQLFEGISFCHENKILHRDLKPQNLLINNKGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+    +R+             D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMG---SRSYSTSI--------DMWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN------RLYAIMNPDVKIPYPE-------KDSFGTVIPR- 716
           CIL +M+ GKP    F G N       ++ +M    +  +P          +F   +P+ 
Sbjct: 197 CILAEMLTGKP---LFPGTNDEEQLKLIFDMMGTPTESTWPTVTTLPKYNSNFSIQVPKD 253

Query: 717 ---------------TVIDTIRSCLERNPISRVTIDQLL 740
                           VID +   L+ NP  R++  Q L
Sbjct: 254 LKKLLQPFTKEQLDDIVIDLLNGLLQLNPSMRLSAKQAL 292

>CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031c cyclin-dependent protein kinase
          Length = 302

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 100/200 (50%), Gaps = 27/200 (13%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++   +V+L D    +  L L+ E  ++DL +
Sbjct: 33  ALKEVKLDS-EEGTPSTAIREISLMKELKH-DNIVRLYDVIHTENKLTLVFEYMDNDLKK 90

Query: 558 VLTQRS--KIP--FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIID 612
            +  R+    P   +   V+Y   ++++ +   H+  I+H DLKP N +  K G LK+ D
Sbjct: 91  YMDSRTVGNAPRGLEMNLVKYFQWQLLEGLAFCHENKILHRDLKPQNLLITKRGQLKLGD 150

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 151 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYSTSIDIWSCG 195

Query: 671 CILYQMVYGKPPYGTFQGNN 690
           CIL +M+ GKP    F G N
Sbjct: 196 CILAEMITGKP---LFPGTN 212

>KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {ON}
           Anc_1.182 YJL164C
          Length = 401

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 90/201 (44%), Gaps = 32/201 (15%)

Query: 519 IELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQE 578
           + +    ++ Q+V  ++DY  G G LF L+             R    F T   +++  E
Sbjct: 152 VRMWGTFQDSQQVFMVMDYIEG-GELFSLL-------------RKSQRFPTPVAKFYAAE 197

Query: 579 MIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGIANAVPDHTVNIYRDNQIGTPNY 637
           +   ++ +H+ DI++ DLKP N +  K G +KI DFG A  VPD T  +      GTP+Y
Sbjct: 198 VCLALEYLHNLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTL-----CGTPDY 252

Query: 638 MAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMN 697
           +APE +    +             K  D WS G ++Y+M+ G  P+           I+N
Sbjct: 253 IAPEVMSTKPYN------------KSVDWWSFGVLIYEMLAGHTPFYDSNAMKTYENILN 300

Query: 698 PDVKIPYPEKDSFGTVIPRTV 718
             +K P    D    ++ R +
Sbjct: 301 AKLKFPSFFHDDVKDLLTRLI 321

>Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 119/271 (43%), Gaps = 57/271 (21%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGV----LFLLMECGEHDLSQVLTQRSKIPFDTEF-V 572
           E++ +   +  + +V LID  +        L+   E  ++DL++V+    ++   +EF +
Sbjct: 87  ELKFMNFFKGHKNIVNLIDLEIVTSSPYDGLYCYQELIDYDLAKVIHSSVQL---SEFHI 143

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAV------PDHTVN 625
           +Y   +++  +K +H AD++H DLKP N +  + G LKI DFG+A  +         T+ 
Sbjct: 144 KYFLYQILCGLKYIHSADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFQCHSTIQ 203

Query: 626 IYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGT 685
            +  N + T  Y APE L++                K  D+W+ GCIL +    KP    
Sbjct: 204 PHITNYVATRWYRAPELLLSNQ-----------PYNKSVDIWAVGCILAEFYARKP---V 249

Query: 686 FQGNNRLYAIMNPDVKIPYPEKD---SFGTV----------------IPRT--------- 717
           F G + ++ I      +  P+KD    FGT+                IP +         
Sbjct: 250 FMGRDSMHQIFEIIKVLGTPDKDLLIKFGTIKAWNLGKSSNNPVYKKIPWSNIFPFASHE 309

Query: 718 VIDTIRSCLERNPISRVTIDQLLSGALINPV 748
            ID I S L  +   R+ ++Q +S   +N V
Sbjct: 310 AIDLIESLLHWDSTHRLNVEQAISHPFLNEV 340

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 118/253 (46%), Gaps = 25/253 (9%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +VYA+K ++ D   E  ++  + EI+ L  L+    + +    ++    L+++ME C   
Sbjct: 49  QVYAVKVLNLD-CPEDEVEDVQKEIQFLASLKQVPNITRYYGSYLYDTKLWVIMEYCAGG 107

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            L + L +  KI  D +++    ++++  +  +H  +++H D+K AN +   +G +K+ D
Sbjct: 108 SL-RTLLRPGKI--DEKYLGVIVRKLLIALVYIHKDNVIHRDIKAANVLITNEGHVKLCD 164

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  +     N  R    GTP +MAPE ++   +               +D+WS G  
Sbjct: 165 FGVAAQL--TAANHKRQTMAGTPYWMAPEVIMEGVYYNTK-----------ADIWSLGIT 211

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I     K P  E  ++  ++     + I  CL+ +P  
Sbjct: 212 AYEIATGNPPYCDVEALRAMQLITK--SKPPRLEGRNYSPLLK----EFIALCLDEDPEE 265

Query: 733 RVTIDQLLSGALI 745
           R T + LLS   +
Sbjct: 266 RPTAEDLLSSKFV 278

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 109/229 (47%), Gaps = 33/229 (14%)

Query: 522 LKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMI 580
           L+KL N   VV+L      +  L+ L+E   + D   ++ +   +  D     Y+  ++I
Sbjct: 235 LQKLNNSHSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSL--DENCACYYGSQII 292

Query: 581 KCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAV---------PDHTVNIYRDN 630
             +  +H + I+H D+KP N +    M +K+ DFG A  +           + ++    +
Sbjct: 293 DAIDHLHVSGIIHRDIKPENILLDGEMRIKLTDFGTAKLLEPTNNSSSKSKYDLSTRSKS 352

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
            +GT  Y++PE L+  +FT        ++     D+W+ GCIL+QM+ GKPP   F+  N
Sbjct: 353 FVGTAEYVSPE-LLNDSFT-------DYRC----DIWAFGCILFQMIAGKPP---FKATN 397

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
             Y      +K+ Y    +F    P  + D ++  L +N   R+TI+Q+
Sbjct: 398 E-YLTFQKVMKVQY----AFTPGFPLIIRDLVKKILIKNLDQRLTINQI 441

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 107/235 (45%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L +    +  L+L++E     +L   L  + K+P + E +
Sbjct: 160 GIEREIVIMK-LISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLP-EREAI 217

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++++ V   H  +I H DLKP N +  K    +KI DFG+A        N     
Sbjct: 218 HY-FKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIKIADFGMAAL---ELPNKLLKT 273

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++   +            G PSDVWSCG +L+ ++ G  P+       
Sbjct: 274 SCGSPHYASPEIVMGRPYH-----------GGPSDVWSCGIVLFALLTGHLPFNDDNIKK 322

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  + +   ++P          +     D I   L  NP  R+T  ++L+  LI
Sbjct: 323 LLLKVQSGKYQMPM--------NLSAEARDLISKILVINPEKRITTQEILNHPLI 369

>CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} similar
           to uniprot|P14681 Saccharomyces cerevisiae YGR040w KSS1
          Length = 398

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 102/203 (50%), Gaps = 28/203 (13%)

Query: 518 EIELLKKLENKQRVVKLID-YHMGQGV----LFLLMECGEHDLSQVLTQRSKIPFDTEFV 572
           EI++L    N + ++ + +     Q +    ++L+ E  E DLS++L   + +  D   +
Sbjct: 81  EIKILSHFNNHENIITIFEKIKPMQSINFKEIYLVQELMETDLSRILASSNTLTVD--HI 138

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAV-PDHTVNIYRDN 630
           +Y   ++++ +K +H A ++H DLKP+N +      LKI DFG+A    PD   +    N
Sbjct: 139 QYFLYQILRALKAIHSAKVIHRDLKPSNILLNSNCDLKICDFGLARTYDPDDDASTMNGN 198

Query: 631 QIG-------TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY 683
            +G       T  Y APE  + +NF   D   A        D+WSCGC+L +M++ KP +
Sbjct: 199 NVGFLTEYVATRWYRAPE--IMLNF--QDYSTA-------IDIWSCGCVLAEMLFRKPIF 247

Query: 684 GTFQGNNRLYAIMNPDVKIPYPE 706
                +++L  I++  +  P PE
Sbjct: 248 PGKDYHHQLLLILD-TLGTPSPE 269

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 117/266 (43%), Gaps = 47/266 (17%)

Query: 495  KVYALKRVSFDEFDESSIDGFKGEIELLKKL-----------ENKQRVVKL-IDYHMGQG 542
            +V   K  S DE   S+++  + E+  LK L           ENK  +  L ++Y  G  
Sbjct: 1126 QVEVPKYSSQDENIISTVEALRSEVSTLKDLDHLNIVQYLGFENKDNIYSLFLEYVAGGS 1185

Query: 543  VLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFV 602
            V  L+   G               FD   +R+   ++++ +  +H   I+H D+K  N +
Sbjct: 1186 VGSLIRMYGR--------------FDEAMIRHLTIQVLRGLSYLHSRGILHRDMKADNLL 1231

Query: 603  FVK-GMLKIIDFGIANAVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKW 658
              + G+ KI DFGI+    D    IY ++ +   GT  +MAPE +         G  AK 
Sbjct: 1232 LDQDGVCKISDFGISRKSND----IYSNSDMTMRGTVFWMAPEMV-----DTKQGYSAK- 1281

Query: 659  KVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTV 718
                  D+WS GC++ +M  GK P+   +    ++ I       P PE D+   +I +  
Sbjct: 1282 -----VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPE-DTL-PLISQDG 1334

Query: 719  IDTIRSCLERNPISRVTIDQLLSGAL 744
               + SC E +P SR T D+LLS A 
Sbjct: 1335 RQFLDSCFEIDPESRPTADKLLSHAF 1360

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 108/234 (46%), Gaps = 23/234 (9%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFV 572
           G + EI ++ KL N   V++L D       L++++E  E  +L  +L +   +P + E V
Sbjct: 78  GIEREI-IIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLVENGPLP-ENEAV 135

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQ 631
            + F+++I  V   H   IVH DLKP N +    + +KI DFG+A      T +   +  
Sbjct: 136 CF-FRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAAL---ETEDKLLETS 191

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR 691
            G+P+Y APE +  + +            G  SD+WSCG I + ++ G+ P+    GN R
Sbjct: 192 CGSPHYAAPEIVSGIPYH-----------GFASDIWSCGVIFFALLTGRLPFDEEDGNIR 240

Query: 692 LYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
              +     K   P+ D     I     D +   L  +P  R+   ++L   L+
Sbjct: 241 NLLLKVQSGKFEMPDDDE----ISPEAQDLLAKILTVDPECRIKPREILKHPLL 290

>NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184
          Length = 366

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 107/230 (46%), Gaps = 25/230 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGV-----LFLLMECGEHDLSQVLTQRSKIPFDTEFV 572
           EI+LL    N + ++ ++D      V     ++L+ E  E DL +++   +  P   + +
Sbjct: 59  EIKLLTYFHNHENIISILDKVKPISVNKLNAVYLVQELMETDLQKIIMNSNNNPLSDDHI 118

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPD-----HTVNI 626
           +Y   ++++ +K +H A ++H DLKP+N +      LK+ DFG++  +        T+  
Sbjct: 119 QYFTYQILRALKAIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLTSSSDSRETLVG 178

Query: 627 YRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTF 686
           +    + T  Y APE ++              +     D+WS GCIL +MV G+P +   
Sbjct: 179 FMTEYVATRWYRAPEIMLTFQ-----------EYTTAMDIWSVGCILAEMVSGRPLFPGR 227

Query: 687 QGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTI 736
             +++L+ I+     +  P  + F  +  +   + I +   R+P+  V +
Sbjct: 228 DYHHQLWLILE---VLGTPSLEDFAQIKSKRAKEYISNLPMRSPMPWVNV 274

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 120/250 (48%), Gaps = 26/250 (10%)

Query: 495 KVYALKRVS-FDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGE 552
           K++A K V+      E +      EI++ K ++N   +V+ ID       +++L+E C  
Sbjct: 106 KIFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKNVN-IVQFIDCFEDDTNVYILLEICPN 164

Query: 553 HDLSQVLTQRSKIPFDTE-FVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKI 610
             L  +L +R  +   TE  VR+   ++   +K +H   ++H DLK  N  F K   LKI
Sbjct: 165 GSLMDLLKKRKSL---TEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKI 221

Query: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
            DFG+A  + +     Y     GTPNY+APE L+     ++ G   +       D+WS G
Sbjct: 222 GDFGLAAVLANDRERKY--TVCGTPNYIAPEVLMG----KHTGHSYE------VDIWSIG 269

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNP 730
            +LY ++ GKPP+ +   N     I   D   P   KD +  + P   I  I+  L  +P
Sbjct: 270 VMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP---KDKY--ISPEAKI-LIQDLLSLDP 323

Query: 731 ISRVTIDQLL 740
           + R ++D+++
Sbjct: 324 LERPSVDEII 333

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 107/235 (45%), Gaps = 35/235 (14%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           E   L+KL N + +V+L      +  L+ L+E   + D   ++ +   +  + +   Y+ 
Sbjct: 259 EKNALQKLNNSRGIVRLFFTFQDEASLYFLLEYAPNGDFLSLIKKFGSM--NEDCASYYS 316

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQ---- 631
            ++I  +  VH   I+H D+KP N +    M +K+ DFG A  +   + +    ++    
Sbjct: 317 AQIIDAIHFVHSRGIIHRDIKPENILLDSEMKVKLTDFGTAKILEPKSSSSSSKHETYDL 376

Query: 632 -------IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYG 684
                  +GT  Y++PE L   N +  D            D+W+ GCI++QM+ GKPP  
Sbjct: 377 LTRSKSFVGTAEYVSPELL---NDSYADSR---------CDIWAFGCIVFQMIAGKPP-- 422

Query: 685 TFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
            F+  N  Y      +K+ Y    +F    P  + D ++  L + P  R+TI Q+
Sbjct: 423 -FKATNE-YLTFQKVMKVQY----AFTAGFPLVIRDLVKRILIKAPEQRLTISQI 471

>TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {ON}
           Anc_3.177 YAR019C
          Length = 980

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 124/256 (48%), Gaps = 33/256 (12%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           ++ A+K V++D  +E  ++    EI LLK L N+  +VK   +      L++++E C + 
Sbjct: 84  QIVAIKEVNYDNDEE--LNDIMSEIHLLKNLNNRN-IVKYHGFIQKMDTLYIILEYCSKG 140

Query: 554 DLSQVLTQRSKIP-FDTE-FVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKI 610
            L ++++    I   D + F+R     ++     +H+  ++H D+K AN +     ++K+
Sbjct: 141 SLKKLISSNKGISEADAKMFIRQTLHGLV----YLHEQGVIHRDIKAANLLLDSDNVVKL 196

Query: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
            DFG++  V + T+ +      G+ N+MAPE +       N G          SD+WS G
Sbjct: 197 ADFGVSTKVSNATMAM---TLAGSLNWMAPEII------GNRGASTL------SDIWSLG 241

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNP 730
             + +++ G PP+      N  YAI N    I +P +D    ++ +  +D +  C ++N 
Sbjct: 242 ATVVELLTGNPPFHNLIDVNIYYAIEN---DIYFPPED----LVSKLGLDFLSKCFQKNM 294

Query: 731 ISRVTIDQLLSGALIN 746
             R T  QLL    +N
Sbjct: 295 YLRPTARQLLQHEWLN 310

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 114/245 (46%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 57  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIVMVIEYAGNELF 115

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+  + E  R+ FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 116 DYIVQRDKMS-EREARRF-FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 173

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWS G ILY 
Sbjct: 174 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSSGVILYV 219

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P         +I R +I         NP++R+T
Sbjct: 220 MLCRRLPFDDESIPILFKNISNGIYTLPKFLSPGAANLIKRMLI--------VNPLNRIT 271

Query: 736 IDQLL 740
           I +++
Sbjct: 272 IHEIM 276

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 116/250 (46%), Gaps = 31/250 (12%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           EI ++K+ ++ + +V  ID ++ +G L+++ME  E   L+ V+T           V    
Sbjct: 695 EIIVMKESKH-ENIVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTH---CLLTEAQVGAVC 750

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTP 635
           +E +  ++ +H   ++H D+K  N +  ++G +K+ DFG    +  + +N+ R   +GTP
Sbjct: 751 RETLSGLQFLHSKGVIHRDIKSDNILLSMRGDIKLTDFGFCAQI--NELNLKRTTMVGTP 808

Query: 636 NYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAI 695
            +MAPE +            ++ + G   D+WS G ++ +M+ G+PPY        LY I
Sbjct: 809 YWMAPEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 856

Query: 696 M---NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTK 752
                P +K P    D+    +          CL+ NP  R +   LL    I  +  + 
Sbjct: 857 ATNGTPSLKEPEALSDALNNFLGW--------CLKVNPDERASAKDLLLDPFITEIADSN 908

Query: 753 FFIHDLIKNA 762
             +  L+K A
Sbjct: 909 ESLAPLVKLA 918

>SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915
           bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 124/277 (44%), Gaps = 52/277 (18%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++ + +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-ENIVRLYDVIHTENKLTLVFEFMDNDLKK 91

Query: 558 VLTQRS--KIP--FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFV-KGMLKIID 612
            +  R+    P       V+Y   ++++ V   H+  I+H DLKP N +   KG LK+ D
Sbjct: 92  YMDSRAVGNTPQGLALPLVKYFEWQLLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYSTSIDIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIM--------------------NPDVKIPYPEKDSF 710
           CIL +M+ GKP +       +L  I                     NP+  I  P KD  
Sbjct: 197 CILVEMITGKPLFPGTSDEEQLKLIFETMGTPTERTWPGISSLPKYNPNFPIHLP-KDLR 255

Query: 711 GTVIPRT-------VIDTIRSCLERNPISRVTIDQLL 740
             +  +T       V+D +   L+ NP  R++  Q L
Sbjct: 256 AFLQSQTRESLDNNVVDLLHGLLQLNPEMRLSAKQAL 292

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 119/268 (44%), Gaps = 30/268 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +V A+K ++ D  D+  ++  + EI+ L  L+    +      ++    L+++ME C   
Sbjct: 43  QVCAIKVLNLDSADDE-VEDVQKEIQFLSSLKQVPNITHYYGSYLNDTKLWVIMEYCAGG 101

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIID 612
            L + L +  KI    +++    +E++  +  +H   ++H D+K AN +    G +K+ D
Sbjct: 102 SL-RTLLRPGKI--GEQYIGVIMRELLTALMHIHKDGVIHRDIKAANVLITNDGHIKLCD 158

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG+A  +      I R    GTP +MAPE ++       +G     KV    D+WS G  
Sbjct: 159 FGVAAQL--SQTKIRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGIT 205

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
            Y++  G PPY   +    +  I     K P  E     + +     + I  CL+ +P  
Sbjct: 206 AYEIATGNPPYCEVEALRAMQLITK--SKPPRLEGRQHSSALK----EIIALCLDEDPKE 259

Query: 733 RVTIDQLLSGALIN-----PVTVTKFFI 755
           R + + LL    I      PV++ K  I
Sbjct: 260 RPSAEDLLKTKFIKLHKNVPVSILKELI 287

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 113/236 (47%), Gaps = 30/236 (12%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L +    +  L+L++E     +L   L  R K+P + E V
Sbjct: 145 GIEREIVIMK-LISHPNVMGLYEVWENKSELYLVLEYVDGGELFDYLVSRGKLP-EREAV 202

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIAN-AVPDHTVNIYRD 629
            Y F+++I+ V   H  +I H DLKP N +  K   ++KI DFG+A   V D  ++    
Sbjct: 203 HY-FKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMAALEVSDKLLST--- 258

Query: 630 NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
              G+P+Y +PE ++  ++            G P+DVWSCG IL+ ++ G  P+      
Sbjct: 259 -SCGSPHYASPEIVMGKSYH-----------GSPTDVWSCGIILFALLTGHLPFNHDNIK 306

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             L  + +    +P        + +     D I   L  +P  R+T  ++L+ +LI
Sbjct: 307 KLLLKVQSGVYHMP--------SDLSPDAKDLISKILVVDPDKRLTTTEILNHSLI 354

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 108/235 (45%), Gaps = 26/235 (11%)

Query: 531 VVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDA 589
           +V  ID  + +G L+++ME  E   L+ V+T           +    +E ++ ++ +H  
Sbjct: 608 IVNFIDSFLLKGDLWVIMEFMEGGSLTDVVTH---CILTEGQIGTVCRETLRGLQFLHSN 664

Query: 590 DIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNF 648
            ++H D+K  N +  +KG +K+ DFG    + +H  N+ R   +GTP +MAPE +     
Sbjct: 665 GVIHRDIKSDNILLSMKGDIKLTDFGFCAQINEH--NLKRTTMVGTPYWMAPEVV----- 717

Query: 649 TRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM-NPDVKIPYPEK 707
                  ++ + G   D+WS G ++ +M+  +PPY        LY I  N   K+  PE 
Sbjct: 718 -------SRKEYGPKVDIWSLGIMIIEMIESEPPYLNETPLRALYLIATNGTPKLKEPE- 769

Query: 708 DSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNA 762
                ++   + D +  CL+ NP  R +   LL    I   +     +  L+K A
Sbjct: 770 -----LLSDVLNDFLSWCLKVNPDERASASTLLEDPFITEYSEPNVSLAPLVKLA 819

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 112/245 (45%), Gaps = 27/245 (11%)

Query: 498 ALKRVSFDEFDESSIDG-FKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           ALK ++     +S + G  + EI  L+ L +   ++KL D    +  + +++E   ++L 
Sbjct: 69  ALKIINKKVLAKSDMQGRIEREISYLRLLRHPH-IIKLYDVIKSKDEIIMVIEYAGNELF 127

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
             + QR K+    +  R  FQ++I  V+  H   IVH DLKP N +  + + +KI DFG+
Sbjct: 128 DYIVQRDKM--SEKEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 185

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
           +N + D     +     G+PNY APE +             K   G   DVWS G ILY 
Sbjct: 186 SNIMTDGN---FLKTSCGSPNYAAPEVI-----------SGKLYAGPEVDVWSSGVILYV 231

Query: 676 MVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVT 735
           M+  + P+           I N    +P         +I R +I         NP++R++
Sbjct: 232 MLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLI--------VNPLNRIS 283

Query: 736 IDQLL 740
           I +++
Sbjct: 284 IHEIM 288

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 121/249 (48%), Gaps = 24/249 (9%)

Query: 495 KVYALKRVSFDEF-DESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGE 552
           K++A K V+      E +      EI++ K +++   +V+ ID       +++L+E C  
Sbjct: 100 KIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHPN-IVQFIDCFEDDTNVYILLEICPN 158

Query: 553 HDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKII 611
             L  +L +R K+  + E VRY   +++  +K +H+  ++H DLK  N  F     LKI 
Sbjct: 159 GSLMDLLKKR-KVLTEPE-VRYFTTQIVGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIG 216

Query: 612 DFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGC 671
           DFG+A  + +     Y     GTPNY+APE L      ++ G   +       D+WS G 
Sbjct: 217 DFGLAAVLANDRERKY--TVCGTPNYIAPEVLAG----KHSGHSYE------VDIWSIGV 264

Query: 672 ILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
           ++Y ++ GKPP+   + N     I + D   P  +  S      + V+  I+  L  +PI
Sbjct: 265 MIYALLIGKPPFQAKEVNIIYERIKSGDYIFPREKPTS------KEVMVLIQDILSIDPI 318

Query: 732 SRVTIDQLL 740
            R ++D+++
Sbjct: 319 ERPSLDEIM 327

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 113/237 (47%), Gaps = 25/237 (10%)

Query: 510  SSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFD 568
            S+++  + E+  LK L++   +V+ + + +   +  L +E      +  ++    K  FD
Sbjct: 1227 STVEALRAEVSTLKDLDH-LNIVQYLGFEVKDSIYSLFLEYVAGGSVGSLIRMYGK--FD 1283

Query: 569  TEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGIANAVPDHTVNIY 627
             + +++   ++++ +  +H   I+H D+K  N +  + G+ KI DFGI+    D    IY
Sbjct: 1284 EKLIKHLTIQVLRGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSKD----IY 1339

Query: 628  RDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYG 684
             ++++   GT  +MAPE +         G  AK       D+WS GC++ +M  GK P+ 
Sbjct: 1340 SNSEMTMRGTVFWMAPEMV-----DTKQGYSAK------VDIWSLGCVVLEMFAGKRPWS 1388

Query: 685  TFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLS 741
              +    ++ I       P P  D    +I ++  D +  C + +P  R T D+LLS
Sbjct: 1389 NLEVVAAMFKIGKSKSAPPIP--DDTLPLISQSGRDFLDQCFKIDPEERPTADKLLS 1443

>Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}
           similar to Ashbya gossypii ACL191C
          Length = 365

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 99/192 (51%), Gaps = 27/192 (14%)

Query: 518 EIELLKKLENKQRVVKLIDY-----HMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFV 572
           E++LLK   + + ++ ++D      +     ++L+ E  E DL ++++Q +    D + +
Sbjct: 59  ELKLLKFFHSHENIISVLDIVRPTSYQEFDAVYLVQELMETDLQRIISQTNNFLSD-DHI 117

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQ 631
           +Y   ++++ +K +H A ++H DLKP+N +      LK+ DFG++  +     +  R+N 
Sbjct: 118 QYFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRS--RENM 175

Query: 632 IG-------TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYG 684
           +G       T  Y APE +++             +     D+WSCGCIL +M+ GKP + 
Sbjct: 176 VGFMTEYVATRWYRAPEIMLSFQ-----------EYTTAMDIWSCGCILAEMISGKPLFP 224

Query: 685 TFQGNNRLYAIM 696
               +++L+ I+
Sbjct: 225 GRDYHHQLWVIL 236

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 93/171 (54%), Gaps = 15/171 (8%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFVRYHF 576
           EIE+ K +   + ++ +ID+      +++++E CG   L  ++ +  +   + E  R   
Sbjct: 99  EIEIHKLVNGHKNIISMIDHFEIDATMYMVLELCGAGSLYDIICRSKRSLREWEAKRLMI 158

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFG---IANAVPDHTVNIYRDNQI 632
           Q +   V  +H+ +IVH+DLK +N +      L++ DFG   ++  + ++++N     + 
Sbjct: 159 Q-LCGAVDWIHEKNIVHADLKLSNILIDSSNNLQLCDFGHSFVSTDIDNNSIN-----KF 212

Query: 633 GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY 683
           GTPNY++PE  +  NF  +D +   +   K SD+WS G +LY M++ K P+
Sbjct: 213 GTPNYLSPE--IISNFILSDKKDLYFP--KESDIWSIGIVLYAMIFDKTPF 259

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 104/229 (45%), Gaps = 26/229 (11%)

Query: 521 LLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           ++ KL +   V+ L D       L+L++E  E  +L  +L     +P + E +   F+++
Sbjct: 79  VIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLP-EREAINC-FRQI 136

Query: 580 IKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPNYM 638
           I  +   H   IVH DLKP N +      +KI DFG+A    D  +    +   G+P+Y 
Sbjct: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADL---LETSCGSPHYA 193

Query: 639 APETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR--LYAIM 696
           APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R  L  + 
Sbjct: 194 APEIVSGLPYE-----------GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQ 242

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
               ++P        T I R   D I   L  +P  R+ I  +LS  L+
Sbjct: 243 KGQFEMPN------DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285

>KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON}
           Anc_8.482 YPL031C
          Length = 302

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 125/279 (44%), Gaps = 56/279 (20%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQ 557
           ALK V  D  +E +      EI L+K+L++   +V+L D    +  L L+ E  ++DL +
Sbjct: 34  ALKEVKLDS-EEGTPSTAIREISLMKELKH-DNIVRLYDVIHTENKLTLVFEYMDNDLKK 91

Query: 558 VLTQR--SKIP--FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIID 612
            +  R     P   +   V+Y   ++++ +   H+  I+H DLKP N +   KG LK+ D
Sbjct: 92  YMDSRIVGNTPRGLELHLVKYFQWQLLEGLAFCHENKILHRDLKPQNLLINKKGQLKLGD 151

Query: 613 FGIANA--VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
           FG+A A  +P +T +    +++ T  Y AP+ L+                    D+WSCG
Sbjct: 152 FGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSR-----------TYSTSIDIWSCG 196

Query: 671 CILYQMVYGKPPYGTFQGNN------RLYAIMNPDVKIPYPEKDS-------FGTVIPR- 716
           CIL +M+ GKP    F G+N       ++  M    +  +P   S       F   +P+ 
Sbjct: 197 CILAEMITGKP---LFLGSNDEEQLKLIFDTMGTPNEATWPGVTSLPKYNANFQQRLPKD 253

Query: 717 ---------------TVIDTIRSCLERNPISRVTIDQLL 740
                          TVID +   L+ NP  R++  Q L
Sbjct: 254 LKMILQPYCESPLDDTVIDLLHGLLQLNPDMRLSAKQAL 292

>SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} similar
           to uniprot|Q03306 Saccharomyces cerevisiae YDR466W
          Length = 784

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 106/230 (46%), Gaps = 41/230 (17%)

Query: 517 GEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHF 576
           G ++L     +++ +  ++DY  G  +L LL   G               FD  + ++  
Sbjct: 78  GIVKLYYTFHDQENLYFVLDYAPGGELLHLLQRYGT--------------FDEVWSKHFM 123

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGIANAV------PDHTVNIYRD 629
            +++  V+ +H   ++H DLKP N +  K G L + DFG A+ V       D++V+    
Sbjct: 124 CQLVDVVEYIHSKGVIHRDLKPENVLLSKDGRLMVTDFGAASVVTTDGTSSDNSVSERAA 183

Query: 630 NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
           + +GT  Y++PE L+          Q  +     SD+W+ GCILYQ + G PP   F+G 
Sbjct: 184 SFVGTAEYVSPELLL--------NNQCFFS----SDIWALGCILYQFMQGSPP---FRGE 228

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
           N L       V + Y     +   +  +V+D +R  L  +P  R++I  +
Sbjct: 229 NELQTFEK-IVSLDY----HWKLAVNPSVMDLVRHILVIDPHERLSISAI 273

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 110/236 (46%), Gaps = 30/236 (12%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L +    +  LFL++E     +L   L  R K+  + E V
Sbjct: 165 GIEREIVIMK-LISHPNVMGLYEVWENKSELFLVLEYVDGGELFDYLVSRGKLS-EREAV 222

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM--LKIIDFGIANA-VPDHTVNIYRD 629
            Y F+++I+ V   H  +I H DLKP N +  K +  +KI DFG+A   +P+  +     
Sbjct: 223 HY-FKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGMAALELPNKLLVT--- 278

Query: 630 NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
              G+P+Y +PE ++  ++            G PSDVWSCG IL+ ++ G  P+      
Sbjct: 279 -SCGSPHYASPEIVMGKSYH-----------GSPSDVWSCGIILFALLTGHLPFNDDSIK 326

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             L  + +   ++P          I     D I   L  +P  R+ I+ +L   LI
Sbjct: 327 KLLLKVQSGKFQMPQN--------ISLEAEDLISRILVVDPEKRIQINDILIHPLI 374

>ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR040W
           (KSS1)
          Length = 365

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 100/193 (51%), Gaps = 29/193 (15%)

Query: 518 EIELLKKLENKQRVVKLID------YHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEF 571
           E++LLK   + + ++ ++D      Y   + V +L+ E  E DL ++++Q +    D + 
Sbjct: 59  ELKLLKFFHSHENIISVLDIVRPTSYQDFEAV-YLVQELMETDLQRIISQPNSFLSD-DH 116

Query: 572 VRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDN 630
           ++Y   ++++ +K +H A ++H DLKP+N +      LK+ DFG++  +     +  R+N
Sbjct: 117 IQYFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRS--REN 174

Query: 631 QIG-------TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY 683
            +G       T  Y APE +++             +     D+WSCGCIL +M+ GKP +
Sbjct: 175 MVGFMTEYVATRWYRAPEIMLSFQ-----------EYTTAMDIWSCGCILAEMISGKPLF 223

Query: 684 GTFQGNNRLYAIM 696
                +++L+ I+
Sbjct: 224 PGRDYHHQLWIIL 236

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 119/245 (48%), Gaps = 18/245 (7%)

Query: 510 SSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFD 568
            ++DG   E+E+L++L N  R+V L  ++      +LLME     DL   +     +  D
Sbjct: 255 GNVDGVTRELEVLRRL-NHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGED 313

Query: 569 TEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG---MLKIIDFGIANAVPDHTVN 625
               R   +++++ V+ +H+  I H DLKP N +  +    ++KI DFG+A  + D+T  
Sbjct: 314 AG--REITRQILEAVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAK-IQDNTT- 369

Query: 626 IYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY-G 684
            +     GT  Y+APE +   N   N      +      D+WS GC++Y ++ G  P+ G
Sbjct: 370 -FMKTFCGTLAYVAPEVIGGKNPEGNGANGNLYS--SLVDMWSIGCLVYVILTGHLPFSG 426

Query: 685 TFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGAL 744
           + Q   +LY  +        P KD + +   R  ID   S L+ NP+ R+T ++ L    
Sbjct: 427 STQ--EQLYKQIANGSYHEGPLKDYWISDEARDFID---SLLQINPVDRLTAERALQHPW 481

Query: 745 INPVT 749
           ++P T
Sbjct: 482 LHPCT 486

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 116/263 (44%), Gaps = 47/263 (17%)

Query: 495  KVYALKRVSFDEFDESSIDGFKGEIELLKKL-----------ENKQRVVKL-IDYHMGQG 542
            +V   K  S DE   S+++  + E+  LK L           ENK  +  L ++Y  G  
Sbjct: 1244 QVEVPKYSSQDEAIISTVEALRSEVSTLKDLDHLNIVQYLGFENKDNIYSLFLEYVAGGS 1303

Query: 543  VLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFV 602
            V  L+   G               FD   +R+   ++++ +  +H   I+H D+K  N +
Sbjct: 1304 VGSLIRMYGR--------------FDEPLIRHLNTQVLRGLAYLHSRGILHRDMKADNLL 1349

Query: 603  FVK-GMLKIIDFGIANAVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKW 658
              + G+ KI DFGI+    D    IY ++ +   GT  +MAPE +         G  AK 
Sbjct: 1350 LDQDGVCKISDFGISRKSKD----IYSNSDMTMRGTVFWMAPEMV-----DTKQGYSAK- 1399

Query: 659  KVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTV 718
                  D+WS GCI+ +M  GK P+  ++    ++ I       P P  D+   +I +  
Sbjct: 1400 -----VDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPP-DTL-PLISQNG 1452

Query: 719  IDTIRSCLERNPISRVTIDQLLS 741
             D + +C E +P +R T D LLS
Sbjct: 1453 RDFLDACFEIDPDNRPTADNLLS 1475

>SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [1569
           bp, 522 aa] {ON} similar to uniprot|P38147 Saccharomyces
           cerevisiae YBR274W CHK1 checkpoint kinase 1 homolog of
           the S. pombe and mammalian Chk1 checkpoint kinases
           Protein kinase Chk1
          Length = 522

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 115/234 (49%), Gaps = 32/234 (13%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           E+ +  +      ++K+ID ++ +  L++ ME  +  DL   +     I  D E  +++F
Sbjct: 65  EVIIHSRCSKHSNILKVIDCNISKDYLWIAMEMADGGDLFDKI--EPDIGVDAEVAQFYF 122

Query: 577 QEMIKCVKVVHD-ADIVHSDLKPANFVFVK-GMLKIIDFGIANAV--PDHTVNIYRDNQI 632
           Q++++ +  +H+   I H D+KP N +  K G LK+ DFG+A+     D T  + RD Q 
Sbjct: 123 QQLLRAIHHLHEVCGIAHRDIKPENILLDKNGNLKLADFGLASQFRRKDGTKRLARD-QR 181

Query: 633 GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY---GTFQGN 689
           G+P YMAPE + +  +               +D+WSCG +++ ++ G+ P+        N
Sbjct: 182 GSPPYMAPEIIYSSEY-----------YADTTDIWSCGILVFVLLTGETPWELPSEDDYN 230

Query: 690 NRLYAIMNPDVKIPYPEKDSFG--TVIPRTVIDTIRSCLERNPISRVTIDQLLS 741
            R +   N ++        SFG    I  T ++ +R  L+ NP  R TI QL S
Sbjct: 231 FREFLEDNGNL--------SFGPWAKIDFTQLNLLRKILQPNPSKRATILQLTS 276

>KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]
           {ON} similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 868

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 114/229 (49%), Gaps = 39/229 (17%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFVRYHF 576
           EI+LLK L++ + +VK   +      LF+L+E C +  L  ++ +    P D +  + + 
Sbjct: 68  EIDLLKNLKH-ENIVKYHGFIQKSHQLFILLEYCSQGSLRDLIKRG---PVDEQECKTYI 123

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTP 635
           ++ +  +K +H+  ++H D+K AN +   + ++K+ DFG++       VN       G+P
Sbjct: 124 RQTLHGLKYLHEQGVIHRDIKAANLLLDAENVVKLADFGVST-----RVNNLAMTYAGSP 178

Query: 636 NYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAI 695
           N+MAPE +V        GE A       SD+WS G  + +++ G PP+         YAI
Sbjct: 179 NWMAPEVMV--------GEGA----STVSDIWSLGATVVEILTGNPPFHNLVNEAACYAI 226

Query: 696 MNPDVKIPYPEKDSFGTVIPRTVIDT----IRSCLERNPISRVTIDQLL 740
           ++ D  IP           P+T+  T    +R+C +++   R + ++LL
Sbjct: 227 VH-DAYIP-----------PKTLSSTCRKFLRACFQKSMFKRPSAEELL 263

>YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}
           HOG1Mitogen-activated protein kinase involved in
           osmoregulation; acts via three independent osmosensors;
           mitophagy-specific regulator; mediates the recruitment
           and activation of RNA Pol II at Hot1p-dependent
           promoters; localization regulated by Ptp2p and Ptp3p
          Length = 435

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 103/215 (47%), Gaps = 23/215 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE  + + + + D E          D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 182 YRAPE--IMLTWQKYDVE---------VDIWSAGCIFAEMIEGKP---LFPGKDHVHQFS 227

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
                +  P KD   T+     +  + S   R+PI
Sbjct: 228 IITDLLGSPPKDVINTICSENTLKFVTSLPHRDPI 262

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 109/250 (43%), Gaps = 51/250 (20%)

Query: 510  SSIDGFKGEIELLKKL-----------ENKQRVVKL-IDYHMGQGVLFLLMECGEHDLSQ 557
            S+++  + E+  LK L           ENK  +  L ++Y  G  V  L+   G      
Sbjct: 1220 STVEALRSEVSTLKDLDHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGR----- 1274

Query: 558  VLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGIA 616
                     FD   +++   +++K +  +H   I+H D+K  N +  + G+ KI DFGI+
Sbjct: 1275 ---------FDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGIS 1325

Query: 617  NAVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCIL 673
                D    IY ++ +   GT  +MAPE +         G  AK       D+WS GCI+
Sbjct: 1326 RKSKD----IYSNSDMTMRGTVFWMAPEMV-----DTKQGYSAK------VDIWSLGCIV 1370

Query: 674  YQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTV--IPRTVIDTIRSCLERNPI 731
             +M  GK P+   +    ++ I       P PE D+   +  + R  +D   +C E NP 
Sbjct: 1371 LEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPE-DTLPLISQVGRGFLD---ACFEINPE 1426

Query: 732  SRVTIDQLLS 741
             R T  +LLS
Sbjct: 1427 KRPTATELLS 1436

>YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middle
           sporulation-specific mitogen-activated protein kinase
           (MAPK) required for production of the outer spore wall
           layers; negatively regulates activity of the glucan
           synthase subunit Gsc2p
          Length = 388

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 119/271 (43%), Gaps = 57/271 (21%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGV----LFLLMECGEHDLSQVLTQRSKIPFDTEF-V 572
           E++ +   +  + +V LID  +        L+   E  ++DL++V+    ++   +EF +
Sbjct: 87  ELKFMNFFKGHKNIVNLIDLEIVTSSPYDGLYCYQELIDYDLAKVIHSSVQL---SEFHI 143

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAV------PDHTVN 625
           +Y   +++  +K +H AD++H DLKP N +  + G LKI DFG+A  +         TV 
Sbjct: 144 KYFLYQILCGLKYIHSADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFKCHSTVQ 203

Query: 626 IYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGT 685
            +  N + T  Y APE L++                K  D+W+ GCIL +    KP    
Sbjct: 204 PHITNYVATRWYRAPELLLSNQ-----------PYSKSVDIWAVGCILAEFYARKP---V 249

Query: 686 FQGNNRLYAIMNPDVKIPYPEKD---SFGTV----------------IPRT--------- 717
           F G + ++ I      +  P+KD    FGT+                IP +         
Sbjct: 250 FMGRDSMHQIFEIIKVLGTPDKDILIKFGTIKAWNLGKNSNNPVYKKIPWSNIFPFASHE 309

Query: 718 VIDTIRSCLERNPISRVTIDQLLSGALINPV 748
            I+ I S L  +   R+ ++Q +S   +N V
Sbjct: 310 AINLIESLLHWDSTHRLNVEQAISHPFLNEV 340

>Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W
           (REAL)
          Length = 527

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 119/232 (51%), Gaps = 31/232 (13%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           E+ L  +      V++LID ++ +  ++++ME  +  DL   +     +  D++  +++F
Sbjct: 65  EVVLQSRCSKHPNVLRLIDCNVSKDYMWIIMEMADGGDLFDKI--EPDVGVDSDVAQFYF 122

Query: 577 QEMIKCVKVVH-DADIVHSDLKPANFVFVK-GMLKIIDFGIANAVP--DHTVNIYRDNQI 632
           Q+++  V  +H    I H D+KP N +  K G LK+ DFG+A+     D T+ +  D Q 
Sbjct: 123 QQLVSAVDYLHVGCGIAHRDIKPENILLDKNGNLKLADFGLASQFKRKDGTLRVSMD-QR 181

Query: 633 GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRL 692
           G+P YMAPE L +      DG  A       +D+WS G +L+ ++ G+ P+        L
Sbjct: 182 GSPPYMAPEVLYS-----EDGYYA-----DRTDIWSIGILLFVLLTGQTPW-------EL 224

Query: 693 YAIMNPDVKIPYPEKDS---FG--TVIPRTVIDTIRSCLERNPISRVTIDQL 739
            ++ N D  + + E D    +G  + I  T ++ +R  L+ +PI RVT+  L
Sbjct: 225 PSLENEDF-VFFIENDGNINWGPWSKIEFTHLNLLRKILQPDPIKRVTLKAL 275

>NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa]
           {ON} 
          Length = 528

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 91/171 (53%), Gaps = 18/171 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           E+ L  K      V++LID ++    ++++ME  +  DL   +     I  D+E  +++F
Sbjct: 65  EVILHSKCSKHPNVLRLIDCNISNAYMWIVMEMADGGDLFDKI--EPDIGVDSEVAQFYF 122

Query: 577 QEMIKCVKVVHD-ADIVHSDLKPANFVFVK-GMLKIIDFGIANAVP--DHTVNIYRDNQI 632
           Q++I+ +  +HD   I H D+KP N +  + G LK+ DFG+A+     D T+ +  D Q 
Sbjct: 123 QQLIRAISYLHDECGIAHRDIKPENILLDRNGNLKLADFGLASQFKRNDGTIRVASD-QR 181

Query: 633 GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY 683
           G+P YMAPE L +       G  A       +D+WS G +L+ ++ G+ P+
Sbjct: 182 GSPAYMAPEILYS-----KGGYYA-----NSTDIWSIGILLFVLLTGEIPW 222

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 110/236 (46%), Gaps = 30/236 (12%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L +    +  L+L++E     +L   L  + K+P + E +
Sbjct: 160 GIEREIVIMK-LISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLP-EREAI 217

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIAN-AVPDHTVNIYRD 629
            Y F+++++ V   H  +I H DLKP N +  K    +KI DFG+A   +P+  +     
Sbjct: 218 HY-FKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKT--- 273

Query: 630 NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
              G+P+Y +PE ++   +            G PSDVWSCG +L+ ++ G  P+      
Sbjct: 274 -SCGSPHYASPEIVMGRPYH-----------GGPSDVWSCGIVLFALLTGHLPFNDDNIK 321

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             L  + +   ++P        + +     D I   L  +P  R+T  ++L   LI
Sbjct: 322 KLLLKVQSGKYQMP--------SNLSSEARDLISKILVIDPEKRITTQEILKHPLI 369

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 101/217 (46%), Gaps = 30/217 (13%)

Query: 531 VVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDA 589
           V+KL      +  L+ L+E   + D   V+ +   +    E  +Y+  +++  +  +H  
Sbjct: 263 VIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTL--SEECTKYYGAQILDAIHHLHKQ 320

Query: 590 DIVHSDLKPANFVFVKGM-LKIIDFGIANAVPD------HTVNIYRDNQIGTPNYMAPET 642
            I+H D+KP N +  K M +K+ DFG A  +        + +N    + +GT  Y++PE 
Sbjct: 321 GIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYVSPEL 380

Query: 643 LVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKI 702
           L       ND       V    D+W+ GCIL+QMV GKPP   F+  N  Y      +++
Sbjct: 381 L-------NDN-----YVDSRCDIWAFGCILFQMVAGKPP---FKATNE-YLTFQKVMRV 424

Query: 703 PYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
            Y    +F    P  + D I+  L + P  R+TI Q+
Sbjct: 425 QY----AFTAGFPMILRDLIKQLLVKKPEQRLTILQI 457

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 109/236 (46%), Gaps = 30/236 (12%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L +    +  L+L++E     +L   L  + K+P + E +
Sbjct: 160 GIEREIVIMK-LISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLP-EREAI 217

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIAN-AVPDHTVNIYRD 629
            Y F+++++ V   H  +I H DLKP N +  K    +KI DFG+A   +P+  +     
Sbjct: 218 HY-FKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKT--- 273

Query: 630 NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
              G+P+Y +PE ++   +            G PSDVWSCG +L+ ++ G  P+      
Sbjct: 274 -SCGSPHYASPEIVMGRPYH-----------GGPSDVWSCGIVLFALLTGHLPFNDDNIK 321

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             L  + +   ++P          +     D I   L  +P  R+T  ++L   LI
Sbjct: 322 KLLLKVQSGKYQMPMN--------LSAEARDLISKILVIDPAKRITTQEILKHPLI 369

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 114/253 (45%), Gaps = 31/253 (12%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +V A+K + ++  +E  ++    EI LLK L N   +VK   +      L++L+E C   
Sbjct: 49  QVVAIKEIVYESDEE--LNDIMAEISLLKNL-NHDNIVKYHGFIRKSYELYILLEYCANG 105

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIID 612
            L +++++ S    + E   Y  Q ++  +K +H   ++H D+K AN +      +K+ D
Sbjct: 106 SLRRLISRSSTGLSENESKSYVTQTLLG-LKYLHGEGVIHRDIKAANILLSADNTVKLAD 164

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG++  V    + +      GT N+MAPE L       N G          SD+WS G  
Sbjct: 165 FGVSTIVNSSALTL-----AGTLNWMAPEIL------GNRGASTL------SDIWSLGAT 207

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
           + +M+   PPY      N  YA+ N      Y    SF      ++ D +  C  +N   
Sbjct: 208 VVEMLTKNPPYHNLTDANIYYAVEND----TYYPPSSFS----ESLKDFLSKCFVKNMYK 259

Query: 733 RVTIDQLLSGALI 745
           R T DQLL  A I
Sbjct: 260 RPTADQLLKHAWI 272

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 110/239 (46%), Gaps = 30/239 (12%)

Query: 529 QRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVH 587
           + +V  ID ++ +G L+++ME  E   L+ V+T           +    +E +  +  +H
Sbjct: 733 ENIVNFIDSYLMKGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGTVCKETLGGLAFLH 789

Query: 588 DADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAM 646
              ++H D+K  N +  + G +K+ DFG    +  + V++ R   +GTP +MAPE +   
Sbjct: 790 SKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI--NEVHLKRTTMVGTPYWMAPEVV--- 844

Query: 647 NFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM---NPDVKIP 703
                    ++ + G   D+WS G ++ +M+ G+PPY        LY I     P +K P
Sbjct: 845 ---------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPQLKDP 895

Query: 704 YPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNA 762
               ++ G ++ +     +  CL  NP  R T  +LLS   I      K  +  L+K A
Sbjct: 896 ----ENLGEILKK----FLDWCLTVNPEERATALELLSHPFITDHADEKISLSPLVKLA 946

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 119/251 (47%), Gaps = 21/251 (8%)

Query: 493 DHKVYALKRVSFDEF-DESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECG 551
           D KV+A K V+      E + +    EI++ K + + Q +V  ID       +++L+E  
Sbjct: 119 DGKVFAAKTVAKISIKSEKARNKLLSEIQIHKNMRH-QNIVHFIDCFEDDINVYILLEIC 177

Query: 552 EHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKI 610
            +     L +R KI  + E VR+   ++   +  +H  +I+H DLK  N  F K   LKI
Sbjct: 178 PNGSLMDLLKRRKILTEPE-VRFFTTQICGALDHMHSRNIIHRDLKLGNIFFDKDFNLKI 236

Query: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
            DFG+A  + +     Y     GTPNY+APE ++        G+Q         D+WS G
Sbjct: 237 GDFGLAAIINNENERKY--TICGTPNYIAPEVIMG-------GKQIGHSF--EVDIWSLG 285

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNP 730
            +++ M+ GKPP+   + +     I + +   P    D +   + + V   I+  L  NP
Sbjct: 286 VMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFP---TDKY---VSKDVKKLIQDILSMNP 339

Query: 731 ISRVTIDQLLS 741
           + R TI ++L+
Sbjct: 340 MERPTIQEILN 350

>Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}
           similar to Ashbya gossypii ADL315C
          Length = 437

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 114/259 (44%), Gaps = 56/259 (21%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQ----GVLFLLMECGEHDLSQVLTQRSKIPFDTEFVR 573
           E++ +   +  + +V LI+  +        L+   E  ++DL++V+   S + F +EF  
Sbjct: 126 ELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARVI--HSNVQF-SEFHI 182

Query: 574 YHFQEMIKC-VKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQ 631
            HF   I C VK +H AD++H DLKP N +  + G LKI DFG+A  +     N    N 
Sbjct: 183 KHFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTKTSNH 242

Query: 632 I----GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQ 687
           I     T  Y APE +++             +  K  D+W+ GCIL +  YG+ P    Q
Sbjct: 243 ITNYVATRWYRAPELILSHK-----------RYNKSIDMWAIGCILAEF-YGRKPIFMGQ 290

Query: 688 ------------------------GNNRLYAIMNPD----VKIPYPEKDSFGTVIPRTVI 719
                                   G++R Y I  P      KIP+ E  SF +      +
Sbjct: 291 DSMHQISEIVKVLGTPSRDTIIKYGSSRAYDIFCPPKPQYAKIPWIEIYSFAS---GEAL 347

Query: 720 DTIRSCLERNPISRVTIDQ 738
           D I   L+ +P  R+T+++
Sbjct: 348 DLIERLLDWDPDRRLTVEE 366

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 107/234 (45%), Gaps = 38/234 (16%)

Query: 521 LLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           L+ K      +V  ID ++ +G L+++ME  E   L+ V+T           +    +E 
Sbjct: 713 LVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVSRET 769

Query: 580 IKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYM 638
           +K ++ +H   ++H D+K  N +  + G +K+ DFG    +  + +N+ R   +GTP +M
Sbjct: 770 LKGLQFLHSKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWM 827

Query: 639 APETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM-- 696
           APE +            ++ + G   D+WS G ++ +M+ G+PPY        LY I   
Sbjct: 828 APEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATN 875

Query: 697 -NPDVKIPYPEKDSFGTVIPRTVIDTIRS----CLERNPISRVTIDQLLSGALI 745
             P++K    + DS          D ++     CL  +P  R T  +LLS   I
Sbjct: 876 GTPELK----DADSLS--------DDLKGFLGWCLHVDPDERATASELLSDPFI 917

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 134/283 (47%), Gaps = 28/283 (9%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           K +A+K +S  +   S++DG   E+E+L++L++  R+V+L  ++      ++LME     
Sbjct: 226 KTFAVKIISKRKVMGSNMDGVSRELEVLQRLDHP-RIVRLKGFYEDHENYYMLMEFVSGG 284

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG---MLKI 610
           DL   +     +  D    R   +++++ +K +H   I H DLKP N +  +    ++KI
Sbjct: 285 DLMDFVAAHGAVGEDAG--REISRQILEAIKYIHSMGISHRDLKPDNILIEQDDPVLVKI 342

Query: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGE--------QAKWKVGK 662
            DFG+A    + T   +     GT  Y+APE +      +NDGE          + +   
Sbjct: 343 TDFGLAKVQDNGT---FMKTFCGTLAYVAPEIISG----KNDGELRENADANSERNEYSS 395

Query: 663 PSDVWSCGCILYQMVYGKPPY-GTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDT 721
             D+WS GC++Y ++ G  P+ G+ Q   +LY  ++       P KD     I     D 
Sbjct: 396 LVDMWSMGCLVYVILTGHLPFSGSTQ--KQLYKQISRGSYHEGPLKD---FRISDEARDF 450

Query: 722 IRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVN 764
           I S L+  P  R+T ++ L    I     ++ F+ +   N+VN
Sbjct: 451 IDSLLQVKPNDRLTAEKALEHPWIKMAQFSQSFVKNNSVNSVN 493

>KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3.92
           YDR490C
          Length = 1095

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 107/236 (45%), Gaps = 36/236 (15%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           E   L+++ +   VV+L      +  L+ L+E   + D   ++ +   +  D    +Y+ 
Sbjct: 195 EKNALQRVNDSPMVVRLFFTFQDEASLYFLLEFAPNGDFLSLMKKFGSLNEDA--AKYYS 252

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAV------------PDHT 623
            ++I  +  +H   IVH D+KP N +  K   +KI DFG A  +            P++ 
Sbjct: 253 AQIIDAIGFLHSRGIVHRDMKPENILLDKNWKIKITDFGTAKILEKTAQQEAGGSGPEYN 312

Query: 624 VNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY 683
           +     + +GT  Y++PE L       ND       V    D+W+ GCI+YQM+ GKPP 
Sbjct: 313 LLTRSKSFVGTAEYVSPELL-------NDSF-----VDYRCDIWAFGCIVYQMLAGKPP- 359

Query: 684 GTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
             F+  N  Y      +K+ Y    +F    P  + D ++  L ++   R+T+ Q+
Sbjct: 360 --FKATNE-YLTFQKVMKVQY----AFTAGFPLVIRDLVKRILVKDLDKRLTVQQI 408

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 108/249 (43%), Gaps = 49/249 (19%)

Query: 510  SSIDGFKGEIELLKKL-----------ENKQRVVKL-IDYHMGQGVLFLLMECGEHDLSQ 557
            S+++  + E+  LK L           ENK  +  L ++Y  G  V  L+   G      
Sbjct: 1226 STVEALRSEVSTLKDLDHLNIVQYLGFENKNSIYSLFLEYVAGGSVGSLIRMYGR----- 1280

Query: 558  VLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKIIDFGIA 616
                     FD   +++   ++++ +  +H   I+H D+K  N +  + G+ KI DFGI+
Sbjct: 1281 ---------FDESLIKHLTTQVLRGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGIS 1331

Query: 617  NAVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCIL 673
                D    IY ++ +   GT  +MAPE +         G  AK       D+WS GCI+
Sbjct: 1332 RKSKD----IYSNSDMTMRGTVFWMAPEMV-----DTKQGYSAK------VDIWSLGCIV 1376

Query: 674  YQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKD-SFGTVIPRTVIDTIRSCLERNPIS 732
             +M  GK P+   +    ++ I       P PE      T + R+ +D   +C E +P  
Sbjct: 1377 LEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLITRVGRSFLD---ACFEIDPEK 1433

Query: 733  RVTIDQLLS 741
            R T  +LLS
Sbjct: 1434 RPTATKLLS 1442

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 112/236 (47%), Gaps = 30/236 (12%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   V+ L +    +  L+L++E     +L   L  R K+P + E +
Sbjct: 160 GIEREIVIMK-LISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSRGKLP-EREAI 217

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIAN-AVPDHTVNIYRD 629
            Y F+++++ V   H  +I H DLKP N +  K    +KI DFG+A   +P+  +     
Sbjct: 218 HY-FKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIKIADFGMAALELPNKLLKT--- 273

Query: 630 NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGN 689
              G+P+Y +PE ++   +            G PSDVWSCG +L+ ++ G  P+      
Sbjct: 274 -SCGSPHYASPEIVMGRPYH-----------GGPSDVWSCGIVLFALLTGHLPFNDDNIK 321

Query: 690 NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
             L  + +   ++P        ++  R +I  I   L  +P  R+T  ++L   LI
Sbjct: 322 KLLLKVQSGKYQMPM-----NLSLEARNLISKI---LVIDPEKRITTQEILEHPLI 369

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 80/165 (48%), Gaps = 28/165 (16%)

Query: 576  FQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGT 634
            F +++  +K +HD  IVH D+K  N +   +G +K+IDFG A  V     +++    +GT
Sbjct: 1152 FMQVVSSIKFLHDQGIVHRDIKDENVIVDSQGFIKLIDFGSAAYVKSGPFDVF----VGT 1207

Query: 635  PNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYA 694
             +Y APE L         GE     VGKP D+W+ G +LY +++ + P+           
Sbjct: 1208 IDYAAPEVL--------GGEPY---VGKPQDIWAIGILLYTIIFKENPF----------- 1245

Query: 695  IMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQL 739
              N D  +    K +  T      +D I+  L RNP  R TID++
Sbjct: 1246 -YNIDEILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {ON}
           uniprot|O93982 Zygosaccharomyces rouxii HOG1 Mitogen-
           activated protein kinase HOG1
          Length = 431

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 103/215 (47%), Gaps = 23/215 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE  + + + + D E          D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 182 YRAPE--IMLTWQKYDVE---------VDIWSAGCIFSEMIEGKP---LFPGKDHVHQFS 227

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
                +  P +D   T+     +  + S   R+P+
Sbjct: 228 IITDLLGSPPRDVINTICSENTLKFVTSLPHRDPV 262

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 105/229 (45%), Gaps = 26/229 (11%)

Query: 521 LLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHFQEM 579
           ++ KL +   V+ L D       L+L++E  E  +L  +L  R  +P + E V+  F+++
Sbjct: 71  VVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLP-EKEAVKC-FRQI 128

Query: 580 IKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPNYM 638
           I  +   H   IVH DLKP N +      +KI DFG+A    D  +    +   G+P+Y 
Sbjct: 129 IIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARL---LETSCGSPHYA 185

Query: 639 APETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNR--LYAIM 696
           APE +  + +            G  SDVWSCG IL+ ++ G+ P+    GN R  L  + 
Sbjct: 186 APEIVSGLPYR-----------GFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQ 234

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
               ++P        T I +   + I   L  +P  R+    +L+  L+
Sbjct: 235 RGQFEMPD------ATEISKDAQNLISRILVVDPTQRMKTRDILTHPLL 277

>TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {ON}
           Anc_8.302 YLR113W
          Length = 481

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 102/215 (47%), Gaps = 23/215 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++L+K L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLMKHLTHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE  + + + + D E          D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 182 YRAPE--IMLTWQKYDTE---------VDIWSAGCIFVEMIEGKP---LFPGKDHVHQFS 227

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
                +  P  D   T+     +  + S   RNP+
Sbjct: 228 IITDLLGSPPPDVINTICSENTLKFVTSLPHRNPV 262

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 115/260 (44%), Gaps = 31/260 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +V A+K + ++  +E  ++    EI LLK L N   +VK   +      L++L+E C   
Sbjct: 49  QVVAIKEIVYENDEE--LNDIMAEISLLKNL-NHHNIVKYHGFIRKSYELYILLEYCANG 105

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIID 612
            L +++++ S    + E   Y  Q ++  +K +H   ++H D+K AN +      +K+ D
Sbjct: 106 SLRRLISRSSTGLSENESKTYVTQTLLG-LKYLHGEGVIHRDIKAANILLSADNTVKLAD 164

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG++  V    + +      GT N+MAPE L       N G          SD+WS G  
Sbjct: 165 FGVSTIVNSSALTL-----AGTLNWMAPEIL------GNRGASTL------SDIWSLGAT 207

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
           + +M+   PPY      N  YA+ N      Y    SF      ++ D +  C  +N   
Sbjct: 208 VVEMLTKNPPYHNLTDANIYYAVEND----TYYPPSSFS----ESLKDFLSKCFVKNMYK 259

Query: 733 RVTIDQLLSGALINPVTVTK 752
           R T DQLL    I     TK
Sbjct: 260 RPTADQLLKHVWITSTESTK 279

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 114/230 (49%), Gaps = 36/230 (15%)

Query: 518  EIELLKKLENK--QRVVKLIDYHMGQGVLF----LLMECGEHDLSQVLTQRSKIPFDTEF 571
            EI+++  L     + +++L+D+       +    L  E G  DL  ++  +S +  ++E 
Sbjct: 1160 EIQIMTTLNKSPHENIMQLLDFFEDDDYYYIETPLHGETGCIDLFDLIEFKSNMT-ESE- 1217

Query: 572  VRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDN 630
             R  F +++  +K +HD++IVH D+K  N +   KG +K+IDFG A  V     +++   
Sbjct: 1218 ARLIFIQVVLGIKHLHDSNIVHRDVKDENVIVDAKGFVKLIDFGSAAYVNSGPFDVF--- 1274

Query: 631  QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             +GT +Y APE L         GE     +GKP D+W+ G +LY +++ + P+       
Sbjct: 1275 -VGTIDYAAPEVL--------SGEPY---LGKPQDIWAIGILLYTIMFKENPFYNID--- 1319

Query: 691  RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLL 740
                I+  ++KI      S      +  ID I+  L +NP  R TID+++
Sbjct: 1320 ---EILEAELKINNTSDAS------QDCIDLIKRILTKNPNKRPTIDEIV 1360

>SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P32485 Saccharomyces
           cerevisiae YLR113W HOG1 Mitogen-activated protein kinase
           involved in osmoregulation via three independent
           osmosensors mediates the recruitment and activation of
           RNA Pol II at Hot1p-dependent promoters localization
           regulated by Ptp2p and Ptp3p
          Length = 434

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 100/216 (46%), Gaps = 23/216 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE ++              K     D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 182 YRAPEIMLTWQ-----------KYNVEVDIWSAGCIFAEMIEGKP---LFPGKDHVHQFS 227

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
                +  P +D   T+     +  + S   R P+S
Sbjct: 228 IITDLLGSPPEDVINTICSENTLKFVTSLPHREPVS 263

>ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {ON}
           similar to uniprot|P38147 Saccharomyces cerevisiae
           YBR274W CHK1 checkpoint kinase 1
          Length = 516

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 114/229 (49%), Gaps = 30/229 (13%)

Query: 517 GEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYH 575
           GE+ L  K      V+K+ID ++    L++ ME  +  DL   +     +  D+E  +++
Sbjct: 60  GEVILQSKCCKHHNVLKVIDCNIAHDYLWIAMEMADGGDLFDKI--EPDVGVDSEVAQFY 117

Query: 576 FQEMIKCVKVVH-DADIVHSDLKPANFVFVK-GMLKIIDFGIANAV--PDHTVNIYRDNQ 631
           FQ+++  V  +H D  + H D+KP N +  K G LK+ DFG+A+     D +  +  D Q
Sbjct: 118 FQQLVSAVSYLHEDCGVAHRDIKPENLLLDKNGNLKLADFGLASKFRRKDGSKRLCYD-Q 176

Query: 632 IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYG--TFQGN 689
            G+P YMAPE L    +  +            +D+WS G +++ ++ G+ P+    F+  
Sbjct: 177 RGSPQYMAPEILHYDEYYAD-----------VTDIWSIGVLVFVILTGELPWDLPVFEDE 225

Query: 690 N-RLYAIMNPDVKI-PYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTI 736
           N R +   N  + + P+ + D        T ++ +R  L+ NP+ RVT+
Sbjct: 226 NFRCFMENNGKLNVGPWAKIDF-------THLNLLRKLLQPNPLERVTL 267

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 111/265 (41%), Gaps = 30/265 (11%)

Query: 495 KVYALKRVSFDEFDESSIDGFK--GEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGE 552
           K  A+K +  D   + S    K   EI  LK L +   +VKL +       + +++E   
Sbjct: 103 KQVAIKLIKRDAISKDSSKELKIYREINALKHLSHPN-IVKLEEVLQNSRYIGIVLEYAS 161

Query: 553 HDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKII 611
                   QR K   +T   R  F ++I  V  +H   +VH DLK  N +  K   L I 
Sbjct: 162 GGEFYRYIQRKKRLKETAACRL-FAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVIT 220

Query: 612 DFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGC 671
           DFG  N    H  N       G+P Y APE +++           K    + +D+WSCG 
Sbjct: 221 DFGFVNEFYSH--NELMKTSCGSPCYAAPELVIS----------TKPYEARKADIWSCGI 268

Query: 672 ILYQMVYGKPPYGTFQGN------NRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSC 725
           ILY M+ G  P+    GN      +RLY  +    K P    D +   IPR   D +R  
Sbjct: 269 ILYAMLAGYLPWDDDSGNPDGDDISRLYYYI---TKTPLKFPD-YINPIPR---DLLRKI 321

Query: 726 LERNPISRVTIDQLLSGALINPVTV 750
           L  +P  R+T+ Q+     + P T 
Sbjct: 322 LVSDPRRRITMKQIEKHEWLKPHTA 346

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 137/307 (44%), Gaps = 40/307 (13%)

Query: 493 DHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CG 551
           + KV A+K V+ +  DE  I+    EI  L +L++   +   I        ++++ME CG
Sbjct: 37  ESKVVAIKIVNLENTDED-IELLTQEIFFLSELKS-PFITNYITTLTEDVTMWIVMEYCG 94

Query: 552 EHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKI 610
               + ++            V Y  ++ +K +K +HD   +H D+K AN +    G +K+
Sbjct: 95  GGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKKIHRDIKAANILLTDCGKVKL 154

Query: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
            DFG++  +      + R   +GTP +MAPE +          +Q K    + +D+WS G
Sbjct: 155 GDFGVSGQI---RATMKRGTFVGTPYWMAPEVI---------NKQCK-GYNEKADIWSLG 201

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIP-----YPEKDSFGTVIPRTVIDTIRSC 725
              Y+++ G PP   +     +  I  P  K P     Y EK  +           +  C
Sbjct: 202 ITAYELLKGVPPLSKYDPFKVMLNI--PKRKPPKLHGQYSEKAKY----------FVSLC 249

Query: 726 LERNPISRVTIDQLLSGALINPVTVTKFFIH-DLIKNAV---NYGCDQKHVNNERVEELS 781
           L ++P  R +I+ LL    + P TV       DLIK+     NY    K+  N+++ + S
Sbjct: 250 LIKDPKQRPSIEALLETDFLLPNTVLNLKEDVDLIKSIKLKNNYSKTPKYQLNQKIYDGS 309

Query: 782 EDV--WN 786
           E++  WN
Sbjct: 310 ENIMSWN 316

>Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C
           (CDC15) - protein kinase domain [contig 43] FULL
          Length = 868

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 111/226 (49%), Gaps = 31/226 (13%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFVRYHF 576
           EI+LLK L++ + +VK   +      LF+L+E C +  L  ++ +    P + +  + + 
Sbjct: 68  EIDLLKNLKH-ENIVKYHGFIQKSHQLFILLEYCSQGSLRDLIKRG---PVEEQQCKTYI 123

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTP 635
           ++ +  +K +HD  ++H D+K AN +   + ++K+ DFG++       VN       G+P
Sbjct: 124 RQTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGVST-----RVNNLAMTYAGSP 178

Query: 636 NYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAI 695
           N+MAPE ++        G+ A       SD+WS G  + +++ G PP+         YAI
Sbjct: 179 NWMAPEVMM--------GQGA----STVSDIWSLGATVVEILTGNPPFHNLVNEAACYAI 226

Query: 696 MNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLS 741
           ++ DV IP        + +  +    +RSC ++N   R     LLS
Sbjct: 227 VH-DVYIP-------PSTLSSSCRKFLRSCFQKNMFKRPKAQDLLS 264

>Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {ON}
           YKL161C (REAL)
          Length = 508

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 145/328 (44%), Gaps = 53/328 (16%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHM---GQGVL---FLLMECG 551
           A+K++    F+E S      E++LL+       ++ L D  +     GVL   +L  E  
Sbjct: 52  AIKKIPSAFFNERSCKRTLRELKLLRHFRGHPNIIWLFDTDIVFYPSGVLNGVYLYEELM 111

Query: 552 EHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKI 610
           E DLSQ+L     +  D+ +  + +Q +   +K +H A ++H DLKP N +      LK+
Sbjct: 112 ECDLSQILRSGQHLE-DSHYQSFIYQTLCA-LKYIHSAGVLHGDLKPKNLLVNSDCQLKV 169

Query: 611 IDFGIANAVPD--HTVNIYRDNQIGTPNYMAPETLVA-MNFTRNDGEQAKWKVGKPSDVW 667
            +FG++    +     N +    + +  Y+APE +++   +T            K  DVW
Sbjct: 170 CNFGLSRGCSEDYEENNHFTTEFVASRCYIAPEIMLSHQGYT------------KAVDVW 217

Query: 668 SCGCILYQMVYGKPPYG----TFQGNNRLYAIMNPD----------------VKIPYPEK 707
           S GCIL +++ GKP +       Q NN L  +  P                 +   +   
Sbjct: 218 STGCILAELLGGKPLFDGKDYVDQLNNILQILGTPSKEMLQEIGSQKIQSYILLFGHIPG 277

Query: 708 DSFGTVIPRT---VIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVN 764
             F +++P+     +D ++  LE +P  R+ +D+    AL +P       I D       
Sbjct: 278 TPFESILPKANPKGLDLLKKMLEFDPKQRIVVDE----ALKHPFLSVWHDIDDEPSCEKT 333

Query: 765 YGCDQKHVNNERVEELSEDVWNKLAEFK 792
           +  + +H++N  +EEL   V  ++++FK
Sbjct: 334 FAFEFEHISN--MEELQSQVTREVSDFK 359

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 111/236 (47%), Gaps = 25/236 (10%)

Query: 511  SIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDT 569
            +++  + E+  LK L++   +V+ + +     +  L +E  G   +  ++    +  FD 
Sbjct: 1321 TVEALRSEVSTLKDLDHLN-IVQYLGFENDHDIYSLFLEYVGGGSVGSLIRLYGR--FDE 1377

Query: 570  EFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYR 628
              +R+   ++++ +  +H   I+H D+K  N +  + G+ KI DFGI+    D    IY 
Sbjct: 1378 ALIRFLTVQVLEGLAYLHSKGILHRDMKADNLLLDLDGVCKISDFGISRKSKD----IYS 1433

Query: 629  DNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGT 685
            ++ +   GT  +MAPE +         G  AK       D+WS GC++ +M  GK P+  
Sbjct: 1434 NSDMTMRGTVFWMAPEMV-----DTKQGYSAK------VDIWSLGCVVLEMFAGKRPWSN 1482

Query: 686  FQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLS 741
             +    ++ I       P PE D+   +I +     + +C E +P  R T D+LLS
Sbjct: 1483 LEVVAAMFKIGKNKSAPPIPE-DTL-PLISQDGRQFLNACFEIDPDLRPTADKLLS 1536

>KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] {ON}
            similar to uniprot|P53599 Saccharomyces cerevisiae
            YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
            kinase kinase kinase activator of Pbs2p
          Length = 1523

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 116/239 (48%), Gaps = 29/239 (12%)

Query: 514  GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
              K E+ +L+ L N   VV+     + +  + L ME C    L+Q+L +  +I  D    
Sbjct: 1278 AIKEEMSVLEML-NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLL-EHGRIE-DEMVT 1334

Query: 573  RYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRD-- 629
            + +  +M++ +  +H + +VH D+KP N +    G++K +DFG A ++  +   +  +  
Sbjct: 1335 QVYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKVANNGS 1394

Query: 630  --------NQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKP 681
                    + +GTP YM+PE++             K K G  SD+WS GC++ +M  G+ 
Sbjct: 1395 EGKTDGVNSMMGTPMYMSPESVTGAK---------KGKFGS-SDIWSLGCVILEMATGRR 1444

Query: 682  PYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLL 740
            P+  F  +N  +AIM        P+  S   + P+   D +  CL+++P  R T  +LL
Sbjct: 1445 PW--FNLDNE-WAIMYHVAAGHVPQLPSRDEISPQGT-DFLLKCLKQDPDKRATAMELL 1499

>KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]
           {ON} highly similar to uniprot|P14681 Saccharomyces
           cerevisiae YGR040W KSS1 Mitogen-activated protein kinase
           (MAPK) involved in signal transduction pathways that
           control filamentous growth and pheromone response
          Length = 365

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 95/192 (49%), Gaps = 27/192 (14%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGV-----LFLLMECGEHDLSQVLTQRSKIPFDTEFV 572
           E++LLK   + + ++ ++D      +     ++L+ E  E DL +V++         + +
Sbjct: 59  ELKLLKLFHSHENIISVLDVVRPTSMDKFQAVYLVQELMETDLHKVISGGGS-SLSDDHI 117

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQ 631
           +Y   ++++ +K +H A ++H D+KP+N +      LK+ DFG+A  +   T +  R N 
Sbjct: 118 QYFTYQILRALKAIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSTHS--RQNL 175

Query: 632 IG-------TPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYG 684
           +G       T  Y APE ++              +     D+WSCGCIL +M+ GKP + 
Sbjct: 176 VGFMTEYVATRWYRAPEIMLTFQ-----------QYTTAMDIWSCGCILAEMITGKPLFP 224

Query: 685 TFQGNNRLYAIM 696
               +++L+ I+
Sbjct: 225 GRDYHHQLWLIL 236

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 109/227 (48%), Gaps = 27/227 (11%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFVRYHF 576
           EI++ K + +   +V+ ID       +++L+E C    L ++L +R K+  + E VR+  
Sbjct: 129 EIQIHKSMSHPN-IVQFIDCFEDDSNVYILLEICPNGSLMELL-KRRKVLTEPE-VRFFT 185

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTP 635
            ++   +K +H   ++H DLK  N  F     LKI DFG+A  + + +   Y     GTP
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTP 243

Query: 636 NYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAI 695
           NY+APE L+     ++ G   +       D+WS G +LY ++ GKPP+     N     I
Sbjct: 244 NYIAPEVLMG----KHSGHSFE------VDIWSLGVMLYALLIGKPPFQARDVNTIYERI 293

Query: 696 MNPDVKIPY--PEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLL 740
              D   P   P  D  G ++       IR  L  +PI R ++ +++
Sbjct: 294 KCRDFSFPRDKPISDE-GKIL-------IRDILSLDPIERPSLTEIM 332

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 120/253 (47%), Gaps = 33/253 (13%)

Query: 498 ALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLS 556
           A+K+++F++  +  +     EI L+ K    + +V  ID +   G L+++ME      L+
Sbjct: 592 AIKKMNFEKQPKKEL--IVNEI-LVMKASRHENIVNFIDSYFLNGNLWVIMEYMKGGSLT 648

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGI 615
            V+T         + +    +E +  ++ +H   ++H D+K  N +  + G +K+ DFG 
Sbjct: 649 DVVTH---CILTEQQISTVTRETLNGLRFLHSKGVIHRDIKSDNVLLSLSGDIKLTDFGF 705

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQ 675
              +  + +N+ R   +GTP +MAPE +            ++ + G   D+WS G ++ +
Sbjct: 706 CAQI--NEINLKRTTMVGTPYWMAPEVV------------SRKEYGPKVDIWSLGIMIIE 751

Query: 676 MVYGKPPYGTFQGNNRLYAIM---NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
           M+ G+PPY        LY I     P++K P    DS    + +  +D    CL+ +P  
Sbjct: 752 MIEGEPPYLNETPLRALYLIATNGTPELKDP----DSLSECL-KAFLDW---CLKVDPHE 803

Query: 733 RVTIDQLLSGALI 745
           R +  +LL+   I
Sbjct: 804 RASATELLNDRFI 816

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 113/254 (44%), Gaps = 31/254 (12%)

Query: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEH 553
           +V A+K V ++  +E  ++    EI LLK L N   +VK   +      L++L+E C   
Sbjct: 49  QVVAIKEVVYENDEE--LNDIMAEISLLKNL-NHNNIVKYHGFIRKSYELYILLEYCANG 105

Query: 554 DLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIID 612
            L +++++ S    + E   Y  Q ++  +K +H   ++H D+K AN +      +K+ D
Sbjct: 106 SLRRLISRSSTGLSENESKTYVTQTLLG-LKYLHGEGVIHRDIKAANILLSADNTVKLAD 164

Query: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672
           FG++  V    + +      GT N+MAPE L       N G          SD+WS G  
Sbjct: 165 FGVSTIVNSSALTL-----AGTLNWMAPEIL------GNRGASTL------SDIWSLGAT 207

Query: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
           + +M+   PPY      N  YA+ N      Y    SF   +     D +  C  +N   
Sbjct: 208 VVEMLTKNPPYHNLTDANIYYAVEND----TYYPPSSFSEPLK----DFLSKCFVKNMYK 259

Query: 733 RVTIDQLLSGALIN 746
           R T DQLL    IN
Sbjct: 260 RPTADQLLKHVWIN 273

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 105/235 (44%), Gaps = 28/235 (11%)

Query: 514 GFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFV 572
           G + EI ++K L +   ++ L +    +  L+L++E     +L   L  R K+  + E V
Sbjct: 188 GIEREIVIMK-LISHSNILGLYEVWENKSELYLVLEYVDGGELFDYLVSRGKL-GEREAV 245

Query: 573 RYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG--MLKIIDFGIANAVPDHTVNIYRDN 630
            Y F+++++ V   H  +I H DLKP N +  K    +KI DFG+A        N     
Sbjct: 246 HY-FKQIVQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAAL---EVSNKLLQT 301

Query: 631 QIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNN 690
             G+P+Y +PE ++   +            G PSDVWSCG IL+ ++ G  P+       
Sbjct: 302 SCGSPHYASPEIVMGRPYH-----------GGPSDVWSCGIILFALLTGHLPFNDDNIKK 350

Query: 691 RLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745
            L  + +    +P          +     D +   L  NP  R+  +++L+  L+
Sbjct: 351 LLLKVQSGKFHMPQ--------NLSAEAKDLMSKILVVNPFKRIATEEILNHPLL 397

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 116/250 (46%), Gaps = 31/250 (12%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           EI ++K  +++  +V  ID ++ +G L+++ME  E   L+ V+T           +    
Sbjct: 700 EIMVMKGSKHR-NIVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVC 755

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTP 635
           +E +  ++ +H   ++H D+K  N +  + G +K+ DFG    +  + +N+ R   +GTP
Sbjct: 756 RETLAGLQFLHSKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQI--NEINLKRTTMVGTP 813

Query: 636 NYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAI 695
            +MAPE +            ++ + G   D+WS G ++ +M+ G+PPY        LY I
Sbjct: 814 YWMAPEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 861

Query: 696 M---NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTK 752
                P +K P    D+ G  + +  +D    CL   P  R +  QLL    +  V    
Sbjct: 862 ATNGTPKLKEP----DNLGEEL-QNFLDW---CLTVEPDQRASSSQLLKDPFVTQVAEEN 913

Query: 753 FFIHDLIKNA 762
             +  L+K A
Sbjct: 914 SSLAPLVKLA 923

>NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {ON}
           Anc_8.302
          Length = 447

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 111/255 (43%), Gaps = 45/255 (17%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLLKHLTHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY------------- 683
           Y APE  + + + + D E          D+WS GCI  +M+ GKP +             
Sbjct: 182 YRAPE--IMLTWQKYDVE---------VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIIT 230

Query: 684 -----------GTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732
                       T    N L  + +   + P P    F TV P  V D +   L   P  
Sbjct: 231 DLLGSPPADVINTIGSENTLKFVTSLPHRDPIPFSQRFKTVEPDAV-DLLEKMLVFEPKK 289

Query: 733 RVTIDQLLSGALINP 747
           RVT  Q L+   + P
Sbjct: 290 RVTAAQALTHPYLAP 304

>Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {ON}
           YKL166C (REAL)
          Length = 397

 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 94/213 (44%), Gaps = 34/213 (15%)

Query: 494 HKVYALKRVSF--DEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECG 551
           H V  LK+V    DE    SI      I +    ++ Q+V  ++DY  G G LF L+   
Sbjct: 121 HTVVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYVEG-GELFSLL--- 176

Query: 552 EHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKI 610
                     R    F     +++  E+   ++ +H  DI++ DLKP N +  K G +KI
Sbjct: 177 ----------RKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKI 226

Query: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
            DFG A  VPD T  +      GTP+Y+APE +    +             K  D WS G
Sbjct: 227 TDFGFAKYVPDVTYTL-----CGTPDYIAPEVVSTKPY------------NKSVDWWSFG 269

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIP 703
            ++Y+M+ G  P+           I+N ++K P
Sbjct: 270 VLIYEMLAGYTPFYNSNTMKTYENILNAELKFP 302

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 115/254 (45%), Gaps = 25/254 (9%)

Query: 494 HKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGE 552
           ++V A+K ++ D  D+  ++  + E++ L  L+    +      ++    L+++ME C  
Sbjct: 42  NRVCAIKVLNLDSADDE-VEDVQKEVQFLSSLKQVPNITHYYGSYLNNTELWVIMEYCAG 100

Query: 553 HDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKII 611
             L + L +  KI    +++    +E++  +  +H   ++H D+K AN +    G +K+ 
Sbjct: 101 GSL-RTLLRPGKI--GEQYIGVIMRELLIALMHIHKDGVIHRDIKAANVLITNDGHIKLC 157

Query: 612 DFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGC 671
           DFG+A  +      I R    GTP +MAPE ++       +G     KV    D+WS G 
Sbjct: 158 DFGVAAQL--SQTKIRRQTMAGTPYWMAPEVIM-------EGVYYDTKV----DIWSLGI 204

Query: 672 ILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
             Y++  G PPY   +    +  I     K P  E     + +     + I  CL+ +P 
Sbjct: 205 TAYEIATGNPPYCDVEALRAMQLITK--SKPPRLEGRQHSSALK----EFIALCLDEDPK 258

Query: 732 SRVTIDQLLSGALI 745
            R + ++LL    I
Sbjct: 259 ERPSAEELLKTKFI 272

>KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P32485 Saccharomyces cerevisiae
           YLR113W HOG1 Mitogen-activated protein kinase involved
           in osmoregulation
          Length = 444

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 100/215 (46%), Gaps = 23/215 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 69  ELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 125

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 126 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 180

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE ++              K     D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 181 YRAPEIMLTWQ-----------KYNVEVDIWSAGCIFAEMIEGKP---LFPGKDHVHQFS 226

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
                +  P KD   T+     +  + S   R+P+
Sbjct: 227 IITDLLGSPPKDVIDTICSENTLKFVTSLPHRDPV 261

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 109/227 (48%), Gaps = 27/227 (11%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFDTEFVRYHF 576
           EI++ K + +   +V+ ID       +++L+E C    L ++L +R K+  + E VR+  
Sbjct: 129 EIQIHKSMSHPN-IVQFIDCFEDDSNVYILLEICPNGSLMELL-KRRKVLTEPE-VRFFT 185

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTP 635
            ++   +K +H   ++H DLK  N  F     LKI DFG+A  + + +   Y     GTP
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTP 243

Query: 636 NYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAI 695
           NY+APE L+     ++ G   +       D+WS G +LY ++ GKPP+     N     I
Sbjct: 244 NYIAPEVLMG----KHSGHSFE------VDIWSLGVMLYALLIGKPPFQARDVNTIYERI 293

Query: 696 MNPDVKIP--YPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLL 740
              D   P   P  D  G ++       IR  L  +PI R ++ +++
Sbjct: 294 KCRDFSFPKDKPISDE-GKIL-------IRDILSLDPIERPSLTEIM 332

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 120/248 (48%), Gaps = 27/248 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEH-DLSQVLTQRSKIPFDTEFVRYHF 576
           EI ++KK ++   +V  ID ++  G L+++ME  E   L+ V+T   +       +    
Sbjct: 658 EIIVMKKSQHPN-IVNFIDSYLVDGKLWVIMEYMEAGSLTDVVT---RCILREGQIGAVC 713

Query: 577 QEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKIIDFGIANAVPDHTVNIYRDNQIGTP 635
           +E++K +  +H   ++H D+K  N +  + G +K+ DFG    + D  +++ R+  +GTP
Sbjct: 714 REVLKGLVFLHSKGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQLND--IHLKRNTMVGTP 771

Query: 636 NYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAI 695
            +MAPE +   ++          KV    D+WS G ++ +M+ G+PPY        LY I
Sbjct: 772 YWMAPEIVEKKHYCP--------KV----DIWSLGVMIIEMIEGEPPYLNEPPLRALYLI 819

Query: 696 M-NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFF 754
             N   K+  PEK      +  T+ + I  CL  +P  R T  +LL+   I  +      
Sbjct: 820 ATNGTPKLKDPEK------LSETLSEFINCCLFVDPELRKTAAELLNHRFITEIAGPNKS 873

Query: 755 IHDLIKNA 762
           +  L+K A
Sbjct: 874 LSHLVKLA 881

>Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113W
           (HOG1) - mitogen-activated protein kinase (MAP kinase)
           [contig 171] FULL
          Length = 432

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 100/215 (46%), Gaps = 23/215 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFLY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A ++H DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE ++              K     D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 182 YRAPEIMLTWQ-----------KYNVEVDIWSAGCIFAEMIEGKP---LFPGKDHVHQFS 227

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
                +  P +D   T+     +  + S   R+P+
Sbjct: 228 IITDLLGSPPEDVINTICSVNTLKFVTSLPHRDPV 262

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 111/236 (47%), Gaps = 20/236 (8%)

Query: 510 SSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKIPFD 568
            ++DG   E+E+L++L N  R+V L  ++  +   +L+ME     DL   +     +  D
Sbjct: 226 GNMDGVTRELEVLRRL-NHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGED 284

Query: 569 TEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG---MLKIIDFGIANAVPDHTVN 625
               R   +++++ VK +H   I H DLKP N +  +    ++KI DFG+A    + T  
Sbjct: 285 AG--REITRQVLEAVKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGT-- 340

Query: 626 IYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY-G 684
            +     GT  Y+APE +   N    +G     K     D+WS GC++Y ++ G  P+ G
Sbjct: 341 -FMKTFCGTLAYVAPEVISGKNSEEKEGN----KYSSLVDMWSIGCLVYVILTGHLPFSG 395

Query: 685 TFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLL 740
           + Q    LY  ++       P KD     I     D I S L+ NP  R+T +Q L
Sbjct: 396 STQ--QELYKQISAGSYHEGPLKD---YRISDDARDFIESFLQVNPRDRMTAEQAL 446

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 100/203 (49%), Gaps = 29/203 (14%)

Query: 500 KRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQV 558
           KR   D+FD     G K E+++L+KL N  R+VKL D+       ++LME     DL   
Sbjct: 225 KRKVMDKFD-----GVKRELDVLQKL-NHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDF 278

Query: 559 LTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKG---MLKIIDFGI 615
           +     +  D    R   +++++ VK +HD  I H DLKP N +  +    ++KI DFG+
Sbjct: 279 VAAHGTVGEDAG--REITRQVLEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGL 336

Query: 616 ANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKP-----SDVWSCG 670
           A        N + +   GT  Y+APE +        DG+ A+ K  +       D+WS G
Sbjct: 337 AKV---QNQNTFLNTFCGTLAYVAPEVI--------DGKNAEDKTNRDLYSSLVDMWSIG 385

Query: 671 CILYQMVYGKPPYGTFQGNNRLY 693
           C++Y ++ G  P+ + Q  N L+
Sbjct: 386 CLVYVILTGHLPF-SGQSQNELF 407

>CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|P32485 Saccharomyces cerevisiae
           YLR113w HOG1
          Length = 447

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 102/215 (47%), Gaps = 23/215 (10%)

Query: 518 EIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQ 577
           E++LLK L ++  +     +      ++ + E    DL ++L  R   P + +FV+Y   
Sbjct: 70  ELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTR---PLEKQFVQYFHY 126

Query: 578 EMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDHTVNIYRDNQIGTPN 636
           ++++ +K VH A +VH DLKP+N +  +   LKI DFG+A  + D  +  Y    + T  
Sbjct: 127 QILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLAR-IQDPQMTGY----VSTRY 181

Query: 637 YMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIM 696
           Y APE  + + + + D E          D+WS GCI  +M+ GKP    F G + ++   
Sbjct: 182 YRAPE--IMLTWQKYDVE---------VDIWSAGCIFAEMIEGKP---LFPGKDHVHQFS 227

Query: 697 NPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731
                +  P  D   T+     +  + S   R+PI
Sbjct: 228 IITDLLGSPPSDVIDTICSENTLKFVTSLPHRDPI 262

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 115/253 (45%), Gaps = 47/253 (18%)

Query: 500 KRVSFDEFDESSIDGFK---GEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLS 556
           K+V +   +++++   K   G I L    +++  +  L++Y      L L+ + G     
Sbjct: 159 KKVKYVNIEKTALQNLKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGT---- 214

Query: 557 QVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGI 615
                      + E   Y+  ++I  +  +H   I+H D+KP N +    M +K+ DFG 
Sbjct: 215 ----------LNEECTIYYSAQIIDAIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGT 264

Query: 616 A---------NAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDV 666
           A         N  P + +     + +GT  Y++PE L++ N+T        +K     D+
Sbjct: 265 AKLLQKKSDKNGKPHYNLLTRSSSFVGTAEYVSPE-LLSDNYT-------DYKC----DI 312

Query: 667 WSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCL 726
           W+ GC++YQM+ GKPP   F+  N  Y      +K+ +    +F    P  + D +++ L
Sbjct: 313 WAFGCLVYQMIAGKPP---FKATNE-YLTFQKVMKVQF----AFTAGFPTIIRDLVKNIL 364

Query: 727 ERNPISRVTIDQL 739
            + P  R+TI Q+
Sbjct: 365 VKQPEKRLTIPQI 377

>TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4.184
           YGR040W
          Length = 374

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 94/193 (48%), Gaps = 24/193 (12%)

Query: 518 EIELLKKLENKQRVVKLID-----YHMGQGVLFLLMECGEHDLSQVLTQRS--KIPFDTE 570
           E++L++   N + ++ ++D            ++++ E  E DL +V+T  +        +
Sbjct: 59  ELKLMRYFNNHENIISVLDKVKPVSFDKLNAVYIVQELMETDLHKVVTNNNLKNTSLSDD 118

Query: 571 FVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM-LKIIDFGIANAVPDH-----TV 624
            ++Y   ++++ +K +H A ++H DLKP+N +      LKI DFG++  +        T+
Sbjct: 119 HIQYFIYQILRALKSIHSAQVIHRDLKPSNILLNSNCDLKICDFGLSRCLASSNNSKATL 178

Query: 625 NIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYG 684
             +    + T  Y APE ++              +     D+WSCGCIL +MV GKP + 
Sbjct: 179 VGFMTEYVATRWYRAPEIMLTFQ-----------EYTTAMDIWSCGCILAEMVSGKPLFP 227

Query: 685 TFQGNNRLYAIMN 697
               +++L+ I++
Sbjct: 228 GRDYHHQLWLILD 240

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 100/226 (44%), Gaps = 64/226 (28%)

Query: 512 IDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLME-CGEHDLSQVLTQRSKI----- 565
           ++  + EI +LKK+ +   +VKLID+       +L+ME C   DL+ ++ +R ++     
Sbjct: 97  LENLEIEIAILKKISHPH-IVKLIDFERTSKDFYLIMEYCSLGDLTFLIKKRQQLIKNHP 155

Query: 566 -----------------PFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGM- 607
                                 F+  + Q++   +K +   ++VH D+KP N +    + 
Sbjct: 156 LLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSAPLI 215

Query: 608 ---------------------LKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAM 646
                                LKI DFG A  +P+ ++    +   G+P YMAPE L   
Sbjct: 216 NYNDPKSFHDLGFVGIYNLPILKIADFGFARFLPNTSM---AETLCGSPLYMAPEIL--- 269

Query: 647 NFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRL 692
           N+ + + +         +D+WS G +LY+M YG PP   F+ +N L
Sbjct: 270 NYQKYNAK---------ADLWSVGTVLYEMCYGNPP---FKASNHL 303

>Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {ON}
           YKL166C (REAL)
          Length = 395

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 94/213 (44%), Gaps = 34/213 (15%)

Query: 494 HKVYALKRVSF--DEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECG 551
           H V  LK+V    DE    SI      I +    ++ Q+V  ++DY  G G LF L+   
Sbjct: 119 HTVVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEG-GELFSLL--- 174

Query: 552 EHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVK-GMLKI 610
                     R    F     +++  E+   ++ +H  DI++ DLKP N +  K G +KI
Sbjct: 175 ----------RKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKI 224

Query: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCG 670
            DFG A  VPD T  +      GTP+Y+APE +    +             K  D WS G
Sbjct: 225 TDFGFAKYVPDVTYTL-----CGTPDYIAPEVVSTKPYN------------KSVDWWSFG 267

Query: 671 CILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIP 703
            ++Y+M+ G  P+           I+N ++K P
Sbjct: 268 VLIYEMLAGYTPFYNSNTMKTYENILNAELKFP 300

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,088,062
Number of extensions: 4081957
Number of successful extensions: 16074
Number of sequences better than 10.0: 2031
Number of HSP's gapped: 14424
Number of HSP's successfully gapped: 2144
Length of query: 793
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 675
Effective length of database: 39,950,811
Effective search space: 26966797425
Effective search space used: 26966797425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)