Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C02343g1.83ON58158127430.0
SAKL0C02684gsingletonON58854319050.0
SAKL0C02662g1.83ON54855118920.0
Skud_5.261.83ON59057418670.0
Suva_5.41.83ON59056118630.0
YEL063C (CAN1)1.83ON59056918600.0
SAKL0C02640gsingletonON54856218540.0
Smik_5.241.83ON59056818510.0
NDAI0A006101.83ON56556818360.0
KNAG0C007901.83ON57951618300.0
Kwal_33.134011.83ON55956018050.0
Kpol_2000.651.83ON59553018020.0
TBLA0A054501.83ON60651917980.0
TPHA0B044801.83ON60351717810.0
CAGL0J08184g1.83ON57254817780.0
KLTH0F02398g1.83ON55556317620.0
NCAS0B085701.83ON53251317430.0
TDEL0C061801.83ON58352017250.0
SAKL0C02728g1.84ON56254817190.0
KNAG0C05920singletonON59951717200.0
KAFR0D007001.83ON57457517160.0
Ecym_10871.83ON57056317050.0
NDAI0F042001.83ON56651016910.0
KLLA0C02365g1.84ON57955816920.0
Ecym_10881.84ON56754516830.0
Kwal_33.134111.84ON56054316790.0
NCAS0A006001.83ON54454116750.0
KLTH0F02420g1.84ON62156716820.0
TPHA0B044701.84ON59957716700.0
Kpol_2000.641.84ON61056616700.0
ZYRO0F16654g1.83ON58054916640.0
Smik_14.681.84ON61151016560.0
CAGL0J08162g1.84ON59751416480.0
AFR668W1.83ON55653416420.0
TBLA0A054601.84ON60852516470.0
NDAI0F041901.84ON59951216420.0
Skud_14.701.83ON57356016370.0
TDEL0C061701.84ON57353216370.0
NCAS0A006101.84ON60751216390.0
Smik_14.671.83ON57355516330.0
YNL270C (ALP1)1.83ON57353216220.0
Skud_14.711.84ON61251016240.0
YNL268W (LYP1)1.84ON61154016230.0
KNAG0F004801.84ON59758516210.0
Suva_14.751.84ON61151016150.0
KAFR0D039401.83ON59753416110.0
Suva_14.731.83ON49748115750.0
AFR667C1.84ON56354715590.0
ZYRO0F16632g1.84ON60751715550.0
CAGL0A01199gna 1ON6135079011e-113
SAKL0G14916gna 1ON5815398981e-113
Kwal_33.15545na 1ON5765278921e-112
NCAS0D02260na 1ON5975078901e-111
Kpol_358.3na 1ON5755178861e-111
KLLA0E16281gna 1ON6055168871e-111
KAFR0B06430singletonON5935278811e-110
NDAI0I02660na 1ON5945408811e-110
YPL265W (DIP5)na 1ON6084968751e-109
KLTH0B01166gna 1ON5775328711e-109
TBLA0A07060na 1ON6254798741e-109
Smik_6.473na 1ON6064968711e-109
Ecym_2480na 1ON5864898691e-108
KNAG0L02470singletonON6385278691e-108
Skud_16.12na 1ON6075088661e-108
Suva_16.40na 1ON6064958631e-107
TPHA0M00130singletonON6114868551e-106
SAKL0F09790gsingletonON5585218451e-105
TPHA0H028507.44ON6015738391e-104
Ecym_80357.44ON5635638331e-103
Kwal_26.69407.44ON5705488321e-103
Ecym_60211.244ON6004718271e-102
TDEL0H040707.44ON5774868211e-101
NDAI0E038007.44ON6215498231e-101
SAKL0D00836gna 2ON6014588211e-101
AFR156W7.44ON5585528141e-101
CAGL0E05632g7.44ON5984838171e-100
SAKL0B10956g7.44ON5724748131e-100
KNAG0L02460singletonON5885188131e-100
NDAI0G060301.368ON5994567952e-97
Suva_8.4027.44ON6835418002e-97
AFR230C1.244ON6044157933e-97
TDEL0C00930singletonON5955347915e-97
KLTH0D01474g7.44ON6245217935e-97
TPHA0B010901.244ON6064117918e-97
KNAG0C02140singletonON5984307891e-96
SAKL0C01232gsingletonON6134217901e-96
YOR348C (PUT4)7.44ON6275417883e-96
ZYRO0D03762g1.244ON6004197846e-96
Skud_4.7841.50ON6634547888e-96
Kpol_543.791.244ON6054377812e-95
Suva_2.6881.50ON6614707852e-95
NDAI0B052201.244ON6114497804e-95
Kpol_367.77.44ON5845017767e-95
ACL135Wna 1ON5884867767e-95
KLLA0F27093gsingletonON5635047731e-94
Ecym_47895.158ON5884317741e-94
Smik_4.7901.50ON6634547783e-94
KNAG0E003907.44ON5995237723e-94
Smik_15.5327.44ON6315427744e-94
SAKL0G14014g5.158ON6054357691e-93
KLTH0E15642g1.244ON5964167681e-93
Kwal_27.126811.244ON5934377672e-93
YDR508C (GNP1)1.50ON6634557722e-93
CAGL0B01012g1.50ON6234457674e-93
TBLA0C01240singletonON6295337674e-93
KAFR0D005001.50ON6174187656e-93
Kwal_26.9612singletonON5434447589e-93
Suva_2.716singletonON6034377621e-92
Suva_3.1891.50ON6334357641e-92
CAGL0L03267g1.244ON5974327612e-92
Suva_11.2731.244ON6014167602e-92
Skud_3.381.50ON6334437623e-92
Kwal_8.590na 3ON6294477604e-92
KAFR0D00510na 4ON6174397586e-92
SAKL0D04664g1.244ON5934707551e-91
Suva_7.4855.158ON6034607551e-91
NCAS0A089201.368ON5994237523e-91
Skud_11.2751.244ON6024167514e-91
AEL030W1.368ON5824697495e-91
Skud_15.5157.44ON6265417526e-91
Suva_4.3073.284ON6094787508e-91
SAKL0C01650g1.50ON6134217508e-91
YBR068C (BAP2)3.284ON6094607508e-91
KLTH0B02046g5.158ON5894647481e-90
CAGL0K05753g1.50ON6604497522e-90
Smik_11.3021.244ON5534707432e-90
CAGL0D02178g1.368ON5774477443e-90
Smik_3.531.50ON6334357483e-90
TDEL0A08030singletonON5145017393e-90
KLTH0F04048gsingletonON5835417443e-90
YOL020W (TAT2)1.368ON5924377444e-90
KAFR0D00520na 5ON5984747454e-90
YKR039W (GAP1)1.244ON6024167454e-90
Kwal_33.14276na 2ON5964377444e-90
Skud_7.5255.158ON6034607455e-90
NCAS0B079001.244ON6194427465e-90
KAFR0C051607.44ON5844767436e-90
TBLA0A051801.50ON6764177496e-90
NDAI0D021605.158ON5874647426e-90
SAKL0D02970g3.284ON6014757436e-90
NDAI0A006401.50ON6414527467e-90
Kwal_33.154075.158ON5874627419e-90
NCAS0E022607.44ON5935157429e-90
SAKL0C13992gsingletonON5525047381e-89
CAGL0B03773g5.158ON6054577421e-89
KLLA0F23419g7.44ON5735467391e-89
NCAS0A106803.284ON5934677411e-89
TBLA0C012101.368ON6004387411e-89
Skud_2.1913.284ON6094727412e-89
AFR698C1.50ON6094197402e-89
Kwal_23.4026singletonON5344897343e-89
TDEL0C065101.50ON6424327423e-89
TDEL0E05750singletonON5485257353e-89
TBLA0I020103.285ON6284487413e-89
Smik_15.1461.368ON5934477383e-89
KLTH0C05170g3.284ON5984217384e-89
KLTH0H13398g1.368ON5874297374e-89
YCL025C (AGP1)1.50ON6334147404e-89
KLTH0B00154gna 3ON5564247345e-89
Ecym_26643.285ON5754327365e-89
Kwal_34.16254singletonOFF4814717285e-89
Kwal_YGOB_34.162541.368ON4914717286e-89
TPHA0E036601.50ON6474297407e-89
ZYRO0D17908gna 1ON5184967307e-89
KAFR0D04120na 5ON6485197407e-89
Kpol_2000.921.50ON6374467389e-89
KLLA0A11770g5.158ON5814677341e-88
Skud_15.1381.368ON5924477341e-88
Kpol_534.221.368ON5924237323e-88
Smik_6.482na 6ON5584867293e-88
Kpol_543.78singletonON6054397333e-88
Suva_15.1481.368ON5924477323e-88
KAFR0E018505.158ON5604187293e-88
Smik_13.1singletonON5234527263e-88
ZYRO0A00308gsingletonON5644817293e-88
Ecym_10561.50ON6064177315e-88
AGR319W5.158ON6264287325e-88
KAFR0A011203.284ON5924347306e-88
Sklu_YGOB_Anc_1.3681.368ON5414547257e-88
NDAI0A056203.284ON5714677261e-87
Smik_2.2013.284ON6094517281e-87
Ecym_27161.368ON5924417262e-87
Skud_16.2na 6ON4964237192e-87
YFL055W (AGP3)na 7ON5585227232e-87
YGR191W (HIP1)5.158ON6034607262e-87
Smik_16.1155.158ON6034567262e-87
NCAS0A071105.158ON5924747244e-87
KLLA0A10813g1.368ON5844597235e-87
TBLA0B077605.158ON6584217277e-87
KNAG0J022003.284ON6074497221e-86
KLLA0B14685gna 8ON5715717182e-86
KAFR0C004003.284ON5824327192e-86
SAKL0D02926g3.285ON5834417192e-86
KLTH0C08052gna 9ON5994667202e-86
SAKL0D02948gna 10ON5944167192e-86
KLLA0A06886gsingletonON5874167182e-86
NCAS0B085801.50ON6274557213e-86
KLTH0F01584g1.50ON5964497174e-86
SAKL0F16544gsingletonON5675687145e-86
CAGL0H08393g3.284ON6124327185e-86
AGR040C3.285ON5734507146e-86
Kwal_27.105383.284ON6024147151e-85
AGR039Cna 10ON5864487122e-85
TDEL0F02830na 11ON5615317093e-85
TBLA0A05190na 5ON6674427164e-85
NCAS0J00140na 7ON5585357084e-85
NCAS0A004201.50ON6794167155e-85
YDR046C (BAP3)3.284ON6044697097e-85
KNAG0F002701.50ON6344727119e-85
ZYRO0C18502g7.44ON5755407061e-84
Suva_13.517singletonON5475387041e-84
NCAS0D018705.158ON5954527071e-84
Skud_6.2na 7ON5585177041e-84
KNAG0G009005.158ON6134277081e-84
KAFR0F02250singletonON5545227032e-84
TPHA0A047005.158ON5694457042e-84
KLTH0A00308gsingletonON5415047012e-84
Ecym_8297na 12ON5694397032e-84
CAGL0M00154gsingletonON5505267023e-84
KNAG0H011503.284ON6174307063e-84
TPHA0A025001.368ON5904617034e-84
Kwal_56.22951na 9ON5964697034e-84
NDAI0A01340singletonON5544997004e-84
Suva_2.2033.284ON6044697035e-84
KAFR0D041401.50ON6374607057e-84
SAKL0A09724gna 13ON5514866997e-84
Ecym_26623.284ON5894436991e-83
Smik_4.2843.284ON6044697001e-83
Kpol_2002.441.50ON6274367012e-83
AGR038C3.284ON5804346972e-83
Kwal_23.2817na 8ON5805686963e-83
Kpol_1010.325.158ON5994296974e-83
Kwal_33.132041.50ON6074186974e-83
TPHA0A002405.158ON6034236959e-83
KLLA0A06930g1.244ON5874716931e-82
TDEL0E05700singletonON5844146921e-82
KAFR0B00220singletonON5854716922e-82
NDAI0A074903.284ON5964516922e-82
KLTH0F01606gna 5ON6044386932e-82
NDAI0C029505.158ON6094326932e-82
SAKL0H08184gna 12ON5984526912e-82
NCAS0I015303.284ON5954316913e-82
KAFR0F04410singletonON5804766893e-82
Smik_2.2023.285ON6174686915e-82
Skud_4.3003.284ON6044666896e-82
TPHA0G03770singletonON6044156897e-82
TDEL0H04510singletonON5844726878e-82
KLLA0C01606g1.50ON6204516891e-81
TBLA0G031203.284ON6734556902e-81
ADL272Wna 12ON5644346823e-81
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C02343g
         (581 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...  1061   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   738   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   733   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   723   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   722   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   721   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   718   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   717   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   711   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              709   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   699   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   698   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   697   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   690   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   689   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   683   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            676   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   669   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   666   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            667   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   665   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   661   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            655   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   656   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   652   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   651   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   649   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   652   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   647   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   647   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   645   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   642   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   639   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   637   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   639   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   637   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   635   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   635   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              635   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   633   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   629   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   630   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   629   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                629   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   626   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   625   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   611   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   605   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   603   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   351   e-113
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   350   e-113
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   348   e-112
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              347   e-111
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   345   e-111
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   346   e-111
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   343   e-110
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   343   e-110
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   341   e-109
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   340   e-109
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   341   e-109
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   340   e-109
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   339   e-108
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             339   e-108
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   338   e-108
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   337   e-107
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     333   e-106
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   330   e-105
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   327   e-104
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   325   e-103
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   325   e-103
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   323   e-102
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   320   e-101
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     321   e-101
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   320   e-101
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   318   e-101
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   319   e-100
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   317   e-100
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             317   e-100
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   310   2e-97
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   312   2e-97
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   310   3e-97
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   309   5e-97
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   310   5e-97
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   309   8e-97
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   308   1e-96
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   308   1e-96
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   308   3e-96
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   306   6e-96
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   308   8e-96
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   305   2e-95
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   306   2e-95
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   305   4e-95
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   303   7e-95
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   303   7e-95
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   302   1e-94
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   302   1e-94
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   304   3e-94
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   301   3e-94
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   302   4e-94
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   300   1e-93
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   300   1e-93
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   300   2e-93
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   301   2e-93
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   300   4e-93
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   300   4e-93
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      299   6e-93
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   296   9e-93
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   298   1e-92
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   298   1e-92
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   297   2e-92
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   297   2e-92
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   298   3e-92
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   297   4e-92
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      296   6e-92
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   295   1e-91
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   295   1e-91
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   294   3e-91
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   293   4e-91
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   293   5e-91
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   294   6e-91
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   293   8e-91
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   293   8e-91
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   293   8e-91
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   292   1e-90
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   294   2e-90
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   290   2e-90
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   291   3e-90
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   292   3e-90
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            289   3e-90
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   291   3e-90
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   291   4e-90
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   291   4e-90
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   291   4e-90
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   291   4e-90
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   291   5e-90
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   291   5e-90
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   290   6e-90
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   293   6e-90
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    290   6e-90
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   290   6e-90
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   291   7e-90
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   290   9e-90
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     290   9e-90
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   288   1e-89
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   290   1e-89
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   289   1e-89
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   290   1e-89
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   290   1e-89
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   290   2e-89
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   289   2e-89
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   287   3e-89
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   290   3e-89
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            287   3e-89
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   290   3e-89
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   288   3e-89
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   288   4e-89
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   288   4e-89
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   289   4e-89
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   287   5e-89
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   288   5e-89
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   285   5e-89
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   285   6e-89
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   289   7e-89
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   285   7e-89
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   289   7e-89
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   288   9e-89
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   287   1e-88
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   287   1e-88
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   286   3e-88
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   285   3e-88
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   286   3e-88
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   286   3e-88
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   285   3e-88
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    284   3e-88
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   285   3e-88
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   286   5e-88
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   286   5e-88
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   285   6e-88
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   283   7e-88
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            284   1e-87
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   285   1e-87
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   284   2e-87
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   281   2e-87
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   283   2e-87
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   284   2e-87
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   284   2e-87
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   283   4e-87
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   283   5e-87
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   284   7e-87
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   282   1e-86
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   281   2e-86
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                281   2e-86
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   281   2e-86
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   281   2e-86
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   281   2e-86
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   281   2e-86
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   282   3e-86
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   280   4e-86
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   279   5e-86
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   281   5e-86
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   279   6e-86
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   280   1e-85
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   278   2e-85
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   277   3e-85
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   280   4e-85
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      277   4e-85
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   280   5e-85
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   277   7e-85
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   278   9e-85
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   276   1e-84
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   275   1e-84
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   276   1e-84
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      275   1e-84
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   277   1e-84
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              275   2e-84
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   275   2e-84
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   274   2e-84
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   275   2e-84
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   275   3e-84
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              276   3e-84
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   275   4e-84
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   275   4e-84
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              274   4e-84
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   275   5e-84
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              276   7e-84
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   273   7e-84
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   273   1e-83
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   274   1e-83
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   274   2e-83
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   273   2e-83
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   272   3e-83
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   273   4e-83
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   273   4e-83
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   272   9e-83
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   271   1e-82
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   271   1e-82
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      271   2e-82
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   271   2e-82
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   271   2e-82
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    271   2e-82
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   270   2e-82
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              270   3e-82
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              270   3e-82
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   270   5e-82
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   270   6e-82
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   270   7e-82
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   269   8e-82
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   270   1e-81
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              270   2e-81
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   267   3e-81
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   267   3e-81
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   267   7e-81
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   266   9e-81
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                265   1e-80
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   266   1e-80
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   266   1e-80
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   265   2e-80
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   264   5e-80
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   263   6e-80
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   264   6e-80
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   265   7e-80
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   264   9e-80
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   265   1e-79
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   262   3e-79
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   263   4e-79
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                261   5e-79
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   261   9e-79
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   260   1e-78
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   261   1e-78
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              260   5e-78
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    258   1e-77
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   259   2e-77
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   257   3e-77
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   257   4e-77
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   256   6e-77
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   256   1e-76
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   256   2e-76
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   255   5e-76
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              254   8e-76
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   253   8e-76
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   253   9e-76
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   253   1e-75
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   253   1e-75
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   253   2e-75
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   252   2e-75
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   252   2e-75
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   251   3e-75
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                251   3e-75
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   249   6e-75
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   251   1e-74
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   251   1e-74
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   246   3e-74
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   248   5e-74
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   247   7e-74
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   248   8e-74
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   246   2e-73
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   244   2e-72
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   244   3e-72
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   244   3e-72
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   241   3e-71
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   239   6e-71
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   236   8e-70
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   235   2e-69
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   235   3e-69
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   234   7e-69
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   233   3e-68
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   231   1e-67
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   225   1e-65
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   225   1e-65
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   230   2e-65
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   225   2e-65
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   224   8e-65
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              223   4e-64
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     212   5e-63
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     211   1e-62
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   219   1e-61
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   209   3e-58
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   204   4e-58
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   209   7e-58
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   204   3e-56
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   199   4e-56
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   203   9e-56
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   202   2e-55
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   202   2e-55
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   202   2e-55
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   200   1e-54
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   200   1e-54
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   199   2e-54
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   197   6e-54
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   196   3e-53
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   195   4e-53
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   194   1e-52
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   194   1e-52
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   192   5e-52
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   192   6e-52
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   189   6e-51
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   178   3e-48
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         147   4e-39
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   142   3e-38
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     128   1e-32
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    129   4e-32
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         124   9e-32
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          88   2e-19
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      75   5e-16
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    77   6e-16
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    69   2e-12
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    47   6e-05
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    40   0.012
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    39   0.037
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    39   0.039
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...    38   0.091
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    36   0.28 
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    35   0.59 
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    35   0.65 
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    35   0.66 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    34   1.1  
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    34   1.2  
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    34   1.4  
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      32   1.7  
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    33   1.9  
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    33   2.1  
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    33   2.4  
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    32   3.4  
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...    32   4.8  
Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa] ...    32   6.7  
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    31   8.5  

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score = 1061 bits (2743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/581 (91%), Positives = 531/581 (91%)

Query: 1   MTSXXXXXXXXXXXXXHSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSR 60
           MTS             HSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSR
Sbjct: 1   MTSIAQQIELEELEALHSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSR 60

Query: 61  MFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGT 120
           MFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGT
Sbjct: 61  MFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGT 120

Query: 121 LAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQI 180
           LAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQI
Sbjct: 121 LAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQI 180

Query: 181 IQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG 240
           IQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG
Sbjct: 181 IQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG 240

Query: 241 AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETK 300
           AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETK
Sbjct: 241 AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETK 300

Query: 301 NPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNC 360
           NPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNC
Sbjct: 301 NPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNC 360

Query: 361 RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI 420
           RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI
Sbjct: 361 RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI 420

Query: 421 TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP 480
           TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP
Sbjct: 421 TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP 480

Query: 481 YKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYR 540
           YKAKFMP                     FAPHFNVSDFFAAYISVFLFFIVWAIFQTIYR
Sbjct: 481 YKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYR 540

Query: 541 TKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
           TKLFRTL                WEEEEPKNLWEKFWAVAA
Sbjct: 541 TKLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/543 (67%), Positives = 428/543 (78%), Gaps = 12/543 (2%)

Query: 39  DPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFIS 98
            P+R +   N++++ +D         EG++  AEVKRALKPRH+SMIALGGTIGTGLFI 
Sbjct: 58  SPMR-TGSPNVSIDYMD---------EGNVQDAEVKRALKPRHISMIALGGTIGTGLFIG 107

Query: 99  ISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAAN 158
           IS PL +AGPVG+LIA+M +GT+AY VTQSLGEMATFIPVTSSFTVF+QRF+SPA G AN
Sbjct: 108 ISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVAN 167

Query: 159 GYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFW 218
           GY+YWFSW ITFALELS+VGQIIQ+WT AVPL AWIAIFWV+L + N+FPVK+YGE EFW
Sbjct: 168 GYLYWFSWCITFALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFW 227

Query: 219 VASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSS 278
           +A IKV+AI+GF+IY+  MVCGAG  GP+GFRYWR PGPWG GII+K+VN+ RFLGWVSS
Sbjct: 228 IACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSS 287

Query: 279 LISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPK 338
           LI+AAFTYQGTELVGITAGE+KNPR+ VPRAINKVFFRIL FYI SL FIGLLVP+NDPK
Sbjct: 288 LINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPK 347

Query: 339 LEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKN 398
           L+  D  SYI+ SPF+IAI N  T VLPHIFNAVIL+TIISAGNSN+YVGSR+L+GL+KN
Sbjct: 348 LKSED--SYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKN 405

Query: 399 NLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLI 458
            LAPK F++ TK GVP+I+VL TA FGFLAYLN+SN AQ+VFDWLLNITAIAGF  WL I
Sbjct: 406 KLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFI 465

Query: 459 SISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDF 518
           S++HIRFMQ LK R +SR+DLP+KAKFMP                     FAP FNVS+F
Sbjct: 466 SLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFAPKFNVSNF 525

Query: 519 FAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWA 578
           FAAYISVFLF  +W +FQ  +RT+   T                 WEEE PKN W+KFWA
Sbjct: 526 FAAYISVFLFLAIWVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWEEETPKNAWDKFWA 585

Query: 579 VAA 581
             A
Sbjct: 586 AMA 588

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/551 (67%), Positives = 430/551 (78%), Gaps = 4/551 (0%)

Query: 32  VSNSKIDDPLRFSKDNNLTLE-AIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGT 90
           +S SK  +  R    ++L ++ +I +D+  M +  GS+ + +VKRALKPRH+SMIALGGT
Sbjct: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSM-ESLGSVKETQVKRALKPRHISMIALGGT 59

Query: 91  IGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFI 150
           IGTGLFISIS PL NAGPVG+LIA+M IGTLAYSVTQSLGEMATFIPVTSSFTVF+QRF+
Sbjct: 60  IGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFL 119

Query: 151 SPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVK 210
           SPA+G+ANGY+YW SWAITFALELS+VGQIIQ+WTDAVPL AWIAIFWV+L   N+FPVK
Sbjct: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179

Query: 211 WYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKA 270
           +YGE EFW+A IKV+AI+GF+IY+  MVCGAG  GP+GFRYWR PGPWG GII+K+VN+ 
Sbjct: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEG 239

Query: 271 RFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGL 330
           RFLGWVSSLISAAFTYQGTELVGITAGE  NPRK VPRAINKVFFRIL FYI SL FIGL
Sbjct: 240 RFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGL 299

Query: 331 LVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSR 390
           LVP+NDPKL+  D  SYI+ SPF+IAI N  T VLPHIFNAVIL+TIISAGNSNVYVGSR
Sbjct: 300 LVPFNDPKLKSED--SYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSR 357

Query: 391 ILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIA 450
           I + ++ N LAPK+ + TTK G+P+ AVL T+V GFLAYL  S+ A  VF+WLLNITA+A
Sbjct: 358 IAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVA 417

Query: 451 GFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFA 510
           GF TW+LISISHIRFMQ LKH+GISRDDLP+KAKFMP                     FA
Sbjct: 418 GFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFA 477

Query: 511 PHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPK 570
           P F VSDFF AYISV LFF+ W  FQ  +R  LF                   WEE++P+
Sbjct: 478 PKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPR 537

Query: 571 NLWEKFWAVAA 581
           NLWEKFWA  A
Sbjct: 538 NLWEKFWAAIA 548

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/574 (63%), Positives = 421/574 (73%), Gaps = 26/574 (4%)

Query: 21  SQSQSARSGMHVSNSKIDD--PLR-----------FSKDNNLTLEAIDDDSSRMFDPEGS 67
           SQ+   R  + + + K  +  PLR           FS + NL     D+D       EG 
Sbjct: 30  SQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQ----DED-------EGE 78

Query: 68  IGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQ 127
           +  AEVKR LK RH+ MIALGGTIGTGLFI +S PL NAGPVG+LIA++ +G+LA+SVTQ
Sbjct: 79  VQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQ 138

Query: 128 SLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDA 187
           SLGEMATFIPVTSSFTVFSQRF+SPA GAANGYMYWFSWAITFALELS+VGQ+IQ+WT  
Sbjct: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK 198

Query: 188 VPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPI 247
           VPL AWI+IFWVL+   N+FPVK+YGEFEFWVASIKVIAIIGFLIY  CMVCGAG  GP+
Sbjct: 199 VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV 258

Query: 248 GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307
           GFRYWR PG WG GII+KN N+ RFLGWVSSLI+AAFT+QGTELVGITAGE  NPRK VP
Sbjct: 259 GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 318

Query: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367
           RAI KV FRIL FYIGSL FIGLLVPYNDPKL  ++  SY++ SPF++AI N  T VLPH
Sbjct: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSYVSTSPFIVAIQNSGTKVLPH 376

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
           IFNAVILTTIISA NSN+YVGSRILFGLSKN LAPKF S+T+K GVP+IAV  TAVFG L
Sbjct: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMP 487
           AY+  S    +VF+WLLNIT +AGF  WL ISISHIRFMQ LK+RGISRD+LP+KAK MP
Sbjct: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496

Query: 488 XXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTL 547
                                FAP FN S F AAYIS+FLF  VW +F+ I+R +    +
Sbjct: 497 GLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKI 556

Query: 548 XXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                           WE+ EPK  W+KFW V A
Sbjct: 557 EDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/561 (64%), Positives = 418/561 (74%), Gaps = 4/561 (0%)

Query: 21  SQSQSARSGMHVSNSKIDD--PLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALK 78
           SQ+   R  + + + K  +  PLR   +     +    +     + EG +  AEVKR LK
Sbjct: 30  SQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELK 89

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPV 138
            RH+ MIALGGTIGTGLFI +S PL NAGPVG+LI+++ +G+LAYSVTQSLGEMATFIPV
Sbjct: 90  QRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPV 149

Query: 139 TSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFW 198
           TSSFTVFSQRF+SPA GAANGYMYWFSWA+TFALELS+VGQ+IQ+WT AVPL AWI+IFW
Sbjct: 150 TSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFW 209

Query: 199 VLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPW 258
           V++ + NMFPVK+YGEFEFWVASIKVIAIIGFLIY  CMVCGAG  GP+GFRYWR PG W
Sbjct: 210 VIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAW 269

Query: 259 GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRIL 318
           G GII+KN N+ARFLGWVSSLI+AAFT+QGTELVGITAGE  NPRK VPRAI KV FRIL
Sbjct: 270 GPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRIL 329

Query: 319 IFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTII 378
            FYIGSL FIGLLVPYNDPKL  +   SY++ SPF+IAI N  T VLPHIFNAVILTTII
Sbjct: 330 TFYIGSLLFIGLLVPYNDPKLTSAT--SYVSTSPFIIAIENSGTKVLPHIFNAVILTTII 387

Query: 379 SAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQE 438
           SA NSN+YVGSR+LFGLSK+ LAPKFFSKTTK GVP+IAV  T++FG LAY+  S    +
Sbjct: 388 SAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGK 447

Query: 439 VFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXX 498
           VF WLLNIT +AGF  WL IS+SHIRFMQ LK+RGISRD+LP+KAK MP           
Sbjct: 448 VFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMV 507

Query: 499 XXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXX 558
                     F P FN  +F AAYISVFLF  +W +F+ I+R +    +           
Sbjct: 508 VIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRD 567

Query: 559 XXXXXWEEEEPKNLWEKFWAV 579
                WEE EPK LW+KFW V
Sbjct: 568 IEAIVWEEPEPKTLWDKFWNV 588

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/569 (63%), Positives = 421/569 (73%), Gaps = 16/569 (2%)

Query: 21  SQSQSARSGMHVSNSKIDD-------PLRFSKDNNLTLE-AIDDDSSRMFDPEGSIGQAE 72
           SQ+   R  + + + K  +       P R + ++  ++E  I D+       EG +  AE
Sbjct: 30  SQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMEDGIGDED------EGEVQNAE 83

Query: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132
           VKR LK RH+ MIALGGTIGTGLFI +S PL NAGPVG+LI+++ +G+LAYSVTQSLGEM
Sbjct: 84  VKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143

Query: 133 ATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEA 192
           ATFIPVTSSFTVFSQRF+SPA GAANGYMYWFSWAITFALELS+VGQ+IQ+WT  VPL A
Sbjct: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAA 203

Query: 193 WIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYW 252
           WI+IFWV++   N+FPVK+YGEFEFWVASIKV+AIIGFLIY  CMVCGAG  GP+GFRYW
Sbjct: 204 WISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYW 263

Query: 253 RKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINK 312
           R PG WG GII+K+ N+ RFLGWVSSLI+AAFT+QGTELVGITAGE  NPRK+VPRAI K
Sbjct: 264 RNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKK 323

Query: 313 VFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAV 372
           V FRIL FYIGSL FIGLLVPYNDPKL  + + SY++ SPF+IAI N  T VLPHIFNAV
Sbjct: 324 VVFRILTFYIGSLLFIGLLVPYNDPKL--TQSTSYVSTSPFIIAIENSGTKVLPHIFNAV 381

Query: 373 ILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNV 432
           ILTTIISA NSN+YVGSRILFGLSKN LAPKF S+TTK GVP+IAV +TA FG LAY+  
Sbjct: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMET 441

Query: 433 SNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXX 492
           S    +VF+WLLNIT +AGF  WL ISISHIRFMQ LK+RGISRD+LP+KAK MP     
Sbjct: 442 STGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501

Query: 493 XXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXX 552
                           FAP FN   F AAYIS+FLF  VW +FQ I+R +    +     
Sbjct: 502 AATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDI 561

Query: 553 XXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                      WE+ EPK  W+KFW V A
Sbjct: 562 DSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/562 (64%), Positives = 426/562 (75%), Gaps = 14/562 (2%)

Query: 20  LSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKP 79
           +S  Q   S    ++ ++      SKD  ++LE++           GS+ + +VKRALKP
Sbjct: 1   MSAQQHHSSEKEKNSEELVSEFSRSKDV-VSLESL-----------GSVKETQVKRALKP 48

Query: 80  RHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVT 139
           RH+SMIALGGTIGTGLFISIS PL NAGPVG+LIA+M IGTLAY V+QSLGEMATFIPVT
Sbjct: 49  RHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVT 108

Query: 140 SSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWV 199
           SSF VF+QRF+SPA+GAANGYMY+ SW+ITFALELS+VGQ+IQ+WTDAVPL AWI I WV
Sbjct: 109 SSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWV 168

Query: 200 LLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWG 259
           +LVS N+ PVK+YGE EFW+A IKV+AI+GF+IY+  MVCGAG  GP+GFRYWR PGPWG
Sbjct: 169 VLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWG 228

Query: 260 NGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILI 319
            GII+K+VN+ RFLGWVSSLISAAFTYQGTELVGITAGE  NPRK VPRAINKVFFRIL 
Sbjct: 229 PGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILF 288

Query: 320 FYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIIS 379
           FYI SL FIGLLVP+NDPKL+  D  SYI+ SPF+IAI N  T VLPHIFNAVIL+TIIS
Sbjct: 289 FYILSLLFIGLLVPFNDPKLKSED--SYISSSPFVIAIENSGTKVLPHIFNAVILSTIIS 346

Query: 380 AGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEV 439
           AGNS+VY+ SR+L+ +  N LAPK+ + TTK G+P+ AVL T++ GFLAYL  S+ A  V
Sbjct: 347 AGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVV 406

Query: 440 FDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXX 499
           FDWLLNITA+AGF  W+LIS++HIRFMQ LKH+GISRDDLP+KAKFMP            
Sbjct: 407 FDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGV 466

Query: 500 XXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXX 559
                    FAP FNVSDFF AY+SV LFF VW  FQ  +R  LF+              
Sbjct: 467 IIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREI 526

Query: 560 XXXXWEEEEPKNLWEKFWAVAA 581
               WEE+EPKNLWEKFW+  A
Sbjct: 527 DNDVWEEDEPKNLWEKFWSAVA 548

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/568 (63%), Positives = 422/568 (74%), Gaps = 14/568 (2%)

Query: 21  SQSQSARSGMHVSNSKIDD--PL-----RFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEV 73
           SQ+   R  + + + K  +  PL     R   ++  ++  +  D     + +G +  AEV
Sbjct: 30  SQTHRRRGSLPLKDEKNKELYPLHSFSTRVDGEDTFSMGDVIRD-----EDQGEVRNAEV 84

Query: 74  KRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA 133
           KR LK RH+ MIALGGTIGTGLFI +S PL NAGPVG+LI+++ +G+LAYSVTQSLGEMA
Sbjct: 85  KRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMA 144

Query: 134 TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAW 193
           TFIPVTSSFTVFSQRF+SPA GAANGYMYWFSWAITFALELS+VGQ+I++WT+ VPL AW
Sbjct: 145 TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKVPLAAW 204

Query: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWR 253
           I+IFWV++   N+FPVK+YGEFEFWVASIKV+AIIGFLIY  CMVCGAG  GP+GFRYWR
Sbjct: 205 ISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWR 264

Query: 254 KPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKV 313
            PG WG GII+K+ N+ RFLGWVSSLI+AAFT+QGTELVGITAGE  NPRK VPRAI KV
Sbjct: 265 NPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKV 324

Query: 314 FFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVI 373
            FRIL FYIGSL FIGLLVPYNDPKL  +   SY++ SPF+IAI N  T VLPHIFNAVI
Sbjct: 325 VFRILTFYIGSLLFIGLLVPYNDPKLTTAT--SYVSVSPFIIAIENSGTKVLPHIFNAVI 382

Query: 374 LTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVS 433
           LTTIISA NSN+YVGSRILFGLSKN LAPKF S+TTK GVP+IAV ITAVFG LAY+  S
Sbjct: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETS 442

Query: 434 NDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXX 493
               +VF+WLLNIT +AGF  WLLISISHIRFMQ LK+RGISRD+LP+KAK MP      
Sbjct: 443 TGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFA 502

Query: 494 XXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXX 553
                          FAP F+  DF AAYIS+FLF  +W +F+ I+R +    +      
Sbjct: 503 ATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIEDVDID 562

Query: 554 XXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                     WE+ EPK  W+KFW V A
Sbjct: 563 SDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/568 (63%), Positives = 429/568 (75%), Gaps = 15/568 (2%)

Query: 22  QSQSARSGMHVSNS-KIDD-PLR------FSKDNNLTLEAIDDDSSRMFDPEGSIGQAEV 73
           Q +  ++G   S+S ++DD PL        S  + +T+E+ +++ +      G I +AEV
Sbjct: 5   QEEPLKNGKIKSSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIA-----NGQIREAEV 59

Query: 74  KRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA 133
           KR LK RH+ MIALGGTIGTGLFI +S PL NAGPVG+LIA++ +GTL YSVTQSLGEMA
Sbjct: 60  KRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMA 119

Query: 134 TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAW 193
           TFIPVTSSFTVFSQRF+SP+ GAANGYMYWFSWAITFALELS+VGQIIQ+WT AVP+ AW
Sbjct: 120 TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAW 179

Query: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWR 253
           I+IFWVLLV+ NMFPV++YGEFEFWVASIKV+AI+GFLIY LCMVCGAG  GP+GFRYWR
Sbjct: 180 ISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWR 239

Query: 254 KPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKV 313
            PGP G GIIAKN+N+A+FLGWVSSLI+AAFTYQGTELVGITAGE  NPRK+VPRAI KV
Sbjct: 240 NPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKV 299

Query: 314 FFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVI 373
            FRIL FYIGSLFFIGLLVPYNDPKL   D  SY+A SPF+I+I N  TP+LPHIFNAVI
Sbjct: 300 VFRILFFYIGSLFFIGLLVPYNDPKLTSDD--SYVAASPFIISIQNSGTPILPHIFNAVI 357

Query: 374 LTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVS 433
           L+TIISA NSNVYVGSRI+FGLSK+ LAP+  S+T K+GVP+++V+ T +FG LAY+  S
Sbjct: 358 LSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETS 417

Query: 434 NDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXX 493
              +  F+WLLNIT +AGF +WL ISISH+RFMQ L++RGISRDDLP+KAKFMP      
Sbjct: 418 TGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYA 477

Query: 494 XXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXX 553
                          F P F+  DF AAYIS FLF  +W +FQ  +R +L   +      
Sbjct: 478 IFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDID 537

Query: 554 XXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                     WE+  P   W+KFW V A
Sbjct: 538 TDRRDIEEVVWEDPPPVTFWDKFWNVVA 565

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/516 (67%), Positives = 401/516 (77%), Gaps = 2/516 (0%)

Query: 66  GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSV 125
           G +  AEVKR LK RH+ MIALG TIGTGLFI +S PL  AGPVG+LI+++ +GTL YSV
Sbjct: 66  GYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSV 125

Query: 126 TQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT 185
           TQSLGEMATFIPVTSSFTVF+QRF+SP++GAA GYMYWFSWA+TFALELS++GQ+IQYWT
Sbjct: 126 TQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT 185

Query: 186 DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEG 245
            AVPL AWI+IFWV++ + NMFPVK+YGE EFW+A IKVIAI+GFL+Y LCMVCGAG  G
Sbjct: 186 YAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTG 245

Query: 246 PIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKA 305
           P+GFRYWR PGPWG GII+K+ N+ARFLGWVSSLI+ AFTYQGTELVGI+AGE  NPRKA
Sbjct: 246 PVGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKA 305

Query: 306 VPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVL 365
           VPRAI KV FRIL FYIGSLFFIGLLVPYND  L  +D  SY+A SPF+IAI N  TPVL
Sbjct: 306 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTD--SYVASSPFIIAIKNSGTPVL 363

Query: 366 PHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFG 425
           PHIFNAVI  TI+SAGNSNVYVGSRILFGLSKN LAPK  S+TTK GVP+IAVL+T+V G
Sbjct: 364 PHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVG 423

Query: 426 FLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKF 485
            LAY+  S   Q  F+WLLNITA+AGF TWL IS+SHIRFMQ LK+RGISRDDLP+KA  
Sbjct: 424 ALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAAL 483

Query: 486 MPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFR 545
           MP                     FAP F+ SDF AAYIS+FLF  +W +FQ I+R +   
Sbjct: 484 MPGLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIH 543

Query: 546 TLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
            +                WE+ EPK +W+KFW + A
Sbjct: 544 KVEDVDIDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/560 (61%), Positives = 420/560 (75%), Gaps = 8/560 (1%)

Query: 25  SARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPE-GSIGQAE--VKRALKPRH 81
           S + GM   + K +  L   +  +   EA+D ++    D + GS G     V+R LKPRH
Sbjct: 5   SEKEGM---SQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRH 61

Query: 82  VSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSS 141
           VSMIALGGTIGTGLFI I  PL NAGPVG+LI+++ +G++AY VTQSLGEMATFIPVTSS
Sbjct: 62  VSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSS 121

Query: 142 FTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLL 201
           FTVF++RF+S  +GAANGYMY FSW++T+ALELSIVGQII+YWT AVP  AWIAIFWV +
Sbjct: 122 FTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPI 181

Query: 202 VSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNG 261
              N+ PVK+YGEF+FW+A IKV+AIIGFL+Y LCMVCGAG  GP+GFRYWR PGPWG+G
Sbjct: 182 TLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWGDG 241

Query: 262 IIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFY 321
           II+ ++++ RFLGWVSSL++AAFTYQGTELVGI+AGE+ NPRK VP+AINKVFFRIL+FY
Sbjct: 242 IISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFY 301

Query: 322 IGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAG 381
           +GSLFFIGLLVP+ND KL  SD  SY A SPF+IAI N  T +LP IFNAVIL TIISA 
Sbjct: 302 VGSLFFIGLLVPFNDEKLTSSD--SYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAA 359

Query: 382 NSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFD 441
           NSNVYVGSR+L+GL+K  LAP+FF++T +HGVP +AVL  A FGFL YL+VSN A + FD
Sbjct: 360 NSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFD 419

Query: 442 WLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXX 501
           WLLNITAIAGF +WL IS+ H+RFMQ LK +GISRDDLP+KAK MP              
Sbjct: 420 WLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLII 479

Query: 502 XXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXX 561
                   AP FNVS+FFAAYISVF+F ++WA+FQ  YRT++   +              
Sbjct: 480 IIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDA 539

Query: 562 XXWEEEEPKNLWEKFWAVAA 581
             W+  EP  LW KFWA  A
Sbjct: 540 QQWDNTEPTTLWGKFWAAMA 559

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/530 (66%), Positives = 406/530 (76%), Gaps = 2/530 (0%)

Query: 52  EAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGS 111
            ++  D    +  +G +  AEVKR LK RH+ MIALGGTIGTGLFI IS PL NAGPVGS
Sbjct: 68  HSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGS 127

Query: 112 LIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFA 171
           LIA++ + T+ +SVTQSLGEMATFIPVTSSFTVFS RFISP++GAANGYMYWFSWAITFA
Sbjct: 128 LIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFA 187

Query: 172 LELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFL 231
           LELS+VGQIIQ+WTDAVPL AWI I+W +L   NMFPVK+YGEFEFWVASIKVIAI+GFL
Sbjct: 188 LELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFL 247

Query: 232 IYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTEL 291
           IY LCMVCGAG  GP+GFRYWR PGPWG GII+  V + RFLGWVSSLI+AAFTYQGTEL
Sbjct: 248 IYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTEL 307

Query: 292 VGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQS 351
           VGITAGE  NPRK VPRAI KV FRILIFYI SLFFIGLLVP++DPKL   D  SY++ S
Sbjct: 308 VGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDD--SYVSSS 365

Query: 352 PFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKH 411
           PF+IAI N  T VLPHIFNAVIL+TIISAGNSN+YVGSR++FGL+K  LAP++F  TTKH
Sbjct: 366 PFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKH 425

Query: 412 GVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKH 471
           GVP+IAVL T+ FG LA+L VS+   + F+WLLNI  +AGF  WLLISI+H+RF+QTL+H
Sbjct: 426 GVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEH 485

Query: 472 RGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIV 531
           RGISRDDLP+KA  MP                     FAP FN SDF AAYISVFLFF +
Sbjct: 486 RGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLFFFL 545

Query: 532 WAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
           W  FQ  +R KL+ +L                WE+  PK  W++FW V A
Sbjct: 546 WVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAPKTFWDRFWDVVA 595

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/519 (67%), Positives = 399/519 (76%), Gaps = 4/519 (0%)

Query: 63  DPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLA 122
           D  G + +A+VKR LKPRH+ MIALGGTIGTGLFI I+ P+ NAGPVGSLIA++ +GTL 
Sbjct: 92  DATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLV 151

Query: 123 YSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQ 182
           +SVTQSLGEMATFIPVTSSFTVF+ RF+S   GAA GYMYWFSWAITFALELS+VGQ+I+
Sbjct: 152 FSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIE 211

Query: 183 YWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242
           +WT  VPL AWI+IFWVL+V  N FPVK YGEFEFWVASIKVIAIIGF+IY LCMVCGAG
Sbjct: 212 FWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAG 271

Query: 243 PEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNP 302
             GP+GFRYWR PGPWG GII+K+ N+ARFLGWVSSLI+AAFTYQGTELVGITAGE  NP
Sbjct: 272 ITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331

Query: 303 RKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRT 362
           RK+VPRAI KV  RIL+FYI SLFFIGLLVPYNDPKL  +D  SY++ SPF+IAI N  T
Sbjct: 332 RKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTD--SYVSASPFIIAIQNSGT 389

Query: 363 PVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITA 422
            VLPHIFNAVILTTIISA NSNVYVGSRIL+GLS   LAPKFF K T++GVPFIAVL TA
Sbjct: 390 KVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTA 448

Query: 423 VFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYK 482
            FG LAY+  S   Q  F+WLLNIT +AGF  WL ISISHIRFMQTLKHRG+SRDDLPYK
Sbjct: 449 AFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYK 508

Query: 483 AKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTK 542
           A  MP                     FAP F+ + F  AYIS FLF  ++ + Q  +RT+
Sbjct: 509 AALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568

Query: 543 LFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
           L+RTL                W EE P+  W+KFWAV A
Sbjct: 569 LWRTLDDVDIDTDRRDIDTVIW-EEGPQTFWDKFWAVIA 606

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/517 (67%), Positives = 405/517 (78%), Gaps = 2/517 (0%)

Query: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124
           EG + +AEVKR LK RH+ MIALGGTIGTGLFI I+ PL NAGPVG+LIA++ + T+ +S
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           VTQSLGEMATFIPVTSSFTVFS RF+SPA+GAANGYMYWFSWA+TFALELS+VGQIIQ+W
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE 244
           T AVPL AWI I+WV+L   N+FPVK+YGEFEFWVASIKV+AIIGFLIY LCMVCGAG  
Sbjct: 209 THAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT 268

Query: 245 GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRK 304
           GP+GFRYWR PGPWG GII+K+VN+ RFLGWVSSLI+AAFTYQGTELVGITAGE  NPRK
Sbjct: 269 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 328

Query: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPV 364
            VPRAI KV FRILIFYI SLFFIGLLVPY+D KL  +D  SYI+ SPF+IAI N  T +
Sbjct: 329 TVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTD--SYISASPFIIAIENSGTKI 386

Query: 365 LPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVF 424
           LPHIFNAVIL+TIISAGNSNVYVGSRILFGL+K  LAPK+F  T++ GVP+ +V  T+ F
Sbjct: 387 LPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSF 446

Query: 425 GFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           G LA+L VS+   + F+WLLNI ++AGF  WLLISI+H+RFMQ LKHRGISRDDLP+KA+
Sbjct: 447 GALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKAR 506

Query: 485 FMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLF 544
           FMP                     FAP FN SDF AAYIS+FLFF +W  FQ  +R+KL 
Sbjct: 507 FMPHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLL 566

Query: 545 RTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
            T+                WE+  PK  W+KFW V A
Sbjct: 567 WTVEEVDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/548 (62%), Positives = 409/548 (74%), Gaps = 5/548 (0%)

Query: 34  NSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGT 93
           NS   +  R  +  +++    +D ++   + +  +   +VKR+LK RH+ MIALGGTIGT
Sbjct: 30  NSNTGELGRRKRKTSVSSTQYEDLAT---EKDELLEHHDVKRSLKQRHIGMIALGGTIGT 86

Query: 94  GLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPA 153
           GLFI I+ PL NAGPVG+L+A++ +GT+ +SVTQSLGEMATFIPVTSSF+VF+QRF+SPA
Sbjct: 87  GLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPA 146

Query: 154 VGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYG 213
           +GAANGYMY+ SW  TFALELS+VGQIIQ+WT  VPL AWI+IFWVLL +FNMFPVK+YG
Sbjct: 147 LGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYG 206

Query: 214 EFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFL 273
           EFEFW+ASIKV+A++GFLIYSLC+VCGAG  GPIGFRYWR PG  G GII+ N  +ARFL
Sbjct: 207 EFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFL 266

Query: 274 GWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVP 333
           GWVSSLI+AAFTYQGTELVGITAGE  NPRKAVPRAI KV  RIL+FYIGSLFFIGL VP
Sbjct: 267 GWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVP 326

Query: 334 YNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILF 393
           YNDPKL  +D  SY++ SPF+I I N  T VLPHIFNAVILTTIISAGNSNVYVGSRILF
Sbjct: 327 YNDPKLTSTD--SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILF 384

Query: 394 GLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFI 453
            ++KN LAPKF +KTT  GVP+++VL  + FG L+Y+ +S    + F+WLLNIT +AGF 
Sbjct: 385 SMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFF 444

Query: 454 TWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF 513
            WLLIS SH+RFMQ LKHRGISRDDLPYKA +MP                     FAPHF
Sbjct: 445 AWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF 504

Query: 514 NVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLW 573
           +  DF AAYISV LF + W  FQ  +R ++   L                WE++ PK LW
Sbjct: 505 SGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLW 564

Query: 574 EKFWAVAA 581
           +KFW   A
Sbjct: 565 DKFWDFVA 572

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/563 (60%), Positives = 416/563 (73%), Gaps = 14/563 (2%)

Query: 22  QSQSARSGMHVSNSKIDDPLRFSKDNNLTLEA---IDDDSSRMFDPEGSIGQAEVKRALK 78
           QS   +  +H +  K+ +    S   +  LE    ID  SS+         +  ++RALK
Sbjct: 4   QSFEKQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQ---------ERGIQRALK 54

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPV 138
           PRHVSMIALGGTIGTGLF+ I+ PL +AGPVGSLI+++ +G+LA+ VTQSLGEMATFIPV
Sbjct: 55  PRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPV 114

Query: 139 TSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFW 198
            SSFTVF++RF+SPA+GAANGYMY FSW ITFALELSIVG+IIQYWT  VP  AWI IFW
Sbjct: 115 ASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFW 174

Query: 199 VLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPW 258
           V +   N+  VK+YGEF+FW+A IKVIAI+GFLIY LCMVCGAG  GP+GFRYWR PGPW
Sbjct: 175 VPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGPVGFRYWRNPGPW 234

Query: 259 GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRIL 318
           G+GII+K+ ++ RFLGWVSSL++AAFTYQGTELVG++AGE+ NPRK VP+AI KVF RIL
Sbjct: 235 GDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRIL 294

Query: 319 IFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTII 378
           +FY+GSLFFIGLLVP+NDPKL+ + N  Y A SPF+IAI N  T  LP IFNAVILTTII
Sbjct: 295 LFYVGSLFFIGLLVPFNDPKLDSTAN--YSASSPFIIAIQNSGTRALPDIFNAVILTTII 352

Query: 379 SAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQE 438
           SA NSNVYVGSR+L+GL+K  LAPK   +  +HGVP+I V I ++FGFL YL+VS+ + +
Sbjct: 353 SAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAK 412

Query: 439 VFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXX 498
            FDWLLNITAIAGF  WL IS+ HIRFMQ LK++GISRDDLP+KAK MP           
Sbjct: 413 AFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFIL 472

Query: 499 XXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXX 558
                     FAP FNVS+FFAAY+SVFLF  VW IFQ I++++L   +           
Sbjct: 473 LIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRRE 532

Query: 559 XXXXXWEEEEPKNLWEKFWAVAA 581
                WE++EP NLW KFWA  A
Sbjct: 533 IEAEVWEDDEPTNLWGKFWAAMA 555

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/513 (65%), Positives = 395/513 (76%), Gaps = 4/513 (0%)

Query: 70  QAE-VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQS 128
           +AE V+R LK RH+ MIALGGTIGTGLFI +S PL NAGPVG+LIA++ + TLAYSVTQS
Sbjct: 23  EAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82

Query: 129 LGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAV 188
           LGEMATFIPVTSSFTVFSQRF+SPA GAANGYMYWFSW ITFALELS+VGQ+IQ+WT AV
Sbjct: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIG 248
           PL AWI+IFWVLL   NMFPVK+YGEFEFWVA +KV+AI+GFLIY  CMVCGAG  GP+G
Sbjct: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVG 202

Query: 249 FRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPR 308
           FRYWR PG +G GIIAK+ N+ARFLGWVSSLI+AAFT+QGTELVGITAGE  NPRK VPR
Sbjct: 203 FRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 262

Query: 309 AINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHI 368
           AI KV FRIL FYI SLFFIGLLVPY+D KL  +D  SY++ SPF+IAI N  T VLPHI
Sbjct: 263 AIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTD--SYVSASPFIIAIENSGTHVLPHI 320

Query: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428
           FNAVI+ TIISAGNSN+YVGSRI++GLS + LAP   S+TT+HGVP++AVL+T++FG LA
Sbjct: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380

Query: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPX 488
           Y+  S   Q+ F+WLLNIT +AGF TWL IS+SHIRFMQ L+ RGISRDDLP+KAK+MP 
Sbjct: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440

Query: 489 XXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLX 548
                               F P +N  DF  AYISVF+F  +W  FQ  +R +L   + 
Sbjct: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499

Query: 549 XXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                          W E+EP+  W+KFW V A
Sbjct: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/520 (64%), Positives = 392/520 (75%), Gaps = 2/520 (0%)

Query: 62  FDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTL 121
           F  EG + +AEVKRALK RH+ MIALGGTIGTGLFI IS PL NAGPVG LIA++ + TL
Sbjct: 66  FVKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATL 125

Query: 122 AYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQII 181
            YSV QSLGEMATFIPVTS+FTVFS RF+SPA GAA+GYMYWFSWAITFALELS+VGQII
Sbjct: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185

Query: 182 QYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGA 241
           ++WT AVP+ AWI IFWVLL   N+FPVK+YGEFEFW+A IKVIA++GF+IY LCMVCGA
Sbjct: 186 EFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245

Query: 242 GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKN 301
           G  GP+GFRYWR PG WG GII+K+ N+ RFLGWVSSLI+AAFTYQGTELVGITAGE  N
Sbjct: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305

Query: 302 PRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCR 361
           PRK+VPRAI KV FRIL+FY     FIGLLVPYNDPKL  + + SY++ SPF+IAI N  
Sbjct: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSG 363

Query: 362 TPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLIT 421
           T VLPHIFNAV+LTTIISAGNSNVYVGSRI++GL+K  LAP FF +T   GVP+ AV  T
Sbjct: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423

Query: 422 AVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           + FG LAY+ +S      F+WLLNIT +AGF TW+LIS  HIRFMQ LK+RGISRDDLP+
Sbjct: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483

Query: 482 KAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRT 541
           KAKFMP                     FAP F+  DF AAY+SVFLF  +W   Q  +R 
Sbjct: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRC 543

Query: 542 KLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
           ++F  L                W++E PK LW+KFW + A
Sbjct: 544 RIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/548 (60%), Positives = 406/548 (74%), Gaps = 5/548 (0%)

Query: 34  NSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGT 93
           + K++D   +     L + +   D++     EG   + EVKRALKPRH+SMIALGGTIGT
Sbjct: 20  SKKLED---YVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIALGGTIGT 76

Query: 94  GLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPA 153
           GLF+ I+ PL  +GPVG+LIA++ IG++ Y VTQSLGEMATFIPVTSS TVFS+RF+SPA
Sbjct: 77  GLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPA 136

Query: 154 VGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYG 213
            G ANGYMYWF+WAIT+A+E+++VGQ+IQYWTDAVPL AWIAIFWVL+   N FPVK+YG
Sbjct: 137 FGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFPVKFYG 196

Query: 214 EFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFL 273
           E EFWVAS+KVIAI+G+LIY+L +VCG   +GPIGFRYWR PGPWG GII+K+VN+ RFL
Sbjct: 197 EVEFWVASVKVIAIVGYLIYALVIVCGGSHQGPIGFRYWRNPGPWGPGIISKDVNEGRFL 256

Query: 274 GWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVP 333
           GWVSSLI+AAFTYQGTELVGITAGE  NPRK VPRAINKVFFRIL FYI SLFFIGLLVP
Sbjct: 257 GWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLVP 316

Query: 334 YNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILF 393
           Y+D +L  S+  + IA SPF+I+I N  T VLPHIFNA+++ TIISA NSNVYVGSR+L+
Sbjct: 317 YDDLRL--SNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLY 374

Query: 394 GLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFI 453
            L+ +  APK F   TK GVP++ V++TA+ G LA+L V+N+A E F+WL+NI+ +AG  
Sbjct: 375 SLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLC 434

Query: 454 TWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF 513
            WL IS+SH+RFMQ LKHRGISR+DLP+KAK MP                     F P F
Sbjct: 435 AWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTPKF 494

Query: 514 NVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLW 573
            VSDFF +YIS+ L  +++   Q  YR +   +L                WE++EPKNLW
Sbjct: 495 RVSDFFTSYISLILLAVLFLGCQLFYRCRFIWSLDDIDIDSDRREIDAIVWEDDEPKNLW 554

Query: 574 EKFWAVAA 581
           EKFW   A
Sbjct: 555 EKFWVAVA 562

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/517 (62%), Positives = 396/517 (76%), Gaps = 2/517 (0%)

Query: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124
           E  +    VKRALKPRH++MIALGGTIGTGLF+ I+ PL NAGPVG+LIA++ +GT+ +S
Sbjct: 85  EEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFS 144

Query: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           VTQSLGEM TFIPVTSSFTVFS RF+SPA GAANGYMYWFSWA+TFA+ELS++G++IQ+W
Sbjct: 145 VTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFW 204

Query: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE 244
           T AVPL AWI IFW LL   NMFPVK+YGE EFW+A +KV++++GFLI+ LC+  GAGP 
Sbjct: 205 TTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPH 264

Query: 245 GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRK 304
           GP GFRYWR PG WG GIIA++ ++ARFLGWVSSLI+AAFTYQGTELVGITAGE  NPRK
Sbjct: 265 GPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 324

Query: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPV 364
           AVP+AI KV  RIL FY+GSLFFIG+LVP+NDPKL  +   S+++ SPF+IAI N    +
Sbjct: 325 AVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSAT--SFVSSSPFIIAIQNSGVSL 382

Query: 365 LPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVF 424
           LP IFN VIL TIISAGNSNVYVGSRILFGL+ +NLAP+FF++TTK GVPF+AVL T++F
Sbjct: 383 LPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLF 442

Query: 425 GFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           G LA+L ++ D  +VF+WLL+I AIAGF  WLLIS+SHIRFM+ L++RGISR+ LP+KA 
Sbjct: 443 GSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAI 502

Query: 485 FMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLF 544
           FMP                     FAP FNVSDF A+YIS+ LF I+W +FQ + + ++F
Sbjct: 503 FMPWLAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIF 562

Query: 545 RTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
             +                WE++ PK  W K W   A
Sbjct: 563 WKVEDIDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/575 (61%), Positives = 418/575 (72%), Gaps = 18/575 (3%)

Query: 18  SNLSQSQSARSGMHV-SNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPE----GSIGQAE 72
           S+ S  +  +SG+   S    DD ++      + +    D SS   D E    GS+  AE
Sbjct: 7   SSQSVPRQRKSGVQTFSTMSQDDDMK-----KINIIQQTDASSTTEDEEMLNSGSVHDAE 61

Query: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132
           VKR LK RH+ MIALGGTIGTGLFI IS PL ++GPVGSLIA++ +GTL Y+VTQSLGEM
Sbjct: 62  VKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121

Query: 133 ATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEA 192
           ATFIPVTSSFTVF+ RF+SP++GAA GYMYWFSWA+TFALELS+VGQI+ YWT AVP+ A
Sbjct: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181

Query: 193 WIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYW 252
           WI+IFWV+L + NMFPVK+YGE EFWVA++KV+AI+GFLIY LCMVCGAG  GP+GFRYW
Sbjct: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYW 241

Query: 253 RKPGPWGNGI------IAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAV 306
           R PGPWG+G+      I+KN N  RFLGW +SLI+AAFTYQGTELVGITAGE  NPRK V
Sbjct: 242 RNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTV 301

Query: 307 PRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLP 366
           PRAI KV FRIL+FYIGSLFFIGLLVP++DPKL  S + SY++ SPF+IAI N  T +LP
Sbjct: 302 PRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKL--SSDDSYVSSSPFIIAIENSGTKILP 359

Query: 367 HIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGF 426
            IFNA+IL TIISAGNSN+YVGSRILF L+K  LAPK  S+TTK GVP+++VL TAVFG 
Sbjct: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGV 419

Query: 427 LAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFM 486
           LAY+  +   Q VFDWL+NITAIAGF  WL I ISHIRFMQ LK RGISRDDLP+KA  M
Sbjct: 420 LAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLM 479

Query: 487 PXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRT 546
           P                     F P F+VSDFFAAYISV LFF++W  FQ  ++ +    
Sbjct: 480 PGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWK 539

Query: 547 LXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
           L                WE+ EPK  W+KFW V A
Sbjct: 540 LEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/563 (58%), Positives = 413/563 (73%), Gaps = 14/563 (2%)

Query: 17  HSNLSQSQSARSG-MHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKR 75
           H++ S   S  S  +H      ++ +  +++N   +E++  +     DP+       VKR
Sbjct: 16  HNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGND----DPD-------VKR 64

Query: 76  ALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATF 135
            LKPRH+SMI+LGGTIGTGLF+ I+ P+  AGPVGSL+A++ +GT+A+ VTQSLGEMATF
Sbjct: 65  DLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATF 124

Query: 136 IPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIA 195
           IPVTSSFT+++QRF+SPA+GAANGY+YWFSW +TFALELSI+GQ+IQYWT AVPL  WI 
Sbjct: 125 IPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIV 184

Query: 196 IFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKP 255
           +FW+LL + NM PV++YGE EFW+A++KV++I GFLIY+L MVCG   EG +GFRYW+ P
Sbjct: 185 VFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNP 244

Query: 256 GPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFF 315
           GPWG G+I+ N  +ARFLGWVSSLI AAFTYQGTELVGITAGE+KNPRK VP+AINKVFF
Sbjct: 245 GPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFF 304

Query: 316 RILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILT 375
           RIL FYI SLFF+GLLVPY DP+L  + + S I  SPF++AI N  T VLP +FN VIL 
Sbjct: 305 RILFFYILSLFFVGLLVPYTDPRLSTTSD-SDINTSPFVMAIQNSGTKVLPSVFNGVILV 363

Query: 376 TIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSND 435
           TI+SAGNSN+Y+GSR+L+GLSK+ LAP  F KT K GVPF AVL +++FG LAYLN+S +
Sbjct: 364 TILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQN 423

Query: 436 AQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXX 495
           A++VFDWLL ITA+AGF  WLLIS+SHIRFMQ LK RGISR+DLP+KAKFMP        
Sbjct: 424 AKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAF 483

Query: 496 XXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXX 555
                        FAP F  S+F A YISVFLF + W  FQ +++T+L            
Sbjct: 484 FITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTD 543

Query: 556 XXXXXXXXW-EEEEPKNLWEKFW 577
                   W +++EPK L +K W
Sbjct: 544 RREIDALVWSDDDEPKTLLQKLW 566

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/510 (62%), Positives = 385/510 (75%), Gaps = 2/510 (0%)

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
           EVKR L  RH++MIALGGTIGTGLF+ I+ PL  +GPVGSLIA++ +GT+ YSVTQSLGE
Sbjct: 59  EVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118

Query: 132 MATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           MATFIPVT+SFT+FS RF+SPA+GAANGYMYWFSWA+TFALELS+VGQIIQ+WT AVPL 
Sbjct: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRY 251
           AWI+IFWV+L   N+FPV+ YGE EFW+A +KV AI+GF+IY  C+VCGAG  GP+GFRY
Sbjct: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRY 238

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311
           WR PGPWG GII+ N+ +ARFLGW SSLI+AAFT+QGTELVGITAGE  NPR+ VP+AI 
Sbjct: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298

Query: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNA 371
           KV FRIL+FYI SLFFIGLLVPY+D KL+  +  SY++ SPF+IAI N  T +LPHIFN 
Sbjct: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSEN--SYVSSSPFIIAIENSGTKILPHIFNG 356

Query: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
           VIL TIISAGNSNVY+GSR+LFGL+KN   PK F+KTTK GVP  AV+ T++FG LA++ 
Sbjct: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXX 491
            S    E F WLLN+  +AGF +WLLIS +HIRFMQ L+ RGISR+DLP+KAKFMP    
Sbjct: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476

Query: 492 XXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXX 551
                            FAP F+V +FFA+YISVFLFFI W  FQ  ++ +    L    
Sbjct: 477 YATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDID 536

Query: 552 XXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                       W++  P NLW KFW   A
Sbjct: 537 IDKDRREIEDRVWQDTTPANLWGKFWDFVA 566

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/558 (60%), Positives = 407/558 (72%), Gaps = 6/558 (1%)

Query: 25  SARSGMHVSNSKI-DDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVS 83
           S  SG     SK  +D +  S D  ++ E  D   S   + EG   + EVKRALKPRHVS
Sbjct: 27  STDSGTLSKRSKAGEDSIELS-DVQVSSELYDHAESE--EGEGDFHETEVKRALKPRHVS 83

Query: 84  MIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFT 143
           MIALGGTIGTGLF+ I+ PL  +GPVGSLIA++ +G++ Y VTQSLGEMATFIPVTSS T
Sbjct: 84  MIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSIT 143

Query: 144 VFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVS 203
           VFS+RF+SPA G ANGYMYWF+WAIT+A+ELS++GQII YWTDAVPL AWIAIFWVLL +
Sbjct: 144 VFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTA 203

Query: 204 FNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGII 263
            N FPVKWYGEFEF VASIKVIAI+G+L+Y+L +VCG   +GPIGFRYWR PGPWG G I
Sbjct: 204 ANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGTI 263

Query: 264 AKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIG 323
           AKNVNKARFLGWV SL++A+FTYQGTELVGITAGE  NPRK VP+AINKVFFRIL+FYIG
Sbjct: 264 AKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIG 323

Query: 324 SLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNS 383
           SLFF+GLLVPYN P+LE   N + IA SPF+I+I N  T VLP IFNAV+L TI+SAGNS
Sbjct: 324 SLFFVGLLVPYNSPQLE--SNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNS 381

Query: 384 NVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWL 443
           NVYVGSR+L+ L+ +  APK FS  TK GVP++ V+ TA+ G LA+L  + +A   F+WL
Sbjct: 382 NVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWL 441

Query: 444 LNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXX 503
           +NI+ +AG   W  IS++HIRFMQ LK RGISRD LP+KAK MP                
Sbjct: 442 INISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFI 501

Query: 504 XXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXX 563
                FAP F+VS+FF AYIS+ L  +++ + Q  YR +    +                
Sbjct: 502 QGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAII 561

Query: 564 WEEEEPKNLWEKFWAVAA 581
           WE++EPKNLWEKFW   A
Sbjct: 562 WEDDEPKNLWEKFWVALA 579

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/545 (57%), Positives = 398/545 (73%), Gaps = 8/545 (1%)

Query: 44  SKDNN---LTLEAIDDDSSRMF----DPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLF 96
           +K NN   + LE+I  DS   F    + EG   + EVKRALK RH+SMIALGGTIGTGLF
Sbjct: 24  AKGNNGSEIALESITPDSGDEFPEEHEQEGDYHETEVKRALKARHISMIALGGTIGTGLF 83

Query: 97  ISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGA 156
           I I+ PL  AGPVGSLIA++ +GT+ YS+TQSLGEMATFIPVTSS TVFS+RF+SPA G 
Sbjct: 84  IVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGV 143

Query: 157 ANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFE 216
           ANGYMYWF+WAITFA+ELS+VGQII YWT  VPL AWI IFW+++   N FPV++YGE E
Sbjct: 144 ANGYMYWFNWAITFAVELSVVGQIINYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIE 203

Query: 217 FWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWV 276
           FW+AS+KVI I+G+LIY+  +VCG   +GPIGFR WR PGPWG G+I+ N  +ARFLGWV
Sbjct: 204 FWIASVKVITIVGYLIYAFIVVCGGSSQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWV 263

Query: 277 SSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYND 336
           SSLI AAFTYQGTELVGITAGE+KNPRK VP+AINKVFFRIL FYI SLFF+GLLVPYND
Sbjct: 264 SSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYND 323

Query: 337 PKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLS 396
           P+++ + +   +  SPF+I+I N  T +LP IFNAV+L T++SA NSNVY+GSR+++ L+
Sbjct: 324 PRMDNTSDTD-VNASPFVISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLA 382

Query: 397 KNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWL 456
           ++  APK F    +HGVP + V++TA+ G +A+L V+N+A+  F+WL+NI+ +AG   WL
Sbjct: 383 QSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWL 442

Query: 457 LISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVS 516
            IS++HIRFMQ LK RGISRD LP+KAKFMP                     F+P F+V+
Sbjct: 443 FISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAFSPKFDVT 502

Query: 517 DFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKF 576
            FF AYIS+ L  +V+   Q  Y+ +    L                WE++EPKNLW+KF
Sbjct: 503 QFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDTNRREIDAIVWEDDEPKNLWDKF 562

Query: 577 WAVAA 581
           W+  A
Sbjct: 563 WSTIA 567

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/543 (58%), Positives = 391/543 (72%), Gaps = 2/543 (0%)

Query: 39  DPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFIS 98
           D  +    +N T       +S   D EG + + +VKRALKPRHVSMIALGGTIGTGLF+ 
Sbjct: 20  DEFQMYVYSNETQNGGSGHNSSFEDDEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVG 79

Query: 99  ISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAAN 158
           I+ PL +AGPVG+LIA++ +G++ Y VTQS+GEMATFIPVTSS TVFS RF+SPA G AN
Sbjct: 80  IASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVAN 139

Query: 159 GYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFW 218
           GYMYWF+WAIT+A+E+S++GQ+IQYWT AVPL AWI IFWV +   N FPV++YGE EFW
Sbjct: 140 GYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFW 199

Query: 219 VASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSS 278
           VASIKVIAI+G+L+Y+L +VCG   +GPIGFRYWR PGPWG+GII+ + +K RFLGWV+S
Sbjct: 200 VASIKVIAIVGYLLYALIIVCGGSKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVAS 259

Query: 279 LISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPK 338
           LI+A+FTYQGTELVGITAGE  NPRK VP+AINKVFFRIL FYI SLFF+GLLVPYN P 
Sbjct: 260 LINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPG 319

Query: 339 LEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKN 398
           L+   + S IA SPF+I+I +  T +LP IFNAV+L TIISA NSNVYVGSRILF L+  
Sbjct: 320 LD--KHTSVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHT 377

Query: 399 NLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLI 458
            +APK FS  T  GVP++ V+ TA+ G LA+L V ++A E F+WL+NI+ +AG   WL I
Sbjct: 378 GIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFI 437

Query: 459 SISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDF 518
           SISHIRFMQ LK RGISRDDLP+K+K MP                     F P F V++F
Sbjct: 438 SISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEF 497

Query: 519 FAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWA 578
           F  YIS+ L  +V+ + Q  YR + F  L                WEEEEP  LW KFW 
Sbjct: 498 FTGYISLILLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREIDALIWEEEEPTTLWGKFWV 557

Query: 579 VAA 581
             A
Sbjct: 558 AVA 560

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/541 (60%), Positives = 399/541 (73%), Gaps = 14/541 (2%)

Query: 44  SKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103
           S D   T+  +DDD  +         Q +VKR LK RH+SMIALGGTIGTGLF+ I+ PL
Sbjct: 15  SNDTPTTISTLDDDQEK---------QQDVKRELKKRHISMIALGGTIGTGLFLGIARPL 65

Query: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYW 163
             AGP+G+LIA++ +GT+ +SVTQSLGEM TFIPVT+SFTVF+QRF+SPA GAANGYMYW
Sbjct: 66  IIAGPIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYW 125

Query: 164 FSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223
           FSWA+TFALELS+VGQIIQ+WT AVPL AWI+I WVLL   N+FPV+ YGE EFW+AS+K
Sbjct: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185

Query: 224 VIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAA 283
           V+AI+GF+IY +C++CGAG  GP+GFRYW+ PGPWG GII+ NVN+ARF GWVSSLI+AA
Sbjct: 186 VLAILGFIIYGICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245

Query: 284 FTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSD 343
           FT+QGTELVGITAGE + PRK VP+AI KV FRIL+FYIGSL  IGLLVPYNDPKL+ +D
Sbjct: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSND 305

Query: 344 NGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPK 403
             SY++ SPF+I I N  T +LPHIFNAVIL TIISAGNSNVY+GSRIL+GL+KN  APK
Sbjct: 306 --SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363

Query: 404 FFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHI 463
           FF+ T+K GVP++ VL T++FG LAY+  +    + F WLLNI  +AGF  WLLIS SHI
Sbjct: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423

Query: 464 RFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYI 523
           RFM+ LK RGISR+DLPYKA  MP                     FAP F V++FFAAYI
Sbjct: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYI 483

Query: 524 SVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWE---EEEPKNLWEKFWAVA 580
           SVFLF I W  FQ  ++ +L   L                W    E++ KN W++FW   
Sbjct: 484 SVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYV 543

Query: 581 A 581
           A
Sbjct: 544 A 544

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/567 (57%), Positives = 401/567 (70%), Gaps = 8/567 (1%)

Query: 17  HSNLSQSQSARSGMHVSNSKIDD--PLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVK 74
           HS   +   A +G     +  DD     +S+D   T    D   S     EG + + +VK
Sbjct: 61  HSRARRGSGATAGEPKLKAHSDDFEMYVYSQDEPST----DPLGSDTESGEGDMQEGKVK 116

Query: 75  RALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT 134
           RALKPRHVSMIALGGTIGTGLF+ I+ PL  +GPVG+LIA++ +GT+ Y VTQS+GEMAT
Sbjct: 117 RALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVTQSMGEMAT 176

Query: 135 FIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWI 194
           FIPVTSS TVFS RF+SPA G ANGYMYWF+WAITFA+ELS+ GQ+I+YWT+AVP  AWI
Sbjct: 177 FIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWTEAVPRAAWI 236

Query: 195 AIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRK 254
           AIFWVL+   N FPV++YGE EFWVASIKV+AI+G+LIY+L +VCG   +GPIGFRYWR 
Sbjct: 237 AIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGSKQGPIGFRYWRN 296

Query: 255 PGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVF 314
           PGPWG GII+K+ ++ RFLGWV+SLI+A+FTYQGTELVGITAGE  NPR+ VPRAINKVF
Sbjct: 297 PGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRTVPRAINKVF 356

Query: 315 FRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVIL 374
           FRIL FYI SLFF+GLLVPYN   L+ +   + IA SPF+I+I N  T  LP IFNAV+L
Sbjct: 357 FRILFFYILSLFFVGLLVPYNHSSLDKTT--TVIASSPFVISIQNAGTRALPDIFNAVVL 414

Query: 375 TTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSN 434
            TIISA NSNVYVGSR+LF L+   +APK FS  T  GVPF+ V++T++ G LA+L V++
Sbjct: 415 VTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLAFLVVNH 474

Query: 435 DAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXX 494
           +A E F+WL+NI+ +AG   WL ISISHIRFMQ LK RGISRDDLP+K+K MP       
Sbjct: 475 NANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAA 534

Query: 495 XXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXX 554
                         F+PHF V++FF +YIS+ L  +V+   Q  YR + F  L       
Sbjct: 535 FWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRLEDIDIDS 594

Query: 555 XXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                    WE++EP  LW KFW   A
Sbjct: 595 DRREADALIWEDDEPTTLWGKFWTAVA 621

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/577 (56%), Positives = 406/577 (70%), Gaps = 19/577 (3%)

Query: 18  SNLSQSQSARSGMHVSNSKIDDPLR---------FSKDNNLTLEAIDDDSSRMFDPE--- 65
           +NLS + S  +  + S++ ++   R         FS   +  +   D+ S+   D +   
Sbjct: 23  NNLSTTASNTNKKYDSDTDMEPSQRKKAAMAGKLFSDQLSYNVSVADNSSAANGDLDLSD 82

Query: 66  ----GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTL 121
               G +    VKRALK RH+ MIALGGTIGTGLF+ IS PL NAGPVG+LIA++ +G++
Sbjct: 83  TEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSI 142

Query: 122 AYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQII 181
            Y +TQSLGEMATFIPVTSS TVFS+RF+SPA G  NGYMYWF+WAIT+A+E+S+VGQ+I
Sbjct: 143 IYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVI 202

Query: 182 QYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGA 241
           QYWTDAVPL AWIAIFWV +   N FPVK YGE EFWVASIKV+AIIG+LIY+L +VCG 
Sbjct: 203 QYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGG 262

Query: 242 GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKN 301
             +GPIGFRYWR PGPWG GII+K+VN+ RFLGWVSSLI+AAFTYQGTELVGITAGE  N
Sbjct: 263 SSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 322

Query: 302 PRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCR 361
           PRK+VPRAINKV FRI +FYI SLFFIGLLVPYND  L   D  SYIA SPF+I+I N  
Sbjct: 323 PRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGD--SYIASSPFVISIQNAG 380

Query: 362 TPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLIT 421
           T  LP IFNAV++ TIISA NSNVYVGSR+L+ L++   APK F+  TKHGVP++ V++T
Sbjct: 381 TYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVT 440

Query: 422 AVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           A  G LA+L V+N+A   F+WL+NI+ +AG   W  I++SHIRFMQ LK+RGISRDDLP+
Sbjct: 441 ASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPF 500

Query: 482 KAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRT 541
           KAK MP                     F P ++ + FF +YIS+ L  +V+   Q  YR 
Sbjct: 501 KAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRC 559

Query: 542 KLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWA 578
           +    +                WE++EPKNLWEKFWA
Sbjct: 560 RFLLKVEDIDIDTDRREIEAIIWEDDEPKNLWEKFWA 596

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/566 (57%), Positives = 402/566 (71%), Gaps = 8/566 (1%)

Query: 17  HSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNL----TLEAIDDDSSRMFDPEGSIGQAE 72
           ++N  +  S +  + +  SK+ +       +NL    T    DD+ S     E       
Sbjct: 46  NTNSFKDSSDKPPITLRKSKLSEIGSLHSGSNLHQHGTTSLHDDEESDT--EEAQYQDTR 103

Query: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132
           VKRALK RH+ MIALGGTIGTGLF+ I+ PL NAGPVGSLIA++ +G++ Y VTQSLGEM
Sbjct: 104 VKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEM 163

Query: 133 ATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEA 192
           ATFIPVTSS TVFS+RF+SPA G ANGYMYWF+WAIT+A+E+S++GQ+IQYWT AVPL A
Sbjct: 164 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAA 223

Query: 193 WIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYW 252
           WI IFWV++   N FPVK YGEFEFW+ASIKV+AI+G+LIY+L +VCG   +GPIGFRYW
Sbjct: 224 WIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSHQGPIGFRYW 283

Query: 253 RKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINK 312
           R PGPWG GII+    +ARFLGWVSSLI+AAFTYQGTELVGITAGE  NPRK+VPRAINK
Sbjct: 284 RNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINK 343

Query: 313 VFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAV 372
           V FRI +FYI SLFFIGLLVP+ND +L  +++ + IA SPF+I+I N  T  LP IFNAV
Sbjct: 344 VVFRIALFYIMSLFFIGLLVPFNDDRL--ANDSAVIASSPFVISIQNAGTRALPDIFNAV 401

Query: 373 ILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNV 432
           +L TIISA NSNVYVGSR+L+ L+    APK FS  TK+GVP++ V+ TA  G LA+L V
Sbjct: 402 VLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVV 461

Query: 433 SNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXX 492
           +N+A   F+WL+NI+ +AG   WL IS+SHIRFMQ LK+RGISRDDLP+KAK MP     
Sbjct: 462 NNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYY 521

Query: 493 XXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXX 552
                           F P F+VS FF +YIS+ L  ++++  Q  YR +    +     
Sbjct: 522 ASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDI 581

Query: 553 XXXXXXXXXXXWEEEEPKNLWEKFWA 578
                      WEE+EPKNLWEKFWA
Sbjct: 582 DSDRREIEAIIWEEDEPKNLWEKFWA 607

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/549 (58%), Positives = 396/549 (72%), Gaps = 8/549 (1%)

Query: 33  SNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIG 92
           S  K +D   +  DN   +    DDS      +G +   EVKRALKPRH+ MIALGGTIG
Sbjct: 40  SPPKENDGYGYRVDNEYDV----DDSVD--GEKGEVRSTEVKRALKPRHIGMIALGGTIG 93

Query: 93  TGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISP 152
           TGLF+ IS PL NAGPVG LIA++ + T+A+SV QSLGEMAT+IPVTS+F+VFSQRF+SP
Sbjct: 94  TGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSP 153

Query: 153 AVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWY 212
           A GAANGYMYWFSW+ITFALELS++GQI+QYWT  VP+ AWI+IFWVL+   N  PVK+Y
Sbjct: 154 AFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPVKFY 213

Query: 213 GEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARF 272
           GEFEFW+A IKV+AI+GF+IY   MVCGAG  GP+GFRYWR    +G+GII+KN N+ARF
Sbjct: 214 GEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKTGPVGFRYWRHGYAFGDGIISKNKNEARF 273

Query: 273 LGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLV 332
           LGWVSSLI+AAFTYQGTELVGITAGE  NPRK VP++I +  +RILIFYI SL F+GLLV
Sbjct: 274 LGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLV 333

Query: 333 PYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRIL 392
           P+ND  L+  D+ SY A SPF++AI N  T  LP IFNAVILTT+ISA NS+VYVGSR++
Sbjct: 334 PFNDHGLQ--DSRSYAASSPFILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVM 391

Query: 393 FGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGF 452
           + +++N LAP   +K +K GVP+ AVL T+  G LAYL  S+    VF+WL+NIT +AGF
Sbjct: 392 YSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGF 451

Query: 453 ITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPH 512
            +W LIS SH+RFM+ LK RGISR+DLP+KA FMP                     F PH
Sbjct: 452 FSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTPH 511

Query: 513 FNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNL 572
           F  SDF A+YISV LFF++WA+FQ  +R  L   +                WE+E PK L
Sbjct: 512 FQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDAEVWEDEPPKTL 571

Query: 573 WEKFWAVAA 581
           W+KFW + A
Sbjct: 572 WDKFWNIVA 580

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/510 (62%), Positives = 383/510 (75%), Gaps = 3/510 (0%)

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
            VKRALK RH+ MIALGGTIGTGLF+ IS PL NAGPVGSLIA++ +GT+ Y +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 132 MATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           MATFIPVTSS TVFS+RF+SPA G +NGYMYWF+WAIT+A+E+S++GQ+IQYWTD VPL 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRY 251
           AWIAIFWVL+   N FPVK YGEFEFWVAS+KV+AI+G+LIY+L +VCG   +GPIGFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311
           WR PG WG GII+KN ++ RFLGWVSSLI+AAFTYQGTELVGITAGE  NPRK VPRAIN
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNA 371
           KV FRI+IFYI SLFFIGLLVPYN+P+L  S + + IA SPF+I+I N  T  LP IFNA
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRL--SPSSAVIASSPFVISIQNAGTYALPDIFNA 402

Query: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
           V+L T+ISA NSNVYVGSR+L+ L+++  APK F   TK GVP++ VL TA  G LA+L 
Sbjct: 403 VVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLV 462

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXX 491
           V+N+A   F+WL++I+ +AG   WL IS++HIRFMQ LK RGISRDDLP+KAK MP    
Sbjct: 463 VNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAY 522

Query: 492 XXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXX 551
                            F P F+VS+FF +YIS+ L  +V+   Q  Y+ +    L    
Sbjct: 523 YASFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDID 581

Query: 552 XXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                       WE++EPKNLWEKFWA  A
Sbjct: 582 IDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/514 (61%), Positives = 388/514 (75%), Gaps = 2/514 (0%)

Query: 68  IGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQ 127
           +    VKRALK RH+ MIALGGTIGTGLF+ IS PL N+GPVG+LIA++ +GT+ Y VTQ
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 128 SLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDA 187
           SLGEMATFIPVTSS TVFS+RF+SPA G ANGYMYWF+WAIT+A+E+S++GQ+IQYWT  
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 188 VPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPI 247
           VPL AWI IFWVL+   N FPVK YGEFEFWVASIKVIAI+G+LIY+L +VCG   +GPI
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 248 GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307
           GFRYWR PG  G GII+ ++ +ARFLGWVSSLI+AAFTYQGTELVGITAGE  NPRK+VP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367
           RAINKV FRI++FYI SLFF+GLLVPYNDP+L  S   + IA SPF+I+I N  T VLP 
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASS--AVIASSPFVISIQNAGTKVLPD 383

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
           IFNAV+L T+ISA NSNVYVGSR+L+ L+++  APK F+  T+HGVP++ V+ TA+ G L
Sbjct: 384 IFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLL 443

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMP 487
           A+L V+++A   F+WL+NI+ +AG   WL IS++HIRFMQ LK RGISRDDLP+KAKFMP
Sbjct: 444 AFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMP 503

Query: 488 XXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTL 547
                                FAP F+VS+FF AYIS+ L  +++A  Q  YR +    L
Sbjct: 504 WGAYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKL 563

Query: 548 XXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                           WE++EP+NLWEKFWA  A
Sbjct: 564 EDIDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/534 (58%), Positives = 397/534 (74%), Gaps = 1/534 (0%)

Query: 44  SKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103
           +K   +  E ++ ++S +        Q++VKR LKPRHV+MI+LGGTIGTGLFI I+ P+
Sbjct: 20  AKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPI 79

Query: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYW 163
            NAGPVGSL+A++ + T+AY VTQSLGEMATFIPVTSSFTVF+ RF+SPA+GAANGY+YW
Sbjct: 80  RNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYW 139

Query: 164 FSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223
            SW ITFALE+S++G++I YW+DAVP+ AW+AIFWVLL + N+ PVK+YGEFEFW+AS+K
Sbjct: 140 LSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLK 199

Query: 224 VIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAA 283
           VIAI+ FL Y L +VCG    G IGFRYW+ PGPWG GI+++ ++ A+FLGWVSSLI AA
Sbjct: 200 VIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAA 259

Query: 284 FTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSD 343
           FT+QGTELVG+TAGETKNPR+ VP+AIN VFFRIL+FYIGSL  IGLLV Y+DP+L    
Sbjct: 260 FTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDG 319

Query: 344 NGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPK 403
           + +    SPF++AI    T VLP I N VI+ TIISAGNSN+YVGSR+L+GL ++ LAP 
Sbjct: 320 STTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPA 379

Query: 404 FFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHI 463
           F S+TT  GVP++AVL T++FG L YLNVS+ +  VFDWLL+ITA++GF TWLLIS+SHI
Sbjct: 380 FISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHI 439

Query: 464 RFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYI 523
           RFMQ LK RGISRDDLP+KAKFMP                     F P F+  DF A YI
Sbjct: 440 RFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYI 498

Query: 524 SVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFW 577
           S F+F ++W +FQ +++ + F T+                W++++P  LW K W
Sbjct: 499 SAFIFVVIWLLFQFLFKGRWFHTVDEIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/525 (59%), Positives = 389/525 (74%), Gaps = 3/525 (0%)

Query: 58  SSRMFD-PEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFM 116
           SS  +D  E      +VKRALKPRH+ MIALGGTIGTGLFI IS PL  +GPVGSLIA++
Sbjct: 86  SSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYI 145

Query: 117 LIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSI 176
            +GT+ Y VTQ+LGEMATFIPVTSS TVFS RF+SPA G +NGY+YWF+WAIT+A+E+S+
Sbjct: 146 FMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISV 205

Query: 177 VGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLC 236
           VGQ+I++WT  VPL AWI+IFWVL+ + N FPV  YGE EFWVAS+KV+AI+G+LIY+L 
Sbjct: 206 VGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALV 265

Query: 237 MVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITA 296
           +VCG   +GPIGFRYWR     G G+I+K+ N+ARFLGWV+SLI+AAFTYQGTELVGITA
Sbjct: 266 IVCGGSKQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITA 325

Query: 297 GETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIA 356
           GE  NPRK+VPRAINKV FRI+IFYI SLFFIGLLVPYNDPKL  +   SYIA SPF+I+
Sbjct: 326 GEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSAT--SYIASSPFVIS 383

Query: 357 ILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFI 416
           I N  T  LPHIFNA+I+ TIISA NSNVYV SR+L+ L+ +  APK F++ T  GVPF+
Sbjct: 384 IENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFL 443

Query: 417 AVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISR 476
            V++TA+ G LA+L V+N+A E F+WL+NI+ +AG   WL IS+SH+RFM+ LK+RGISR
Sbjct: 444 GVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISR 503

Query: 477 DDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQ 536
           DDLP+KA+FMP                     F+P F+V+ FF AYIS+ L  +++   Q
Sbjct: 504 DDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQ 563

Query: 537 TIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
             YR + F  +                WE++EPK  W+KFWA  A
Sbjct: 564 LYYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/512 (60%), Positives = 383/512 (74%), Gaps = 2/512 (0%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
             +VKRALK RH+ MIALGGTIGTGLFI I+ PL N+GPVGSLIA++ +G++ Y +TQSL
Sbjct: 90  DTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSL 149

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVP 189
           GEMATFIPVTSS TVFS+RF+SPA G ANGYMYWF+WAITFA+E+S+VGQ+I+YWTD VP
Sbjct: 150 GEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKVP 209

Query: 190 LEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF 249
           L AWIAIFWVL+   N FPVK YGE EFW+A IKV+AI+G+L+Y+L +VCG   +GPIGF
Sbjct: 210 LAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIGF 269

Query: 250 RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRA 309
           RYWR PGPWG GII+K+VN  RFLGWVSSLI+AAFTYQGTELVGITAGE  NPRK VPRA
Sbjct: 270 RYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 329

Query: 310 INKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIF 369
           INKV FRI +FYI SLFFIG+LVPYND +L  +   + IA SPF+I+I N  T VLP IF
Sbjct: 330 INKVVFRIALFYIMSLFFIGMLVPYNDERL--ASTSAVIASSPFVISIQNAGTKVLPDIF 387

Query: 370 NAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAY 429
           NA+++ TIISA NSNVYVGSR+L+ L+ +  APK F+  T++GVP++ V++T+  G LA+
Sbjct: 388 NAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAF 447

Query: 430 LNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXX 489
           L V+N+A   F+WL+NI+ +AG   WL ISISHIRFMQ LK RGISRDDLP+KAK MP  
Sbjct: 448 LVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFG 507

Query: 490 XXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXX 549
                              F+PH++ + FF +YIS+ +  +++   Q  YR + F  +  
Sbjct: 508 AYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVED 567

Query: 550 XXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                         WE++EPK LW+KFWA  A
Sbjct: 568 IDIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/560 (59%), Positives = 404/560 (72%), Gaps = 7/560 (1%)

Query: 24  QSARSGMHVSNSKIDDPLRFSKDNNLTLEA---IDDDSSRMFDPEGSIGQAEVKRALKPR 80
           + A S   +   ++ D     +D +  + A   I++D ++  +      + EV+R LK R
Sbjct: 15  REANSAPTIKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPR-SRGEVQRKLKER 73

Query: 81  HVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTS 140
           H+ MIALGGTIGTGL I I  PL +AGPVG+LI+++ +GT+ YSVTQSLGEMATFIPVTS
Sbjct: 74  HIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTS 133

Query: 141 SFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVL 200
           SF+VF+QRF+SPA+GA NGYMYW SW  TFALELS++GQIIQYWT AVPL AWI IFW L
Sbjct: 134 SFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWIVIFWCL 193

Query: 201 LVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG-PEGPIGFRYWRKPGPWG 259
           L   NMFPVK+YGEFEF +ASIKVI ++GF+I+S C+VCGAG P+GPIGFRYWR PG WG
Sbjct: 194 LTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWG 253

Query: 260 NGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILI 319
            GII+ N N+ RFLGWVSSLI+AAFTYQGTELVGITAGE  NPRKAVPRAI KV  RIL+
Sbjct: 254 PGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILV 313

Query: 320 FYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIIS 379
           FYI SLFFIGLLVPYNDPKL+   +G++++ SPF+I+I N  T VLP IFNAV+L TI S
Sbjct: 314 FYILSLFFIGLLVPYNDPKLD--SDGTFVSASPFMISIENSGTKVLPDIFNAVVLITIFS 371

Query: 380 AGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEV 439
           AGNSNVY+GSR+L+ LSKN+LAPK  S  T+ GVP++AVL+T++FGFLA+L  S  + + 
Sbjct: 372 AGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKA 431

Query: 440 FDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXX 499
           F+WLLNIT +AGF  WLLIS SHIRFMQ +K RGISRDDLPYKA+ MP            
Sbjct: 432 FNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIAL 491

Query: 500 XXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXX 559
                    FAP F   DF AAYISVFLF I+W  FQ  ++ +L   L            
Sbjct: 492 IVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREI 551

Query: 560 XXXXWEEEEPKNLWEKFWAV 579
               W E E K  W++ W +
Sbjct: 552 EEQVWIEPECKTRWQRVWDI 571

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/532 (59%), Positives = 390/532 (73%), Gaps = 2/532 (0%)

Query: 50  TLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPV 109
           T+  + D        E       VKRALK RH+ MIALGGTIGTGLF+ I+ PL NAGPV
Sbjct: 44  TVTNVCDGLEEEDAEEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPV 103

Query: 110 GSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAIT 169
           GSLIA++ +G++ Y +TQSLGEMATFIPVTSS TVFS+RF+SPA G ANGYMYWF+WAIT
Sbjct: 104 GSLIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAIT 163

Query: 170 FALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIG 229
           +A+E+S++GQ+IQ+WT AVPL AWIAIFWV +   N FPVK YGE EFWVASIKVIAI+G
Sbjct: 164 YAVEISVIGQVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVG 223

Query: 230 FLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGT 289
           +LIY+L +VCG   +GPIGFRYWR PGPWG GII+ + N+ RFLGWVSSLI+AAFTYQGT
Sbjct: 224 YLIYALVIVCGGSSQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGT 283

Query: 290 ELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIA 349
           ELVGITAGE  NPRK+VPRAINKV FRI+IFYI SLFF+G+LVP+NDP+L  + N + IA
Sbjct: 284 ELVGITAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL--ASNVAVIA 341

Query: 350 QSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTT 409
            SPF+I+I N  T VLPHIFNAV++ TIISA NSNVYVGSR+L+ LS+   APK F   T
Sbjct: 342 SSPFVISIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVT 401

Query: 410 KHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTL 469
           +HGVP++ V+ T++ G LA+L V+N+A   F+WL+NI+ +AG   WL IS+SHIRFMQ L
Sbjct: 402 RHGVPYLGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQAL 461

Query: 470 KHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFF 529
           K RGISRDDLP+KAK MP                     F+P F+VS FF AYIS+ +  
Sbjct: 462 KFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILV 521

Query: 530 IVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
           ++    Q  YR +    L                WEEEEP+NLWEKFW++ A
Sbjct: 522 VLLIGCQLYYRCRFLWKLEDIDIDTDRREIECIIWEEEEPQNLWEKFWSIMA 573

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/512 (60%), Positives = 382/512 (74%), Gaps = 2/512 (0%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
             EVKRALK RH+ MIALGGTIGTGLF+ IS PL N+GPVGSLIA++ +G++ YS+TQSL
Sbjct: 98  DTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSL 157

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVP 189
           GEMATFIPVTSS TVFS+RF+SPA G ANGYMYWF+WAIT+A+E+S+VGQ+I+YWT  VP
Sbjct: 158 GEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKVP 217

Query: 190 LEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF 249
           L AWIAIFWV +   N FPVK YGE EFW+A +KV+AI G+L+Y+L +VCG   +GPIGF
Sbjct: 218 LAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIGF 277

Query: 250 RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRA 309
           RYWR PGPWG GII+K+ N +RFLGWVSSLI+AAFTYQGTELVGITAGE  NPRK+VPRA
Sbjct: 278 RYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 337

Query: 310 INKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIF 369
           INKV FRI +FYI SLFFIGLLVPY+DP+L      + +A SPF+I+I N  T +LP IF
Sbjct: 338 INKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDS--AVVASSPFVISIQNAGTKILPDIF 395

Query: 370 NAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAY 429
           NA+++ T+ISA NSNVYVGSR+L+ L++   APK F+  T+HGVP++ VL TA  G LA+
Sbjct: 396 NAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAF 455

Query: 430 LNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXX 489
           L V+N+A   F+WL+NI+ +AG   WL ISISHIRFMQ LK RGISRDDLP+KAKFMP  
Sbjct: 456 LVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWA 515

Query: 490 XXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXX 549
                              F+PHF+V+ FF AYIS+ +  +++   Q  YR + F  L  
Sbjct: 516 AYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLED 575

Query: 550 XXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                         WE++EPK  W+KFWA  A
Sbjct: 576 IDIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/555 (60%), Positives = 401/555 (72%), Gaps = 10/555 (1%)

Query: 32  VSNSKIDDPLRFSKDNNLTLEA------IDDDSSRMFDPEGSIGQAEVKRALKPRHVSMI 85
           +S  K ++ +    D   T EA      I++DS++  +     G  EVKR LK RH+ MI
Sbjct: 20  ISTIKEEELICARYDGQDTEEAVAGKSSINNDSAKETETSPRKG-GEVKRKLKQRHIGMI 78

Query: 86  ALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVF 145
           ALGGTIGTGL I I  PL +AGPVG+LI+++ +GT+ YSVTQSLGEMATFIPVTSSF+VF
Sbjct: 79  ALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVF 138

Query: 146 SQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFN 205
           +QRF+SPA+GA NGYMYW SW  TFALELS++GQIIQYWTDAVPL AWI IFW LL   N
Sbjct: 139 AQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMN 198

Query: 206 MFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE-GPIGFRYWRKPGPWGNGIIA 264
           MFPVK+YGEFEF +ASIKVIA++GF+ +S C+VCGAG   GPIGFRYWR PG WG GII+
Sbjct: 199 MFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIIS 258

Query: 265 KNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGS 324
           KN N+ RFLGWVSSLI+AAFTYQGTELVGITAGE  NPR+AVPRAI KV  RIL+FYI S
Sbjct: 259 KNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYILS 318

Query: 325 LFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSN 384
           LFFIGLLVPYNDPKL+    G++++ SPF+I+I N  T VLP IFNAV+L TI+SAGNSN
Sbjct: 319 LFFIGLLVPYNDPKLD--SEGTFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSN 376

Query: 385 VYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLL 444
           VY+GSR+L+ LSKN+LAP+F S  TK GVP+ AVL T+ FGFLA+L  S  + +VF+WLL
Sbjct: 377 VYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNWLL 436

Query: 445 NITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXX 504
           NIT +AGF  WLLIS+SHIRFMQ +K RGISRDDLPY+A+ MP                 
Sbjct: 437 NITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVLIQ 496

Query: 505 XXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXW 564
               FAP F   DF AAYISVFLF  +W +FQ  ++ +    L                W
Sbjct: 497 GFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRRDIEEQVW 556

Query: 565 EEEEPKNLWEKFWAV 579
            E E K  W+  W +
Sbjct: 557 IEPECKTRWQHVWDI 571

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/532 (61%), Positives = 396/532 (74%), Gaps = 6/532 (1%)

Query: 50  TLEAIDDDSSRMFDPEGSIGQA-EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGP 108
           T   ++DD+++  + E S  +  EVKR LK RH+ MIALGGTIGTGL I I  PL +AGP
Sbjct: 44  TERKVEDDAAK--ETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGP 101

Query: 109 VGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAI 168
           VG+LI+++ +GT+ YSVTQSLGEM TFIPVTSSF+VF+QRF+SPA+GA NGYMYW SW  
Sbjct: 102 VGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCF 161

Query: 169 TFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAII 228
           TFALELS++G++IQYWT+AVPL AWI IFW LL S NMFPVK+YGEFEF +ASIKVIA++
Sbjct: 162 TFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALL 221

Query: 229 GFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQ 287
           GF+I+S C+VCGAG  +GPIGFRYWR PG WG GII+ + N+ RFLGWVSSLI+AAFTYQ
Sbjct: 222 GFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQ 281

Query: 288 GTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY 347
           GTELVGITAGE  NPRKA+PRAI KV  RIL+FYI SLFFIGLLVPYNDPKL+   +G +
Sbjct: 282 GTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLD--SDGIF 339

Query: 348 IAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSK 407
           ++ SPF+I+I N  T VLP IFNAV+L TI+SAGNSNVY+GSR+L+ LSKN+LAP+F S 
Sbjct: 340 VSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN 399

Query: 408 TTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQ 467
            T+ GVP+ +VL T+VFGFLA+L VS  + + F+WLLNIT +AGF  WLLIS SHIRFMQ
Sbjct: 400 VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQ 459

Query: 468 TLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFL 527
            ++ RGISRDDLPYKA+ MP                     FAP F   DF AAYIS+FL
Sbjct: 460 AIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFL 519

Query: 528 FFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAV 579
           F  +W  FQ  ++ +L   L                W E E K  W++ W V
Sbjct: 520 FLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEELVWIEPECKTRWQRVWDV 571

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/510 (61%), Positives = 377/510 (73%), Gaps = 3/510 (0%)

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
            VKRALK RH+ MIALGGTIGTGLF+ IS PL  AGPVGSLI+++ +GT+ Y +TQSLGE
Sbjct: 106 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQSLGE 165

Query: 132 MATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           MATFIPVTSS TVFS+RF+SPA G ANGYMYWF+WAIT+A+E+S++GQ+IQYWTD VPL 
Sbjct: 166 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 225

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRY 251
            WIAIFWVL+   N FPVK YGEFEFWVAS+KV+AI+G+LIY+L +VCG   +GPIGFRY
Sbjct: 226 VWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIGFRY 285

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311
           WR PG WG GII+ + N+ RFLGWVSSLI+AAFTYQGTELVGITAGE  NPRK VPRAIN
Sbjct: 286 WRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 345

Query: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNA 371
           KV FRI++FYI SLFFIGLLVPYN+P+L  S   + IA SPF+I+I N  T  LP IFNA
Sbjct: 346 KVVFRIVLFYIMSLFFIGLLVPYNEPRLSASS--AVIASSPFVISIQNAGTYALPDIFNA 403

Query: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
           V+L T+ISA NSNVYVGSR+L+ L++   APK F   TK GVP++ VL TA  G LA+L 
Sbjct: 404 VVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLV 463

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXX 491
           V+N+A   F+WL+NI+ +AG   WL IS++HIRFMQ L+ RGISRDDLP+KAK MP    
Sbjct: 464 VNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGAY 523

Query: 492 XXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXX 551
                            F P F VSDFF +YIS+ L  +V+   Q  Y+ +    L    
Sbjct: 524 YAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDID 582

Query: 552 XXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                       WE++EPKNLWEKFWA  A
Sbjct: 583 IDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/540 (59%), Positives = 391/540 (72%), Gaps = 5/540 (0%)

Query: 44  SKDNNLT-LEAIDDDSSRMFDPE-GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISG 101
           S  N+LT L+ +  ++    D E        VKRALK RH+ MIALGGTIGTGLF+ IS 
Sbjct: 75  SITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGIST 134

Query: 102 PLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYM 161
           PL NAGPVGSLIA++ +GT+ Y VTQSLGEMATFIPVTSS TVFS+RF+SPA G +NGYM
Sbjct: 135 PLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYM 194

Query: 162 YWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVAS 221
           YWF+WAIT+A+E+S++GQ+I+YWTD VPL AWIAIFWV++   N FPVK YGEFEFWVAS
Sbjct: 195 YWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVAS 254

Query: 222 IKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLIS 281
           +KV+AI+G+LIY+L +VCG   +GPIGFRYWR PG WG GII+ + ++ RFLGWVSSLI+
Sbjct: 255 VKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLIN 314

Query: 282 AAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEG 341
           AAFTYQGTELVGITAGE  NPRK VPRAINKV FRI++FYI SLFFIGLLVPYND +L  
Sbjct: 315 AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSA 374

Query: 342 SDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLA 401
           S   + IA SPF+I+I N  T  LP IFNAV+L T++SA NSNVYVGSR+L+ L++   A
Sbjct: 375 SS--AVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNA 432

Query: 402 PKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISIS 461
           PK F   T+ GVP++ V+ TA  G LA+L V+N+A   F+WL+NI+ +AG   WL IS++
Sbjct: 433 PKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLA 492

Query: 462 HIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAA 521
           HIRFMQ LKHRGISRDDLP+KAK MP                     F P F VS+FF +
Sbjct: 493 HIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTS 551

Query: 522 YISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
           YIS+ L  +V+   Q  Y+ +    L                WE++EPKNLWEKFWA  A
Sbjct: 552 YISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/585 (54%), Positives = 406/585 (69%), Gaps = 24/585 (4%)

Query: 18  SNLSQSQSARSGMHVSNSKI--DDPLRFSKDNNLTLEA-----------------IDD-- 56
           S+ ++SQ++  G       I  D+ +R  K  +++ +A                 +DD  
Sbjct: 16  SDDTRSQTSGDGSPYEMEDIVPDEKIRLQKLKHVSTQADVHSVTGSLTRSRLNSRVDDGA 75

Query: 57  DSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFM 116
           +S    + E  + + +VKRALK RH+ MIALGGTIGTGLF+ IS PL  AGPVGSLIA++
Sbjct: 76  ESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYI 135

Query: 117 LIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSI 176
            +GT+ Y VTQSLGEMATFIPVTSS TVFS+RF+SPA G ANGYMYWF+WAIT+A+E+S+
Sbjct: 136 FMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISV 195

Query: 177 VGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLC 236
           +GQ+IQYWT AVPL AWIAIFWVL+   N FPVK YGE EFW+A +KV+AI+G+LIY+L 
Sbjct: 196 IGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALV 255

Query: 237 MVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITA 296
           +VCG   +GPIGFRYWR PG +G GII+KN N  +FLGWV+SLI+AAFTYQGTELVGITA
Sbjct: 256 IVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITA 315

Query: 297 GETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIA 356
           GE  NPRK VPRAINKV FRI++FYI SLFFIG+L+PYND +L   D  + IA SPF+I+
Sbjct: 316 GEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQD--AVIASSPFVIS 373

Query: 357 ILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFI 416
           I N  T VLP IFNAV++ T++SA NSNVYVGSR+L+ L+    APK FS  T++GVP++
Sbjct: 374 IKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYL 433

Query: 417 AVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISR 476
            V+ TA  G LA+L V+N+A   F+WL+NI+ +AG   WL IS++HIRFMQ LK RGISR
Sbjct: 434 GVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISR 493

Query: 477 DDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQ 536
           DDLP+KAK MP                     F P ++VS FF +YIS+ L  ++    Q
Sbjct: 494 DDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCP-WDVSTFFTSYISLILLAVLVVGCQ 552

Query: 537 TIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
             YR +    L                WE++EPK LW+KFWA AA
Sbjct: 553 LYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPKTLWDKFWAWAA 597

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/510 (61%), Positives = 376/510 (73%), Gaps = 3/510 (0%)

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
            V+RALK RH+ MIALGGTIGTGLF+ IS PL NAGPVGSLIA++ +GT+ Y VTQSLGE
Sbjct: 105 HVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSLGE 164

Query: 132 MATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           MATFIPVTSS TVFS+RF+SPA G +NGYMYWF+WAIT+A+E+S++GQ+I+YWT  VPL 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKVPLG 224

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRY 251
            WIAIFWVL+   N FPVK YGEFEFWVAS+KV+AI+G+LIY+L +VCG   +GPIGFRY
Sbjct: 225 VWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIGFRY 284

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311
           WR PG WG GII+ + N+ RFLGWVSSLI+AAFTYQGTELVGITAGE  NPRK VPRAIN
Sbjct: 285 WRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNA 371
           KV FRI++FYI SLFFIGLLVPY DP+L  S   + IA SPF+I+I N  T  LP IFNA
Sbjct: 345 KVVFRIVLFYIMSLFFIGLLVPYTDPRLSASS--AVIASSPFVISIQNAGTYALPDIFNA 402

Query: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
           ++L T+ISA NSNVYVGSR+L+ L++   APK F   TK GVP++ VL TA  G LA+L 
Sbjct: 403 IVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLV 462

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXX 491
           V+N+A   F+WL+NI+ +AG   WL IS+SHIRFMQ L  RGISRDDLP+KAKFMP    
Sbjct: 463 VNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGAY 522

Query: 492 XXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXX 551
                            F P F V+DFF +YIS+ L  +V+   Q  Y+ +    L    
Sbjct: 523 YASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDID 581

Query: 552 XXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
                       WE++EPKNLWEKFWA  A
Sbjct: 582 IDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/534 (57%), Positives = 387/534 (72%), Gaps = 14/534 (2%)

Query: 55  DDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIA 114
           D+D+      E      +VKR LK RH+ MIALGGTIGTGLF+ I+ PL +AGPVG+LIA
Sbjct: 71  DEDAE-----EADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIA 125

Query: 115 FMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALEL 174
           ++ +G++ Y VTQ+LGEMATFIPVTSS TVFSQRF+SPA G ANGYMYWF+WAITFA+E+
Sbjct: 126 YIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEI 185

Query: 175 SIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYS 234
           S+VGQ+IQYWTDAVPL AWIAIFWVL+   N FPVK YGE EFWVA +KVIAI+G+L+Y+
Sbjct: 186 SVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYA 245

Query: 235 LCMVC-GAGPEGPIGFRYWRKPGPWGNGI------IAKNVNKARFLGWVSSLISAAFTYQ 287
           L +VC G+  +GPIGFRYWR PG WGNG+      I  +  + RFLGWV+SLI+AAFTYQ
Sbjct: 246 LIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQ 305

Query: 288 GTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY 347
           GTELVGITAGE  NPRK VPRAINKV FRI++FYI SLFFIGLLVP+ D +L  SD+ + 
Sbjct: 306 GTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL--SDDTTV 363

Query: 348 IAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSK 407
           IA SPF+I+I N  T +LP IFNA+++ T++SA NSNVYVGSR+L+ L+   +APK F++
Sbjct: 364 IASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFAR 423

Query: 408 TTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQ 467
            T+ GVPF+ V+ T++ G LA+L V N+A   F+WL++I+ +AG   WL IS++H+RFMQ
Sbjct: 424 VTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQ 483

Query: 468 TLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFL 527
            LK RGISRDDLP+KAKFMP                     F+PHF+V+ FF  YIS+ L
Sbjct: 484 VLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLIL 543

Query: 528 FFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
             +V+   Q  YR +    L                WE++EPK +W+KFWA  A
Sbjct: 544 LAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/481 (63%), Positives = 359/481 (74%), Gaps = 3/481 (0%)

Query: 102 PLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYM 161
           PL +AGPVG+LI+++ +GT+ YSVTQSLGEMATFIPVTSSF+VF+QRF+SPA+GA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 162 YWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVAS 221
           YW SW  TFALELS++GQIIQYWTDAVPL AWI IFW LL   NMFPVK+YGEFEF +AS
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 222 IKVIAIIGFLIYSLCMVCGAG-PEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLI 280
           IKVIA++GF+IYS CMVCGAG P+GPIGFRYWR PG WG GII+ + N+ RFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 281 SAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLE 340
           +AAFTYQGTELVGITAGE  NPRKAVPRAI KV  RIL+FYI SLFFIGLLVPYNDPKL+
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 341 GSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNL 400
              +GS+++ SPF+I+I N  T VLP IFNAV+L TI+SAGNSNVY+GSR+L+ LSKN+L
Sbjct: 259 --SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDL 316

Query: 401 APKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISI 460
           AP+F S  TK GVP+ AVL T+VFGFLA+L  S  + + F+WLLNIT +AGF  WLLIS 
Sbjct: 317 APRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISF 376

Query: 461 SHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFA 520
           SHIRFMQ +  RGISR+DLPYKA+ MP                     FAP F   DF A
Sbjct: 377 SHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVA 436

Query: 521 AYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVA 580
           AYISVFLF  +W  FQ  ++  +   L                W E   K  W+  W V 
Sbjct: 437 AYISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVL 496

Query: 581 A 581
           A
Sbjct: 497 A 497

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/547 (55%), Positives = 383/547 (70%), Gaps = 19/547 (3%)

Query: 46  DNNLTLEAIDDDSSRM---FDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGP 102
           +N++ L+++   +         EG   + EVKRALK RH+SMIALGGTIGTGLFI I+ P
Sbjct: 25  ENDIELQSVTPATGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASP 84

Query: 103 LWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMY 162
           L  AGPVGSL+A++ IGT+ YS+TQSLGEMATFIPVTSS TVFS+RF+SPA G ANGYMY
Sbjct: 85  LRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMY 144

Query: 163 WFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASI 222
           WF+WAITFA+ELS+VGQIIQYWTD VP+ AWI IFWVL+   N FPV++YGE EFW+AS+
Sbjct: 145 WFNWAITFAVELSVVGQIIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASV 204

Query: 223 KVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKAR--------FLG 274
           KV+ I+G+LIY+  +VCG   +GPIG        P   GI A+    +         FLG
Sbjct: 205 KVLTIVGYLIYAFIIVCGGSKQGPIGL-------PATGGIPARGARASSRTTRKRHGFLG 257

Query: 275 WVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPY 334
           WVSSLI AAFTYQGTELVGITAGE+ NPRK VP+AINKVFFRIL FYIGSL F+GLLVPY
Sbjct: 258 WVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPY 317

Query: 335 NDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFG 394
           +DP+L  S++ + +  SPF+I+I N  T +LP IFNAV+L T+ISA NSNVY+GSR+ + 
Sbjct: 318 DDPRLN-SESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYS 376

Query: 395 LSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFIT 454
           L+    APK  +  TK GVP+  VLIT++ G +++L ++++A   FDWL+NI+ +AG   
Sbjct: 377 LALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCA 436

Query: 455 WLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFN 514
           WL IS++HIRFMQ LKHRGISRDDLP+KAKFMP                     F P F+
Sbjct: 437 WLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTPKFD 496

Query: 515 VSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWE 574
           V+ FF +YIS+FL  +V+   Q  Y+ +    +                WEE+EPKN+W+
Sbjct: 497 VTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDAIVWEEDEPKNIWD 556

Query: 575 KFWAVAA 581
           KFW+  A
Sbjct: 557 KFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/517 (57%), Positives = 374/517 (72%), Gaps = 3/517 (0%)

Query: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124
           +G     +VKRALKPRH+ MIALGGTIGTGLF+ IS PL  +GPVGSLIA++ +G++ Y 
Sbjct: 94  KGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYF 153

Query: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           VTQSLGEMATFIPVTSS TVF++RF+SPA+G +NGYMYWF+WAITFA ELS+ GQIIQYW
Sbjct: 154 VTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYW 213

Query: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE 244
           T  VPL AWI IFWV++   N FPVK YGE EFWV+S+KV+AI+G+LIY+L +VCG   +
Sbjct: 214 TYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQ 273

Query: 245 GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRK 304
           GPIGFRYWR    +G+G I+KN ++ARFLGWVSSLI+AAFTYQGTELVGI+AGE  NPRK
Sbjct: 274 GPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRK 333

Query: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPV 364
            VPRAINKV FRI +FYI SLFFIGLLVPYND +L  SD  + IA SPF+I++LN  T  
Sbjct: 334 TVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL--SDGSAIIASSPFVISMLNAGTSA 391

Query: 365 LPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVF 424
           LP IFNAVIL T++SA NS+VY+ SR+L+ L+    APK F+   ++GVP++ V +T + 
Sbjct: 392 LPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLV 451

Query: 425 GFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           G+LA+L VSN+A   F+WL+NI+ +AG   W  I  +HIRFMQ LKH+GISRDDLP+KA+
Sbjct: 452 GWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKAR 511

Query: 485 FMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLF 544
           FMP                     F P ++   FF +YIS+ LF +++      YR +L 
Sbjct: 512 FMPWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLL 570

Query: 545 RTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKFWAVAA 581
             +                WEE+ P+N WEKFWA  A
Sbjct: 571 IKIEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  351 bits (901), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 182/507 (35%), Positives = 304/507 (59%), Gaps = 8/507 (1%)

Query: 46  DNNLTLEAIDDDSSRMFD--PEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103
           DN  T+ +  +DS +  D   +G      +++ LK RH+SMIA+GG+IGTGL I     L
Sbjct: 57  DNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSL 116

Query: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYW 163
           + AGP+   IA+  +G L +    +LGEMA++IP+   FT ++ R+  PA+G A GY Y 
Sbjct: 117 YTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYL 175

Query: 164 FSWAITFALELSIVGQIIQYWTDAVPLE--AWIAIFWVLLVSFNMFPVKWYGEFEFWVAS 221
             + I    +L+    +IQYW D   +    WI IF V++V+ N   VK++GEFEFW+++
Sbjct: 176 CKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLST 235

Query: 222 IKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLI 280
            KVI +IG +I    ++ G GP    +GFR++  PG +     + + +K +F+ +V+ L+
Sbjct: 236 FKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLV 295

Query: 281 SAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLE 340
            A F Y G EL GI A E  NPRK++P+AI    +RI++FY+ ++F +G+ V Y+DP L+
Sbjct: 296 YALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLK 355

Query: 341 GSD-NGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNN 399
            +  +G+  A SP+++AI+N     LPHIFNA +L  + SA NS++YV SR L+GL+ +N
Sbjct: 356 KAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDN 415

Query: 400 LAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLIS 459
            APK F+ T + GVP+ ++L+++ F  LAY++VS+ + ++F++ +N+ +I G ++W+ I 
Sbjct: 416 KAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISIL 475

Query: 460 ISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFA-PHFNVSDF 518
           I+++ F + +K + + R    Y+A F P                     F   HF+  +F
Sbjct: 476 ITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNF 535

Query: 519 FAAYISVFLFFIVWAIFQTIYRTKLFR 545
              YI + +F I +  ++ + +TK+++
Sbjct: 536 ITGYIGIPVFVISYFGYKFVKKTKIWK 562

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  350 bits (898), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/539 (38%), Positives = 310/539 (57%), Gaps = 14/539 (2%)

Query: 44  SKD-NNLTLEAIDDDSSR--MFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISIS 100
           SKD  NL L   DD SS+    + +G      +K+ L+ RHVSMIA+GG++GTGL I   
Sbjct: 23  SKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTG 82

Query: 101 GPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGY 160
             L  AGPV  LIA+  +G L Y V   LGEMAT+IP+   FT ++ R+  PA+G A GY
Sbjct: 83  TSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGY 141

Query: 161 MYWFSWAITFALELSIVGQIIQYWT--DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFW 218
            Y F + I    +L+    ++QYW   + V    WI IF V++V+ N+  VK++GEFEFW
Sbjct: 142 SYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFW 201

Query: 219 VASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVS 277
           ++S KV+ ++  ++    ++ G GP    +GFR+++ PG +     A + +K +F+ +V+
Sbjct: 202 LSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVA 261

Query: 278 SLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDP 337
             + A F Y GTEL GI A E KNPR+ VPRAI    +RI++FY+ ++F +G+ V YNDP
Sbjct: 262 VFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDP 321

Query: 338 KL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLS 396
            L +     +  A SPF++AI N   PVLPHIFNA +L  + SA NS++YV SR L+GL+
Sbjct: 322 LLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLA 381

Query: 397 KNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWL 456
            +N APK F+KT K GVP+ ++++  +F  LAY+NVS+ + +VF++ +N+ +I G ++W+
Sbjct: 382 IDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWI 441

Query: 457 LISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPH-FNV 515
            I I++I F + L+ +G+ +  L Y A                         F  H F+ 
Sbjct: 442 AILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDY 501

Query: 516 SDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWE 574
            +F   YI + +F I +  ++ I  TK  +                   EEEE K LW+
Sbjct: 502 KNFITGYIGIPVFIICFFGYKYIRGTKFVKP----EEADLYTFKELIDLEEEEGK-LWD 555

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  348 bits (892), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/527 (36%), Positives = 306/527 (58%), Gaps = 13/527 (2%)

Query: 24  QSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVS 83
           +   +G+  SN  +++ +       +TLE+     S     +G      +K+ L+ RHVS
Sbjct: 8   EKKNAGVLYSNETLEEGI-------VTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60

Query: 84  MIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFT 143
           MIA+GG++GTGL I     L +AGPV  LI++  +G L Y+V   LGEMA FIP+   FT
Sbjct: 61  MIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFT 119

Query: 144 VFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT--DAVPLEAWIAIFWVLL 201
            ++ R++ PAVG A GY Y F + I    +L+    ++Q+W   D V    WI IF  L+
Sbjct: 120 SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179

Query: 202 VSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGN 260
           V  N   V+++GEFEFW++S+KV+ ++G ++    ++ G GP     GFR+WR PG +  
Sbjct: 180 VLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKP 239

Query: 261 GIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIF 320
              A + +K +F+ + S    A F Y GTEL GI A E KNPR++VPRAI    +RI++F
Sbjct: 240 YSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVF 299

Query: 321 YIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIIS 379
           Y+ ++  +G+ V YNDP+L +     +  A SPF++AI N   PVLPHIFN  +L  + S
Sbjct: 300 YVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFS 359

Query: 380 AGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEV 439
           A NS++YV SR L+GL+ +  AP+ F+ T K GVP+ ++ ++ +F  LAY+NVS+ + +V
Sbjct: 360 ACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQV 419

Query: 440 FDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXX 499
           F++ +N+ +I G ++W+ I I++IRF + ++ +   +  L Y A F P            
Sbjct: 420 FNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL 479

Query: 500 XXXXXXXXXFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFR 545
                    F  H F+   F + YI + ++ I +  ++ +YRTKL +
Sbjct: 480 IGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIK 526

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  347 bits (890), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/507 (36%), Positives = 299/507 (58%), Gaps = 6/507 (1%)

Query: 46  DNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWN 105
           +NN++L    +D +  ++ +G      +K+ L+ R VSM+A+GG++GTGL I     L  
Sbjct: 44  ENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLAT 103

Query: 106 AGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFS 165
           AGPV  LIA+  +G L +    SLGEMA++IP+   FT ++ R+  PA+G A GY Y F 
Sbjct: 104 AGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCYLFK 162

Query: 166 WAITFALELSIVGQIIQYW--TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223
           + I    +L+    +IQYW   + V    WI IF V++V+ N   V+++GEFEFW++S K
Sbjct: 163 YFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFK 222

Query: 224 VIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISA 282
           V+ +   +I    ++ G GP    +GFR+W+ PG + N   A   +  +F+ +VS  + A
Sbjct: 223 VLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYA 282

Query: 283 AFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL-EG 341
            F Y GTELVGI  GE +NPRK+VP+AI    +RI+IFY+ S+  +G+ V Y+DP L E 
Sbjct: 283 TFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEA 342

Query: 342 SDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLA 401
               +  A SPF++AI+N    VLPHIFNA +L  + SA NS++YV SR L+ L+ +N A
Sbjct: 343 KTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKA 402

Query: 402 PKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISIS 461
           PK F++T + G+P+ ++ ++ +F  LAY++VS+ + ++F++ +N+ +I G ++W+ I ++
Sbjct: 403 PKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVT 462

Query: 462 HIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPH-FNVSDFFA 520
           ++ F + ++ +GI +    Y A                         F  H F+   F  
Sbjct: 463 YLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFIT 522

Query: 521 AYISVFLFFIVWAIFQTIYRTKLFRTL 547
            YI + +FFI +  ++ IY+TK+   L
Sbjct: 523 GYIGIPVFFISYFGYKLIYKTKIIDPL 549

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  345 bits (886), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/517 (36%), Positives = 297/517 (57%), Gaps = 15/517 (2%)

Query: 38  DDPLRFSKDNNLTLEAID--DDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGL 95
           +D +   K+   +L + +  DDS+++ D  G      +K+ LK RH+SMIA+GG++GTGL
Sbjct: 15  EDIIDLEKNTTSSLNSFEQEDDSNKISD--GKEDGVRLKKELKARHISMIAIGGSLGTGL 72

Query: 96  FISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVG 155
            I     L   GP   LIA+  +G L + V   LGEMAT+IP+   FT ++ R+  PA+G
Sbjct: 73  LIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALG 131

Query: 156 AANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE--AWIAIFWVLLVSFNMFPVKWYG 213
            A GY Y F + I    +L+    +IQYW D   +    WI IF V++V  N   V+++G
Sbjct: 132 FAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFG 191

Query: 214 EFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPG---PWGNGIIAKNVNK 269
           EFEFW++S K++ + G +++   ++ G GP    +GFRYW+ PG   P+   I     +K
Sbjct: 192 EFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG---SK 248

Query: 270 ARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIG 329
            +F+ +V+  + A F Y G EL GI A E +NPR+ +PRAI    +RI++FYI ++F +G
Sbjct: 249 GKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLG 308

Query: 330 LLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVG 388
           + V YNDP+L   +   +  A SPF++AI N     LPHIFN  +L  + SA NS++YVG
Sbjct: 309 MCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVG 368

Query: 389 SRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITA 448
           +R L+ L+ +  APK F+KT + GVP+ A+    +F  LAY+NVS+ + ++F++ +N+ +
Sbjct: 369 TRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVS 428

Query: 449 IAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXX 508
           I G ++W+ I I++I F +    + + R+   Y+A F P                     
Sbjct: 429 IFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTV 488

Query: 509 FAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFR 545
           F   F+   F   YI + L+ I +  ++ IY+TKL +
Sbjct: 489 FIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVK 525

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  346 bits (887), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/516 (37%), Positives = 292/516 (56%), Gaps = 10/516 (1%)

Query: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124
           +G      +K+AL+ RHVSMIA+GG++GTGL I     L  AGP   LIA+  +G L + 
Sbjct: 71  DGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFF 130

Query: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           V   LGEMA +IP+   FT +S R+  PA+G A GY Y F + I    +L+    +IQYW
Sbjct: 131 VMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189

Query: 185 TDAVPLE--AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242
            D   +    WI I  V +++ N   V+++GE E++++++K+  ++G +I  L + CG G
Sbjct: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGG 249

Query: 243 PEGPI-GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKN 301
           P   + GF+YW+ PG +     A    K RF+ + S  + A F Y GTEL GI   E KN
Sbjct: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309

Query: 302 PRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQ-SPFLIAILNC 360
           PRKAVP+AI    +RI++FY+ S+F +G+ VP+NDP L  + +    A  SPF++AI+N 
Sbjct: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNA 369

Query: 361 RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI 420
             PVLPHI NA IL  + SA NS++YV SR L+GL+ +N AP+ F+KT K GVP+ ++L+
Sbjct: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429

Query: 421 TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP 480
             +F  LAY+NVS+ + EVF + +N  +I G ++W+ I I++IRF +  + +GI +  L 
Sbjct: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489

Query: 481 YKAKFMPXXXXXXXXXXXXXXXXXXXXXF-APHFNVSDFFAAYISVFLFFIVWAIFQTIY 539
           Y++   P                     F    F+   F   YI +  + I +  ++  Y
Sbjct: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWY 549

Query: 540 RTKLFRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEK 575
           +TK+  +                  EEEE K L E+
Sbjct: 550 KTKIIPS----EEVDLVSFKEAVDLEEEEGKMLDEE 581

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/527 (37%), Positives = 298/527 (56%), Gaps = 20/527 (3%)

Query: 35  SKIDDPLRFSKDNNLTLEAIDDDSSR--------MFDPEGSIGQAEVKRALKPRHVSMIA 86
            K  D +  S D  L   +I   SSR        +FD +G      +K+ LK RHVSMIA
Sbjct: 21  QKQSDQVTISSD--LEQNSISIASSRNSSIGDRDIFD-DGKTEGFRLKKNLKARHVSMIA 77

Query: 87  LGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFS 146
           +GG++GTGL I     L  AGP    I +  +G L +     LGEMA FIP+   FT ++
Sbjct: 78  IGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEMAAFIPL-DGFTSYA 136

Query: 147 QRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE--AWIAIFWVLLVSF 204
            R++ PA+G A GY Y   + I  A +L+    ++QYW D   L    +I IF +L+V+ 
Sbjct: 137 SRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNPGVFITIFLILIVTI 196

Query: 205 NMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPG---PWGN 260
           N+F VK +GEFEFW++S KV+ ++G ++    ++ G GP    +GFRYWR PG   P+ +
Sbjct: 197 NIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGFRYWRDPGSFKPYSS 256

Query: 261 GIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIF 320
            II+ + +  +F+ + S  + A F Y G EL GI A E +NPRK +P+AI    +RI+IF
Sbjct: 257 SIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNIPKAIKLTMYRIIIF 316

Query: 321 YIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIIS 379
           Y+ ++  + + V YNDP L + +   +  A SPF++AI N    +LPHIFN  +L  ++S
Sbjct: 317 YVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINILPHIFNVCVLAFVLS 376

Query: 380 AGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEV 439
           A NS++YV SR L+ L+ +N APKFF KT K G+P+ ++  +  F  LAY+NVS+ A  V
Sbjct: 377 AANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFSCLAYMNVSSSASNV 436

Query: 440 FDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXX 499
           F++ +N  +I G I+W+ I +++I F +  K +G+ + +  Y A + P            
Sbjct: 437 FNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPWQPYGAYFALFFCCV 496

Query: 500 XXXXXXXXXF-APHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFR 545
                    F    F+  +F   YI + +FFI +  ++ +Y+TK  R
Sbjct: 497 LALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTKTHR 543

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/540 (36%), Positives = 309/540 (57%), Gaps = 11/540 (2%)

Query: 18  SNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLE-----AIDDDSSRMFDPEGSIGQAE 72
           SN +  Q       +   +   P++  +  N  LE     A   D +  ++ +G      
Sbjct: 8   SNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTR 67

Query: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132
           +K+ALK RHVSMIA+GG++GTGL I     L  AGPV +LIA+  +G L +     LGEM
Sbjct: 68  LKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEM 127

Query: 133 ATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE- 191
           AT+IP+   FT ++ R+  PA+G A GY Y F + I    +L+    +IQYW D   +  
Sbjct: 128 ATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNP 186

Query: 192 -AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGF 249
             W+ IF V++VS N+F V+++GEFEFW++S KV+ ++G ++    ++ G GP+   +GF
Sbjct: 187 GVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGF 246

Query: 250 RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRA 309
           RYWR PG +         +  RF+ +VS  + A + Y G EL GI A E +NPRK++P+A
Sbjct: 247 RYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKA 306

Query: 310 INKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY-IAQSPFLIAILNCRTPVLPHI 368
           I    +RI+IFY+ S+F +G+ V Y+DP L  + N S   A SPF++AI+N     LPHI
Sbjct: 307 IKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINALPHI 366

Query: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428
            NA +L  + SA NS++YV SR L+ L+ +N APK F+KT + G+P+ A+ ++ +F  LA
Sbjct: 367 INACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLA 426

Query: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPX 488
           Y+ VS+ + ++F++ +N+ +I G ++W+ I I++I F + ++ +G+ +    Y A F P 
Sbjct: 427 YMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPY 486

Query: 489 XXXXXXXXXXXXXXXXXXXXFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTL 547
                               F  H F+  +F   YI + +FF  +  ++  Y+TK+   L
Sbjct: 487 GAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPL 546

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  341 bits (875), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/496 (37%), Positives = 294/496 (59%), Gaps = 8/496 (1%)

Query: 56  DDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAF 115
           DDS  +  P+G      +++ LK RH+SMIA+GG++GTGL I     L   GPV  LIA+
Sbjct: 67  DDSFAV--PDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAY 124

Query: 116 MLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELS 175
             +G L +     LGEMA++IP+   FT ++ R++ PA+G A GY Y F + I    +L+
Sbjct: 125 AFVGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 183

Query: 176 IVGQIIQYW--TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIY 233
               +IQYW   D V    WI IF V++V+ N+  VK++GEFEFW++S KV+ ++G ++ 
Sbjct: 184 AAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILL 243

Query: 234 SLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELV 292
              ++ G GP    +GFRYWR PG +     A    K +F+ +V+  + + F+Y G EL 
Sbjct: 244 LFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELT 303

Query: 293 GITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY-IAQS 351
           GI   E +NPRK+VP+AI    +RI++FY+ ++F +G+ V YNDP+L  +   S   A S
Sbjct: 304 GIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS 363

Query: 352 PFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKH 411
           PF++AI N    VLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK F+KT++ 
Sbjct: 364 PFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRW 423

Query: 412 GVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKH 471
           GVP+ A++++ +F  LAY+NVS+ + ++F++ +N+ ++ G ++W+ I I +I F +  + 
Sbjct: 424 GVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 483

Query: 472 RGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPH-FNVSDFFAAYISVFLFFI 530
           +GI +    Y A                         F  H F+   F   YI + ++ I
Sbjct: 484 QGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYII 543

Query: 531 VWAIFQTIYRTKLFRT 546
            WA ++ IY+TK+ ++
Sbjct: 544 SWAGYKLIYKTKVIKS 559

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  340 bits (871), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/532 (36%), Positives = 308/532 (57%), Gaps = 11/532 (2%)

Query: 20  LSQS-QSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALK 78
           +S+S +   +G+  SN  +++ + F K       A    +S     EG      +K+AL+
Sbjct: 1   MSESLEKKNAGILYSNETLEEDVAFDKLERGASGASAAGASVDGKHEG----IRLKKALE 56

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPV 138
            RHVSMIA+GG++GTGL I     L +AGP   LI++  +G L Y+V   LGEMA FIP+
Sbjct: 57  ARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEMAAFIPL 116

Query: 139 TSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT--DAVPLEAWIAI 196
              FT ++ R++ PA+G A GY Y F + I    +L+    ++QYW   + V    WI I
Sbjct: 117 -DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITI 175

Query: 197 FWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKP 255
           F VL+V  N   V+++GEFEFW++S+KV+ ++G ++    ++ G GP     GFRYWR P
Sbjct: 176 FLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRYWRDP 235

Query: 256 GPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFF 315
           G +     A + +K +F+ + S    A F Y GTEL GI A E KNPR++VPRAI    +
Sbjct: 236 GAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLY 295

Query: 316 RILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVIL 374
           RI++FY+ S+  +G+ V YNDP L +     +  A SPF++AI N   PVLPHIFNA +L
Sbjct: 296 RIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPHIFNACVL 355

Query: 375 TTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSN 434
             + SA NS++YV SR L+GL+ +  APK F+KT   GVP+ ++ ++ +F  LAY+NVS+
Sbjct: 356 LFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSS 415

Query: 435 DAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXX 494
            + ++F++ +N+ +I G ++W+ I I+++RF + +  +   +    Y A F P       
Sbjct: 416 GSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSL 475

Query: 495 XXXXXXXXXXXXXXFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFR 545
                         F  H F+   F + YI + ++ I +  ++ ++R+KL +
Sbjct: 476 FFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIK 527

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  341 bits (874), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/479 (38%), Positives = 287/479 (59%), Gaps = 6/479 (1%)

Query: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132
           +K+ L+ RHVSMIA+GG++GTGL I     L  AGP    IA+  +G L +    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 133 ATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW--TDAVPL 190
           A++IP+   FT ++ R++ PA+G A GY Y F + I    +L+    +IQYW   D V  
Sbjct: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 191 EAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGF 249
             WI IF V++V  N+  VK++GEFEFW++S KV+ ++G ++    ++ G GP+   +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 250 RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRA 309
           RYW+ PG +     A + +  +F+ +VS  + A F Y G EL GI A E  NPRK+VPRA
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 310 INKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDN-GSYIAQSPFLIAILNCRTPVLPHI 368
           +    +RI+IFY+ ++F +G+ V YNDP+L  +   G+  A SPF++AI N    VLPHI
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428
           FNA +L  + SA NS++YVGSR L+ L+ +  AP  F +TT  G+P  ++ +  +F  LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPX 488
           Y+NVS+ + +VF++ +N+ +I G ++W+ I I++I FM+ +K +G+ R    Y A F P 
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 489 XXXXXXXXXXXXXXXXXXXXFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRT 546
                               F  H F+  +F   YI + +F I +  ++ I +TK+ ++
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKS 576

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  340 bits (871), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/496 (37%), Positives = 293/496 (59%), Gaps = 8/496 (1%)

Query: 56  DDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAF 115
           DDS  + D  G      +K+ LK RH+SMIA+GG++GTGL I     L   GPV  LIA+
Sbjct: 65  DDSFAIAD--GKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAY 122

Query: 116 MLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELS 175
             +G L +     LGEMA++IP+   FT ++ R++ PA+G A GY Y F + I    +L+
Sbjct: 123 AFVGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 181

Query: 176 IVGQIIQYW--TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIY 233
               +IQYW   D V    WI IF V++V+ N+  VK++GEFEFW++S KV+ ++G ++ 
Sbjct: 182 AAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILL 241

Query: 234 SLCMVCGAGPE-GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELV 292
              ++ G GP+   +GFRYWR PG +     A   +  +F  +V+  + + F+Y G EL 
Sbjct: 242 LFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELT 301

Query: 293 GITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY-IAQS 351
           GI   E +NPRK+VP+AI    +RI++FY+ ++F +G+ V YNDP+L  +   S   A S
Sbjct: 302 GIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS 361

Query: 352 PFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKH 411
           PF++AI N    VLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK F+KT+K 
Sbjct: 362 PFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKW 421

Query: 412 GVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKH 471
           GVP+ A++++ +F  LAY+NVS+ + ++F++ +N+ ++ G ++W+ I I +I F +  + 
Sbjct: 422 GVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 481

Query: 472 RGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPH-FNVSDFFAAYISVFLFFI 530
           +GI +    Y A                         F  H F+   F   YI + ++ +
Sbjct: 482 QGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIL 541

Query: 531 VWAIFQTIYRTKLFRT 546
            WA ++ IY+TK+ ++
Sbjct: 542 SWAGYKLIYKTKVIKS 557

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  339 bits (869), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/489 (37%), Positives = 292/489 (59%), Gaps = 8/489 (1%)

Query: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124
           +G      +K+ L+ RHVSMIA+GG++GTGL I     L  AGP+  LIA+ ++G + ++
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           V   LGEMA +IP+   FT ++ R+  PA+G A GY Y F + +    +L+    ++QYW
Sbjct: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 185 TD--AVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242
                V    WI +F  ++++ N+  VK++GEFEFW++S KV+ ++  +   L +V G G
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGG 228

Query: 243 P-EGPIGFRYWRKPGPWG--NGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGET 299
           P    +GFRYW+ PG +   +G ++    K +F+ + S  + A F Y GTEL GI A E 
Sbjct: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288

Query: 300 KNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAIL 358
           KNPR+ VPRAI    +RI++FY+ ++F +GL V YNDP L +     +  A SP+++AI 
Sbjct: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIK 348

Query: 359 NCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAV 418
           N   PVLPHIFNA +LT + SA NS++YVGSR L+GL+ +  APK F+KT   GVP+ ++
Sbjct: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408

Query: 419 LITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDD 478
            +  +F  LAY+NVS+ A+ +F + +N+T+I G ++W+ I I++I F +  + +GI ++ 
Sbjct: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468

Query: 479 LPYKAKFMPXXXXXXXXXXXXXXXXXXXXXF-APHFNVSDFFAAYISVFLFFIVWAIFQT 537
           L Y+A F P                     F    F+   F   YI + ++ + +  ++ 
Sbjct: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528

Query: 538 IYRTKLFRT 546
           +++TK  ++
Sbjct: 529 VHKTKWIKS 537

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  339 bits (869), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/527 (35%), Positives = 305/527 (57%), Gaps = 10/527 (1%)

Query: 23  SQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAE---VKRALKP 79
           S    +   V+ SK+   L     ++ + +++ D +S +   E   G+ E   +K+ LK 
Sbjct: 14  SPKGDNAKEVTASKL--ALNIEVQSDQSSKSLCDSASDVLASEIGDGKYEGIRLKKQLKS 71

Query: 80  RHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVT 139
           RH+SMIA+GG++GTGL I+    L  AGPV +LIA+  +G + +     LGEMATFIP+ 
Sbjct: 72  RHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMATFIPL- 130

Query: 140 SSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT--DAVPLEAWIAIF 197
             FT ++ R+  PA+G A GY Y   + I    +L+    ++QYW   D V    W+ + 
Sbjct: 131 DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGIWVTLV 190

Query: 198 WVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYS-LCMVCGAGPEGPIGFRYWRKPG 256
           + ++   N+F V+++GEFEFW++S+KV+ +IG +I   + M+ GAG    +GFRYW+ PG
Sbjct: 191 FAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRYWKHPG 250

Query: 257 PWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFR 316
            + +     + +  +F+ +V+ L+   F Y G EL GI A E  NPR++VP+AI   F+R
Sbjct: 251 AFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIKLTFYR 310

Query: 317 ILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTT 376
           IL+FY+ S+F +G+ VPYND KL  ++  S  A SPF IAILN    VLP IFN  +L  
Sbjct: 311 ILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTA-SPFSIAILNAGITVLPDIFNGCLLIF 369

Query: 377 IISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDA 436
           + SA NS++YV SR L+ L+ +N APK F+ T + G+P+ ++ ++ +F  LAY+ VS+ +
Sbjct: 370 VFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYMTVSSSS 429

Query: 437 QEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXX 496
            +VF + +N+ +IAG +TW+ I I++I F + ++ + + +    Y A F P         
Sbjct: 430 AQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYGAYVSLFF 489

Query: 497 XXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKL 543
                       F  HF+   F   YI + +F + +  ++   ++++
Sbjct: 490 CCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSEI 536

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  338 bits (866), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/508 (36%), Positives = 295/508 (58%), Gaps = 8/508 (1%)

Query: 44  SKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103
           S+ +  T  +  DDS  +  P+G      +++ LK RH+SMIA+GG++GTGL I     L
Sbjct: 54  SRSSTFTSPSARDDSFAV--PDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTAL 111

Query: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYW 163
              GPV  LIA+  +G L +     LGEMA++IP+   FT ++ R++ PA+G A GY Y 
Sbjct: 112 MTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYL 170

Query: 164 FSWAITFALELSIVGQIIQYWT--DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVAS 221
           F + I    +L+    +IQYW   D V    WI IF V++V+ N+  VK++GEFEFW++S
Sbjct: 171 FKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSS 230

Query: 222 IKVIAIIGFLIYSLCMVCGAGPE-GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLI 280
            KV+ ++G ++    ++ G GP+   +GFRYWR PG +     A    K +F+ +++  +
Sbjct: 231 FKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFV 290

Query: 281 SAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLE 340
            + F+Y G EL GI   E +NPRK+VP+AI    +RI++FY+ ++F +G+ V YNDP+L 
Sbjct: 291 YSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLI 350

Query: 341 GSDNGSY-IAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNN 399
            +   +   A SPF++AI N    VLPHIFNA +L  + SA NS++YV SR L+ L+ + 
Sbjct: 351 STKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDG 410

Query: 400 LAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLIS 459
            APK FSKT K GVP+ A++ + +F  LAY+NVS  + ++F++ +N+ ++ G ++W+ I 
Sbjct: 411 KAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITIL 470

Query: 460 ISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPH-FNVSDF 518
           I +I F +  + +GI +    Y A                         F  H F+   F
Sbjct: 471 IVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTF 530

Query: 519 FAAYISVFLFFIVWAIFQTIYRTKLFRT 546
              YI + ++   W  ++ IY+TK+ ++
Sbjct: 531 ITGYIGLPVYVFSWVGYKLIYKTKVIKS 558

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  337 bits (863), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/495 (36%), Positives = 290/495 (58%), Gaps = 8/495 (1%)

Query: 56  DDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAF 115
           DDS  +  P+G      +++ LK RH+SMIA+GG++GTGL I     L   GPV  LIA+
Sbjct: 65  DDSFAV--PDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAY 122

Query: 116 MLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELS 175
             +G L +     LGEMA++IP+   FT ++ R++ PA+G A GY Y F + I    +L+
Sbjct: 123 GFVGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 181

Query: 176 IVGQIIQYWT--DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIY 233
               +IQYW   D V    WI IF V++V+ N+  V+++GEFEFW++S KV+ ++G ++ 
Sbjct: 182 AAALVIQYWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILL 241

Query: 234 SLCMVCGAGPE-GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELV 292
              ++ G GP+   +GFRYWR PG +     A   +K +F+ + S  + + F+Y G EL 
Sbjct: 242 LFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELT 301

Query: 293 GITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY-IAQS 351
           GI   E KNPRK+VP+AI    +RI++FY+ ++F +G+ V YNDP+L  +   +   A S
Sbjct: 302 GIVCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAAS 361

Query: 352 PFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKH 411
           PF++AI N    VLPHIFN  +L  + SA NS++YV SR L+ L+ +  APK F+KT+K 
Sbjct: 362 PFVVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKW 421

Query: 412 GVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKH 471
           GVP+ A++++ +F  LAY+NVS  + ++F++ +N+ ++ G ++W+ I I +I F +  + 
Sbjct: 422 GVPYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRA 481

Query: 472 RGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPH-FNVSDFFAAYISVFLFFI 530
           +G+ +    Y A                         F  H F+   F   YI + ++  
Sbjct: 482 QGVDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVF 541

Query: 531 VWAIFQTIYRTKLFR 545
            W  ++ IY+TK+ +
Sbjct: 542 SWVGYKLIYKTKVVK 556

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/486 (37%), Positives = 281/486 (57%), Gaps = 9/486 (1%)

Query: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124
           +G      +K+ LK RH+SMIA+GG++GTGL I     L  AGP   LIA+  +GTL + 
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
              +LGEMA +IP+   FT ++ R+  PA+G A GY Y F + I    +L+    +IQYW
Sbjct: 134 TMAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYW 192

Query: 185 TD--AVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242
            D   V    WI IF V++++ N   VK++GEFEFW++S K++ +IG +I+   ++ G G
Sbjct: 193 VDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGG 252

Query: 243 P-EGPIGFRYWRKPG---PWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGE 298
           P    +GFRYW+ PG   P+ + ++    +  +F+ +V+  + A F Y G EL GI A E
Sbjct: 253 PNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAE 312

Query: 299 TKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAI 357
            +NPR+ +PRAI    +RIL FY+ ++F +G+ V Y+DP L   ++  +  A SPF++AI
Sbjct: 313 AENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAI 372

Query: 358 LNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIA 417
            N    VLPHIFN  +L  + SA NS++YVG+R L+ L+ +  APK F+KT + GVP+ A
Sbjct: 373 QNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNA 432

Query: 418 VLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRD 477
           +    +F  LAY+NVS+ + E+F++ +N+ +I G ++W  I I+ I F + ++ +GI R 
Sbjct: 433 MGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRS 492

Query: 478 DLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXF-APHFNVSDFFAAYISVFLFFIVWAIFQ 536
              Y A F P                     F    F+   F   YI + ++   +  ++
Sbjct: 493 TFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYK 552

Query: 537 TIYRTK 542
             Y+TK
Sbjct: 553 LYYKTK 558

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  330 bits (845), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/521 (35%), Positives = 288/521 (55%), Gaps = 13/521 (2%)

Query: 65  EGS-IGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAY 123
           EG+   +  +++ L  RH+ +IALGG IGTGLF+  S  L N GP+   ++F++I  + Y
Sbjct: 37  EGTKCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVY 96

Query: 124 SVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQY 183
            V  +L EM  ++P   +    + R++ P++G A G+ Y +S++I  A ELS    ++QY
Sbjct: 97  PVMNTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQY 156

Query: 184 WTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP 243
           WTD V +  WI IF V++V  N  PVK+YGE EFW AS+K+I I+G LI S+ +  G  P
Sbjct: 157 WTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAP 216

Query: 244 -EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKN 301
               +GFRYW  PGP+   I   N    RFL   +++I + F +    EL+G+   E K+
Sbjct: 217 SHDRLGFRYWNNPGPFAYHITGGNT--GRFLDIWTAIIKSGFAFILSPELIGLACVEAKD 274

Query: 302 PRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL--EGSDNGSYIAQSPFLIAILN 359
            R+ + +A  +  +RI+ FYI S   IG ++  +DPKL    + +    A SPF+  I N
Sbjct: 275 TRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISN 334

Query: 360 CRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVL 419
              PVL HI NAVIL++  S+ NS +Y  SR +  L+K   APK F++  + GVP+ AV 
Sbjct: 335 AGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVA 394

Query: 420 ITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDL 479
           ++     L YLN S+ + +VF WL NI  I+GFI W LI I+++RF + + +  +  + +
Sbjct: 395 LSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL-YERV 453

Query: 480 PYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF-NVSDFFAAYISVFLFFIVWAIFQTI 538
           P+K+   P                     F P + N SDF AAYI++ +FF+++   +  
Sbjct: 454 PFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIW 513

Query: 539 YRTKL---FRTLXXXXXXXXXXXXXXXXWEEEEPKNLWEKF 576
           ++T+    FR +                 +   PKN+WEKF
Sbjct: 514 FKTRWYIPFREIDVITGLADAEEEAKMT-QPRTPKNMWEKF 553

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  327 bits (839), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 198/573 (34%), Positives = 303/573 (52%), Gaps = 32/573 (5%)

Query: 30  MHVSNSKIDDPL--RFSKDN---NLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSM 84
           M      +DD L  RF+K +   N  L    D S+   + + +     +K+ LK RHV +
Sbjct: 30  MEAQQMNLDDSLDDRFNKKDSGLNKVLTVSSDTSTNSLEEDYT---NTLKQGLKSRHVQL 86

Query: 85  IALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-----VT 139
           IALGG IGTGLF+  S  L   GP G  IA+ +I ++ Y +  ++GEM  ++P       
Sbjct: 87  IALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSA 146

Query: 140 SSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWV 199
            S T   +R++  ++  A G+ Y++ + I  A E +    +++YWT AVP  AWI IF  
Sbjct: 147 GSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLA 206

Query: 200 LLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPW 258
           ++   NM  VK++GE EFW ASIK++ I+G +I S  +  G GP    +GFRYW+ PG +
Sbjct: 207 IIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAF 266

Query: 259 GNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPRKAVPRAINKVFFRI 317
            + +   ++    FL   S +I  AF +  G ELV +T+ E  + R+ + +A  +  +R+
Sbjct: 267 AHHVTDGSL--GNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRL 324

Query: 318 LIFYIGSLFFIGLLVPYNDPKLEG--SDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILT 375
           + FYI     IG++V +NDP L    S+N      SPF+I I N    VLPHI NA ILT
Sbjct: 325 MFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILT 384

Query: 376 TIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSND 435
           +  S+GN+ ++  SR LF +++N  APK F +  K+GVP++AV+++ +   LAYLN S+ 
Sbjct: 385 SAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSS 444

Query: 436 AQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXX 495
           A  VF WL NI+ I+GF+ W+   I+++RF + + +  +  D +P+K    P        
Sbjct: 445 AARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKTWGQPYLILWSLT 503

Query: 496 XXXXXXXXXXXXXFAPHF-NVSDFFAAYISVFLFFI------VWAIFQTIY-RTKLFRTL 547
                        F P F NVSDF AAYI++ +F        V+  F+  Y   KL  ++
Sbjct: 504 VVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSV 563

Query: 548 XXXXXXXXXXXXXXXXWEEEE----PKNLWEKF 576
                            E +E    P N WE+F
Sbjct: 564 EDIDVITGLDEIETKTCELDENRILPTNRWERF 596

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 197/563 (34%), Positives = 293/563 (52%), Gaps = 21/563 (3%)

Query: 21  SQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPR 80
           S S+   +GM    S  ++  R S  N   LE+ + D    +       +  +K+ L  R
Sbjct: 10  SVSKQEFNGMKEVKSN-EETYRTSHSN---LESQNSDVVSDY-------EHNLKKGLSNR 58

Query: 81  HVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTS 140
           H+ +IALGG IGTGLF+  S  L   GP    ++F++I T+ Y +  +L EM  ++P   
Sbjct: 59  HIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQG 118

Query: 141 SFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVL 200
           S      R++ P++G A G+ Y +S+A+  A EL+    I++YWTD VP   WI IF ++
Sbjct: 119 SVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIV 178

Query: 201 LVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWG 259
           +V  N   V++YGE EFW AS+K+I I+  L+ S+ +  G  P    +GFRYWR PG +G
Sbjct: 179 VVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFG 238

Query: 260 NGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPRKAVPRAINKVFFRIL 318
             I   N+   RFL   +++I +AF +    ELVG+   E K+ R+ + +A  +  +RI+
Sbjct: 239 YHITGGNL--GRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRII 296

Query: 319 IFYIGSLFFIGLLVPYNDPK--LEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTT 376
            FY+ S   IG++V  ND    L   +N    A SPF+  I N   PVL H+ N  ILT+
Sbjct: 297 FFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTS 356

Query: 377 IISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDA 436
             SAGNS  Y  SR +  LSK   APK FSK  + GVP+ AV + ++   LAYLNVS+ +
Sbjct: 357 AWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTS 416

Query: 437 QEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXX 496
            +VF WL NI  I+GFI W LI +++IRF + +    +  D +PY++   P         
Sbjct: 417 SKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQPFSAYFFTIV 475

Query: 497 XXXXXXXXXXXXFAP-HFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXX 555
                       F    ++  DF  +YIS+ +F   +   +TIY+T+    +        
Sbjct: 476 VAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVITG 535

Query: 556 XXXXXXXXWEE--EEPKNLWEKF 576
                          PKN WEKF
Sbjct: 536 LEEAEEEAKLSVVRVPKNAWEKF 558

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  325 bits (832), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/548 (35%), Positives = 290/548 (52%), Gaps = 33/548 (6%)

Query: 54  IDDDSSRMFDPEGSIGQAE----VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPV 109
           +D +S    +  GS  Q      +K+ L+ RH+ +IALGG IGTGLF+  S  L   GP 
Sbjct: 26  LDTESLSALNTGGSESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPA 85

Query: 110 GSLIAFMLIGTLAYSVTQSLGEMATFIPVTS-----SFTVFSQRFISPAVGAANGYMYWF 164
           G L ++++I  + Y V  +LGEM  ++P +      S +    R+  P++G A G+ Y++
Sbjct: 86  GLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYY 145

Query: 165 SWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKV 224
            + I  A E +    ++ YWT  VP  AWI IF  ++   N  PVK+YGE EFW A +K+
Sbjct: 146 CYVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKI 205

Query: 225 IAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAA 283
           + I+G L  S  +  G GP    +GFRYW+KPG +   I   N    RFL   + +I   
Sbjct: 206 LCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHITTGNTG--RFLDVWTGVIKGG 263

Query: 284 FTY-QGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS 342
           F +  G ELV +T+ E  + R+ + +A  +  +R++ FY+ S   IG++V  NDP L  +
Sbjct: 264 FAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDA 323

Query: 343 --DNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNL 400
                +  A SPF+IAI N    +LPHI NA IL++  S+GNS ++  SR L  ++++ +
Sbjct: 324 LASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGV 383

Query: 401 APKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISI 460
           APK F K  + GVP+ AV ++A F  LAYLNVS+ + + F W  NI+ I+GFI W+ I +
Sbjct: 384 APKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGV 443

Query: 461 SHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF-NVSDFF 519
           +++RF + +  RG+  D +P+K+ F P                     F P F   +DF 
Sbjct: 444 AYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFV 502

Query: 520 AAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEE----------- 568
           AAYI++ +F ++W +   IY     RTL                 E EE           
Sbjct: 503 AAYITLPVFVVLW-VGHKIYT----RTLSTWVIPVAEVDVTTGLAEIEELTKELDALRVP 557

Query: 569 PKNLWEKF 576
           P + WEKF
Sbjct: 558 PNSAWEKF 565

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/471 (39%), Positives = 272/471 (57%), Gaps = 14/471 (2%)

Query: 17  HSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSI--GQAEVK 74
            S  SQ   + S    S SK  D     KD+   ++++D D +     + +I   Q+ ++
Sbjct: 30  ESGASQEDYSNSSYPKSGSKWKD----FKDSFKRMDSVDLDPNLTDAQKIAILTSQSPLQ 85

Query: 75  RALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT 134
           R LK RH+ MIA+GG IGTGLFI  S  L  AGP G LI + L+ T+   +  SLGEMA 
Sbjct: 86  RKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEMAV 145

Query: 135 FIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEA-W 193
             PV+  +T ++ RFI  + G AN   Y     +   LE+      + YW       A +
Sbjct: 146 TFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYRAAF 205

Query: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYW 252
           +A+FW+ +VS NMF VK YGE EF  + IKV+ +IGF+I  + +VCG GP    IG ++W
Sbjct: 206 VALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGSKFW 265

Query: 253 RKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINK 312
             PG +       +    +F G  S  ++AAF++  TELVG+ A ET++PRK+VP+A  +
Sbjct: 266 SNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQ 320

Query: 313 VFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAV 372
           VF+RI +FYI SL  +GLLVPY DP+L GS      A SPF++A+ N     LP + N V
Sbjct: 321 VFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVD-AAASPFVLALKNHGIKGLPSVINVV 379

Query: 373 ILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNV 432
           ILT ++S GNS+V+  SR L  LS+    P  F    + G P ++++ ++ FG L +L V
Sbjct: 380 ILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAV 439

Query: 433 SNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           S+  QE+FDW+L+++ ++    WL IS+ HIRF + L  +  S D+L + +
Sbjct: 440 SHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFAS 490

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/486 (37%), Positives = 273/486 (56%), Gaps = 15/486 (3%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           + ++++ L  RH+ +IALGG IGTGLF+  S  L   GP G  I++++I T+ Y +  + 
Sbjct: 53  EGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAF 112

Query: 130 GEMATFIP-----VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           GEM  ++P        S +    R++ P++  A G+ Y++ + I  A E +    +++YW
Sbjct: 113 GEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYW 172

Query: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP- 243
           TDAVP  AWI IF  ++V  N+  VK+YGE EFW ASIKV+ I+G +I S  +  G GP 
Sbjct: 173 TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPN 232

Query: 244 EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNP 302
              +GFRYW+ PG + + I   N+    FL   S +I  AF +  G EL+ + + E K+ 
Sbjct: 233 HDRLGFRYWKNPGGFAHHITGGNL--GNFLDVYSGIIKGAFAFILGPELIALASSECKDQ 290

Query: 303 RKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNC 360
           R+ + +A  +  +R++ FYI     I ++V  NDP L  +          SPF+I I N 
Sbjct: 291 RRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNA 350

Query: 361 RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI 420
              +LPHI NA ILT+  SAGN+ ++  SR L  ++ N  APK F K  + GVP++AV  
Sbjct: 351 GIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTF 410

Query: 421 TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP 480
           +A+   LAYLNVS+   +VF W  NI+ I+GFI W    ++++RF + +K+ G+  + LP
Sbjct: 411 SALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLP 469

Query: 481 YKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF-NVSDFFAAYISVFLFFIVWAIFQTIY 539
           Y  +F                       F P F NVSDF AAYI++ LF ++W I   IY
Sbjct: 470 YAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLW-IGHKIY 528

Query: 540 RTKLFR 545
            T+ F+
Sbjct: 529 -TRDFK 533

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  321 bits (823), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/549 (34%), Positives = 292/549 (53%), Gaps = 23/549 (4%)

Query: 51  LEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVG 110
           +++IDD++ +    E S    E+K+ LK RH+ +IALGGTIGT L +  S  L N GP G
Sbjct: 74  IDSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAG 133

Query: 111 SLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFS-----QRFISPAVGAANGYMYWFS 165
             I++++I T  Y +  +LGEM  F+P   S +  S      +++ P++G A  + Y++ 
Sbjct: 134 LFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYC 193

Query: 166 WAITFALELSIVGQIIQYWT--DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223
           + I  A E+S    +I+YW   + VP  AWI IF  L+V  N  PV  YGE EFW ASIK
Sbjct: 194 FVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIK 253

Query: 224 VIAIIGFLIYSLCMVCGAGP--EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLIS 281
           ++ I G +I S  +  G GP  +G +GFRYW+ PG + + I         FL   + +I 
Sbjct: 254 ILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHITGGG--GGNFLDIYTGIIK 311

Query: 282 AAFTY-QGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLE 340
             F+   G ELV +T+ E  + R+ + +A  +  +R++ FYI     IG++V YNDP L+
Sbjct: 312 GGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQ 371

Query: 341 GS--DNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKN 398
            +   + +    SPF+I I N     +PHI N  ILT+  SAGN+ ++  SR L  +++N
Sbjct: 372 NALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARN 431

Query: 399 NLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLI 458
             APK F +  + GVP+ AV  + +   LAYLNVS+   +VF+W  NI+ I+GFI W+  
Sbjct: 432 GNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICA 491

Query: 459 SISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAP-HFNVSD 517
            +++IRF + + +  ++   +P++AK                        F P ++NV D
Sbjct: 492 CVAYIRFRKAITYNKLTH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKD 550

Query: 518 FFAAYISVFLFFIVWAIFQTIYRTKL---FRTLXXXXXXXXXXXXXXXXW----EEEEPK 570
           F AAYI++ +F ++W   +   RT L    R +                       + PK
Sbjct: 551 FIAAYITLPIFIVLWIGHKVFTRTLLKAWLRPIDKIDVYTGLEEIEELTEELNANRQAPK 610

Query: 571 NLWEKFWAV 579
           N WEKF A+
Sbjct: 611 NKWEKFMAI 619

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/458 (38%), Positives = 266/458 (58%), Gaps = 20/458 (4%)

Query: 36  KIDDPLRFSKDN------NLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGG 89
            ++DP +    N       L +E +D + +       +   + +KR LK RH+ MIA+GG
Sbjct: 46  HVNDPNKSRFQNFVDGFRELRMEDVDPNLTAAERAAIATASSPLKRHLKNRHLQMIAIGG 105

Query: 90  TIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRF 149
           +IGTGLF+     L   GP   +IA+++ G++ YSV Q+LGE+A  +PV+ S+  +  RF
Sbjct: 106 SIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGELAVALPVSGSYLSYVSRF 165

Query: 150 ISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVPLEAWIAIFWVLLVSFNMFP 208
           I P+ G A  Y Y     IT  LEL      + YW  D+   +A++A+F++++V  N+F 
Sbjct: 166 IEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYADAFVALFYIVIVGINLFG 225

Query: 209 VKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP--EGPIGFRYWRKPGPWGNGIIAKN 266
           VK YGE EF  + IKV AI+GF+I  + +VCG GP  EG IG RYW  PG + +G     
Sbjct: 226 VKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGARYWYNPGGFAHG----- 280

Query: 267 VNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLF 326
                F G+ +  +++AF++ G+E+  + A ET+NPRK +PRA  +VF+RI +FY+ SL 
Sbjct: 281 -----FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRAAKQVFWRITLFYVISLT 335

Query: 327 FIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVY 386
            IG LVPY D  L  + +    + SPF+IAI       LP + N VIL  ++S GN  VY
Sbjct: 336 LIGCLVPYTDKHLFAASS-VDASASPFVIAIARAGIKGLPSVVNVVILIAVLSVGNCCVY 394

Query: 387 VGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNI 446
             SR +  L+     P+ F    + G P + +L+ A+FG L++L+ S++  EVFDW+L I
Sbjct: 395 AASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFLSASSNYGEVFDWMLAI 454

Query: 447 TAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           + +  F  W  I + H+RF + L  +G S D+L YKA+
Sbjct: 455 SGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQ 492

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  318 bits (814), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/552 (34%), Positives = 287/552 (51%), Gaps = 33/552 (5%)

Query: 46  DNNLTLEAIDDDSSRMFDPEGSIGQA-----EVKRALKPRHVSMIALGGTIGTGLFISIS 100
           DN   +  +    SR    E     A      + + L+ RH+ +IALGG IGTGLF+  S
Sbjct: 14  DNGGYMHKVKTPHSRTSLEELETQSAGSEYNTLHKGLQSRHIQLIALGGCIGTGLFVGTS 73

Query: 101 GPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGY 160
             L N G    L++F+LI T+ Y +  SL EM  ++P   S      R++ P++G A G+
Sbjct: 74  WTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGW 133

Query: 161 MYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVA 220
            Y +++AI  A ELS    ++ YW + VP+ AWI IF V++V  N   VK+YGE EFW A
Sbjct: 134 NYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFA 193

Query: 221 SIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSL 279
           SIK+I I+G L+ S+ +  G  P     GFRYW+ PGP+   +   +    RFL    ++
Sbjct: 194 SIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGST--GRFLDVWRAV 251

Query: 280 ISAAFTY-QGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPK 338
           I +AF +    EL+GI   E ++ R+   +A  +  +RI+ FY+     IG+++   DPK
Sbjct: 252 IKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPK 311

Query: 339 L-EGSDNGS-YIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLS 396
           L E  + G+   A SPF+  I N   PVL H+ N  IL++  SAGNS +Y  +R++  L+
Sbjct: 312 LIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALA 371

Query: 397 KNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWL 456
           +   APKF +K  ++GVP+ AV++  +   LAYLNV   +  VF WL NI  I+GFI W 
Sbjct: 372 REGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWF 431

Query: 457 LISISHIRFMQTLKHRGISRDDL----PYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAP- 511
            + I+ IRF      RGI  ++L    PY+    P                     F   
Sbjct: 432 AMGIAFIRF-----RRGIVFNNLQSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKG 486

Query: 512 HFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEE--- 568
            +NV DF AAY+++ ++ +++   +  +RT+ +  +                 EEE    
Sbjct: 487 RWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVITGLVEA-----EEESKMT 541

Query: 569 ----PKNLWEKF 576
               PKNLWEKF
Sbjct: 542 PPRIPKNLWEKF 553

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  319 bits (817), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/483 (36%), Positives = 277/483 (57%), Gaps = 14/483 (2%)

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
           E+K+ LK RHV +IALGG IGTGLF+  S  L   GP G  I++ +I ++ Y + Q +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 132 MATFIPVTSS----FTVF-SQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTD 186
           M  ++P + S    F  +   +++  ++G A+ + Y++ + I  A E +    +++YWT 
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 187 AVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EG 245
           +VP  AWI IF   +V  N   VK+YGE EFW ASIK++ I+G +I S  +  G GP   
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 246 PIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPRK 304
            +GFRYW+ PG + + I  +  +   FL   + +I   F +  G E++ +T+ E ++ R+
Sbjct: 254 RLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRR 311

Query: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNCRT 362
            + +A  +  +R++ FYI     I ++V YNDP LE +   N      SPF+I I N   
Sbjct: 312 NIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGI 371

Query: 363 PVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITA 422
            VLPHI NA IL++  SAGN+ ++  SR L  +++N  AP+ F+K  + GVP+ AV +++
Sbjct: 372 KVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSS 431

Query: 423 VFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYK 482
               LAYLN S+   +VF+W  NI+ I+GFI W+ + I++IRF + +   G+ +  LPY 
Sbjct: 432 AISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYT 490

Query: 483 AKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF-NVSDFFAAYISVFLFFIVWAIFQTIYRT 541
           A+ MP                     F P F +  +F AAYI++ +F+++W I   +YR 
Sbjct: 491 ARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLW-IGHRVYRR 549

Query: 542 KLF 544
           K+F
Sbjct: 550 KIF 552

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/474 (37%), Positives = 267/474 (56%), Gaps = 13/474 (2%)

Query: 69  GQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQS 128
           G   +K+ LK RH+ +IALGG IGTGLF+  S  L   GP G   ++ +I  + Y V  +
Sbjct: 47  GDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNA 106

Query: 129 LGEMATFIPVTSSFTV-----FSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQY 183
           LGEM  ++P   S +         R++ P++G A G+ Y++ + I  A E +    ++QY
Sbjct: 107 LGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQY 166

Query: 184 WTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP 243
           WT AVP  AWI IF  ++V  N   VK+YGE EFW AS+K++ I+G L  S  +  G GP
Sbjct: 167 WTTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGP 226

Query: 244 E-GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKN 301
               +GFRYW+KPG +   I + N    RFL   + +I   F +  G ELV +T+ E ++
Sbjct: 227 HHDRLGFRYWQKPGAFAYHITSGNT--GRFLDIWTGVIKGGFAFILGPELVALTSAEAQD 284

Query: 302 PRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS-DNGSYIA-QSPFLIAILN 359
            R+ + +A  +  +R++ FY+ S   IG +V YND  L  + D G   A  SPF+I I N
Sbjct: 285 ARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQN 344

Query: 360 CRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVL 419
               VLPHI N  IL++  S+GNS ++  SR L  +S+   APK   +  + GVP+ AV 
Sbjct: 345 AGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVA 404

Query: 420 ITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDL 479
           +T++   +AYLNVS+   +VF W  NI+ I+GFI W+ I I+++RF + +  + +  + +
Sbjct: 405 LTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERV 463

Query: 480 PYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAP-HFNVSDFFAAYISVFLFFIVW 532
           P+K  F P                     F P ++NVSDF AAY+++ +F ++W
Sbjct: 464 PFKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLW 517

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/518 (36%), Positives = 295/518 (56%), Gaps = 10/518 (1%)

Query: 31  HVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGT 90
           ++ N K  +P +   +   T     DD++  FD  G      +K+ LK RHVSMIA+GG+
Sbjct: 24  NIDNKK--EPFQIDIEKESTESVALDDTNEQFD--GKCSDQRLKKDLKARHVSMIAIGGS 79

Query: 91  IGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFI 150
           +GTGL I     L  AGPV  LI++  +G L + V   +GEMA +IP+   FT ++ R+ 
Sbjct: 80  LGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPL-DGFTSYASRYC 138

Query: 151 SPAVGAANGYMYWFSWAITFALELSIVGQIIQYW--TDAVPLEAWIAIFWVLLVSFNMFP 208
            PA+G A GY Y   + I    +L+    +IQYW   + V    WI I  V++V  N F 
Sbjct: 139 DPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFG 198

Query: 209 VKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNV 267
           VK++GEFEFW++S KVI ++G +I    ++ G  P    +GFRYW+ PG +     + + 
Sbjct: 199 VKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHG 258

Query: 268 NKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFF 327
           +  RF+ +VS  +   F Y G EL GI A E +NPRK +P+AI    +RI+IFYI ++F 
Sbjct: 259 DIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFL 318

Query: 328 IGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVY 386
           +G+ V  NDP L E     +  A SPF++AI+N     LPHIFNA +L  + SA NS++Y
Sbjct: 319 LGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLY 378

Query: 387 VGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNI 446
           V SR L+ L+ +N APK F+KT + G+P+ ++ +  +F  LAY++VS+ + ++F++ +N+
Sbjct: 379 VASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNV 438

Query: 447 TAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXX 506
            +I G +TW+ I I++I F + ++ +GI +    Y A   P                   
Sbjct: 439 VSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNF 498

Query: 507 XXFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTKL 543
             F  H F+  +F   YI + LFFI +  ++ + +TK+
Sbjct: 499 TVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTKI 536

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  310 bits (795), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 181/456 (39%), Positives = 255/456 (55%), Gaps = 28/456 (6%)

Query: 34  NSKIDDPL-----RFSKDNNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRHVSMIA 86
            SK DD +      +    N+    ID      F P  +GS     +KR LK RH+ MIA
Sbjct: 44  QSKDDDDIAEGHSSYQPPRNIFQRCIDS-----FKPPLDGSFHTHNLKRTLKARHLIMIA 98

Query: 87  LGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFS 146
           +GG+IGTGLFI     L + GP+  +I + + GT        LGE+    PV  +F  +S
Sbjct: 99  IGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGEITVRFPVVGAFANYS 158

Query: 147 QRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNM 206
            RF+ P++      +Y   W     LE+      IQYW  ++    W+AIF+ ++VS N+
Sbjct: 159 TRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSIDPVVWVAIFYCVIVSINL 218

Query: 207 FPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAK 265
           F  + +GE EF  +SIKVI IIGF+I  + ++CG GP+   +G RYW  PG   +G    
Sbjct: 219 FGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGARYWHDPGCLSHG---- 274

Query: 266 NVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSL 325
                 F G +S L+ A+++  GTE+V + +GET NPR+ +P AI + F+RIL F++ SL
Sbjct: 275 ------FPGVLSVLVVASYSLGGTEMVCLASGET-NPRE-LPSAIKQTFWRILFFFLISL 326

Query: 326 FFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNV 385
             IG LVPY +P L G   GS +  SPF+IAI       LP I NAVIL +I+S GNS +
Sbjct: 327 TLIGFLVPYTNPNLLG---GSSVNNSPFVIAIKLHHIKALPSIVNAVILISIMSVGNSCI 383

Query: 386 YVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLN 445
           +  SR L  ++   L PKFF    + G P   +L  ++FG LA+L  S+   EVFDWL+ 
Sbjct: 384 FASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMA 443

Query: 446 ITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           I  +A  I WL I+ISHIRF   +K +G S D+L +
Sbjct: 444 IAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEF 479

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  312 bits (800), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 182/541 (33%), Positives = 287/541 (53%), Gaps = 23/541 (4%)

Query: 19  NLSQSQSARSGMHVSNSKIDDPLRFSK--------DNNLTLEAIDDDSSRMFDPEGSIGQ 70
            +++S S+ S  H   ++ DD +R  K         N    E +D + S   D  G  G 
Sbjct: 102 QVTESPSSGSRTHHYEAEKDDAIRMEKISKNQSASSNGTVREELDLEKSPSAD--GDAGP 159

Query: 71  AEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLG 130
             +K+ L+ RHV +IALGG IGTGL +  S  L   GP G  I++++I  + Y +  +LG
Sbjct: 160 HRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALG 219

Query: 131 EMATFIPVTSSFTVFSQ-----RFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT 185
           EM  F+P   S +  S      R++  ++G A G+ Y++ + I  A E +    +++YWT
Sbjct: 220 EMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWT 279

Query: 186 DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEG 245
            AVP   WI IF  ++V  N   VK YGE EFW ASIK++ I+G +I S  +  G GP+ 
Sbjct: 280 TAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKH 339

Query: 246 P-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPR 303
             +GFRYW+ PG + + +   ++    F    + +I  AF +  G ELV +T+ E  + R
Sbjct: 340 DRLGFRYWQHPGSFAHHLAGGSLGN--FTDIYTGIIKGAFAFILGPELVCMTSAECADQR 397

Query: 304 KAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNCR 361
           + + +A  +  +R++ FY+     I ++VPYNDP L  +          SP++I I N  
Sbjct: 398 RNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAG 457

Query: 362 TPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLIT 421
             VLPHI N  ILT+  SA N+ ++  +R L  +++   APK   K  + GVP++AV ++
Sbjct: 458 IKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVS 517

Query: 422 AVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
            +   LAYLNVS+   +VF+W  NI+ I+GF+ W+   I+++RF + +   G+  D LP+
Sbjct: 518 FLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPF 576

Query: 482 KAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF-NVSDFFAAYISVFLFFIVWAIFQTIYR 540
           K    P                     F P + NV+DF AAYI++ +F ++W   +   R
Sbjct: 577 KTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTR 636

Query: 541 T 541
           T
Sbjct: 637 T 637

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  310 bits (793), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 167/415 (40%), Positives = 247/415 (59%), Gaps = 8/415 (1%)

Query: 71  AEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLG 130
           A + R LK RH+ MIA+GG IG GLF+     L  AGP G LI + L  T+   +  SLG
Sbjct: 81  APLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLG 140

Query: 131 EMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVP 189
           E+A   PV+  +  ++ RFI  + G AN + Y     +   LE+      + YW TD   
Sbjct: 141 ELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKY 200

Query: 190 LEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IG 248
             A++A+FWV++VS N+F V+ +GE E   + IKVI IIGF+I  + ++ G GP+   IG
Sbjct: 201 KLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIG 260

Query: 249 FRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPR 308
            +YW  PGP+       N    +F G  S  ++AAF++ G+EL+G+ A ET+ PRK++P+
Sbjct: 261 GKYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPK 315

Query: 309 AINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHI 368
           A  +VF+RI +FYI SL  +GLLVP N+  L         A SPF+IA+   R  VLP I
Sbjct: 316 AAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDA-AHSPFVIAMDMHRIRVLPSI 374

Query: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428
            N VILT +IS GNS+VY  SR +  L+++   PK F    + G P  A+  T++FG L 
Sbjct: 375 INVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLC 434

Query: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           ++  + +  E+FDWLL I+ ++ F TWL I+++H+RF   LK +G + ++L + +
Sbjct: 435 FVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTS 489

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  309 bits (791), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 185/534 (34%), Positives = 283/534 (52%), Gaps = 25/534 (4%)

Query: 21  SQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPR 80
            QSQ + +  H    +  +   F +   + L+    ++ R+        Q+ +K  LK R
Sbjct: 32  DQSQGSSTEAHSRWGRFKE--SFKRAEEMELDPNLTEAERI---AIKTAQSPLKHHLKNR 86

Query: 81  HVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTS 140
           H+ MIA+GG IGTGLF+     L  AGP G LI + L GT+ YS+  ++GE+A   PV  
Sbjct: 87  HLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGELAVVFPVAG 146

Query: 141 SFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVPLEAWIAIFWV 199
            FT ++ RF+  + G A  ++Y   W +   LE+      + YW TD    + ++A+F+V
Sbjct: 147 GFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYV 206

Query: 200 LLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPW 258
           ++V  NMF VK YGE EF  + IKVI +IGF+I ++ ++CG G +   IG +YW  PG +
Sbjct: 207 VIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAF 266

Query: 259 GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRIL 318
                  +    +F G+ +  ++AAF++ G+ELVG+   E + PRK+VP A  +VF+RI 
Sbjct: 267 -----VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRIT 321

Query: 319 IFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTII 378
           +FYI  L  IG+LVP + P+L G+ +    A SPF+IAI+N     LP + N VIL  ++
Sbjct: 322 LFYILCLLLIGMLVPSDSPRLIGASSVD-AAASPFVIAIVNHGIKGLPSVVNVVILIAVL 380

Query: 379 SAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQE 438
           S GNS +Y  SR L  L+     P       + G P + + I+A FG +A++  S    +
Sbjct: 381 SVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGD 440

Query: 439 VFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXX 498
           VF+WL+ ++ ++   TW  I + HIR+   L  +G S D+LP++A   P           
Sbjct: 441 VFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQA---PAGVWGSYWGFF 497

Query: 499 XXXXXXXXXXFAPHF------NVSDFFAAYISVFLFFIVWAIFQTIYRT--KLF 544
                     +   F      N  DFF AY+S F  FI    F  I++   KLF
Sbjct: 498 MCILMFIAQFYVGLFPPGTKPNAYDFFLAYLS-FCIFIALYAFHKIWKRNWKLF 550

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  310 bits (793), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 181/521 (34%), Positives = 282/521 (54%), Gaps = 23/521 (4%)

Query: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132
           +K+ L+ RH+ +IALGG IGTGLF+  S  L   GP G L ++++I  + Y V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 133 ATFIPVTS-----SFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDA 187
             F+P ++     S +    R+  P++G A G+ Y++ + I  A E +    ++ YWT A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 188 VPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGP 246
           VP  AWIAIF  ++   N  PVK YGE EFW A +K++ I+G L  S  +  G GP    
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 247 IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPRKA 305
           +GFRYW+ PG +   I   N    RFL   + +I   F +  G ELV IT+ E  + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTGNTG--RFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 306 VPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNCRTP 363
           + +A  +  +R++ FY+ S   IG++V   DP L+ +  +  +    SPF+IAI N    
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 364 VLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAV 423
           VLPHI NA IL++  S+GNS ++  SR L  ++++  AP+   +  + GVP+ AV ++A 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 424 FGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           F  LA+LNVS+ + + F W  NI+ I+GFI W+ I +++++F + +  RG+  + +P+K+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 484 KFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKL 543
              P                     F  ++N SDF AAYI++ +F ++W +   IY T+ 
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLW-VGHKIY-TRT 578

Query: 544 FRTLXXXXXXXXXXXXXXXXWEEEE--------PKNLWEKF 576
           + T                  EE +        P N W+KF
Sbjct: 579 WSTWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  309 bits (791), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 170/411 (41%), Positives = 245/411 (59%), Gaps = 8/411 (1%)

Query: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132
           +K  LK RH+ MIA+GG IGTGLF+     L  AGP   +I + + G++ YS+  ++ EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 133 ATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVPLE 191
           A   P++  FT ++ RFI  + G AN + Y   W +   LE+      + YW T     +
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-R 250
            ++A+FW+++V  N+F VK YGE EF  ++IKVI ++GF+I  L +VCG GP G     +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 251 YWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAI 310
           YW  PG +           A+F G+ S  ++AAF++ G+EL+GI   E +NPRKAVP A 
Sbjct: 269 YWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAA 323

Query: 311 NKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFN 370
            +VF+RIL+FYI SL FIGLLVP ND +L GS N    A SPF+IAI       LP + N
Sbjct: 324 KQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVD-AAASPFVIAITVHGIRGLPSVIN 382

Query: 371 AVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYL 430
            VIL  ++S GNS +Y  SR L  L++    PK  S   + G P + + I++ FG +A++
Sbjct: 383 VVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFV 442

Query: 431 NVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
             S+   +VF+WLL I+ ++ F TW  I + HIRF   LK +  S D+LP+
Sbjct: 443 AQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPF 493

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  308 bits (789), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 170/430 (39%), Positives = 251/430 (58%), Gaps = 7/430 (1%)

Query: 54  IDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLI 113
           +D + S +         + ++  LK RH+ MIA+GG IGTGLF+     L  AGP G LI
Sbjct: 62  VDPNMSELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILI 121

Query: 114 AFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALE 173
            + L GT+ YS+  +LGE+A   PV+  FT ++ RFI  + G AN   Y   W +   LE
Sbjct: 122 GWGLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLE 181

Query: 174 LSIVGQIIQYW-TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLI 232
           +      + YW T+    + ++A+FW+ +   N+F VK YGE EF  + IKVI ++GF+I
Sbjct: 182 IVAASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFII 241

Query: 233 YSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTEL 291
             + + CG GP +G IG RYW  P     G    +   ARF G  S  ++AAF++ G+EL
Sbjct: 242 LGIILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSEL 297

Query: 292 VGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQS 351
           VG+ + ET NPRK+VP+A  +VF+RI +FY+ +L  +GLLVPY + +L G+ +    A S
Sbjct: 298 VGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVD-AAAS 356

Query: 352 PFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKH 411
           PF+IAI       LP + N VIL  ++S GNS +Y  SR L  L++ N  PKFF    + 
Sbjct: 357 PFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRS 416

Query: 412 GVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKH 471
           G P  ++L+T+ FG +A++  S    EVF+WLL ++ ++   TW  I + HIRF + L  
Sbjct: 417 GRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSA 476

Query: 472 RGISRDDLPY 481
           +G   D+L +
Sbjct: 477 QGRGTDELSF 486

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  308 bits (790), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 161/421 (38%), Positives = 253/421 (60%), Gaps = 8/421 (1%)

Query: 66  GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSV 125
           G  G  ++K+ +K RHV MI+LG  IGTG+ +     L N GP G +I + ++G+  Y +
Sbjct: 89  GDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCI 148

Query: 126 TQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
            Q+ GE+A  +  ++  F  +    I PA+G +  ++Y   W     LEL      I+YW
Sbjct: 149 IQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYW 208

Query: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGP 243
           T +V  + ++AIF+V++++ N+F  + Y E EF+  + KV+ I GFLI  + + CG AG 
Sbjct: 209 TTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGN 268

Query: 244 EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPR 303
           +G IG +YW  PG +      K ++   F G VS+L++AAF +  TE + +TA E  NPR
Sbjct: 269 DGYIGGKYWNDPGSFSGD---KPID--HFKGVVSTLVTAAFAFGATEFIALTAAEQANPR 323

Query: 304 KAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTP 363
           K++P A  K+ +RIL+ Y+GS+  IG LVP+N  +L GS  GS    SP++IAI +    
Sbjct: 324 KSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGS-GGSATHASPYVIAIASHGVK 382

Query: 364 VLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAV 423
           V+PH+ NAVIL ++IS GNS  Y  SR+L  L++   AP F     + G P +A++I++V
Sbjct: 383 VVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSV 442

Query: 424 FGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           FG ++++  S   + VF WLL I+ ++   TW  I +SHIRF + +K +G S  +L +K+
Sbjct: 443 FGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKS 502

Query: 484 K 484
           +
Sbjct: 503 Q 503

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  308 bits (788), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 182/541 (33%), Positives = 289/541 (53%), Gaps = 24/541 (4%)

Query: 21  SQSQSARSGMHVSNSKIDDPLRFSK-------DNNLTLEA---IDDDSSRMFDPEGSIGQ 70
           S S  +R+  H S+++ DD +R  K        +N T+     +D D  +    +G    
Sbjct: 45  SPSSGSRNN-HRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPSVDGDSEP 103

Query: 71  AEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLG 130
            ++K+ L+ RHV +IALGG IGTGL +  S  L   GP G  I++++I  + Y +  +LG
Sbjct: 104 HKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALG 163

Query: 131 EMATFIPVTSSFTVFSQ-----RFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT 185
           EM  F+P   S +  S      R++ P++G A G+ Y++ + I  A E +    +++YWT
Sbjct: 164 EMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWT 223

Query: 186 DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-E 244
            AVP   WI IF  ++V  N   VK YGE EFW ASIK++ I+G +I S  +  G GP  
Sbjct: 224 TAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNH 283

Query: 245 GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPR 303
             +GFRYW+ PG + + +   ++    F    + +I  AF +  G ELV +T+ E  + R
Sbjct: 284 DRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQR 341

Query: 304 KAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNCR 361
           + + +A  +  +R++ FY+     I ++VPYNDP L  +          SPF+I I N  
Sbjct: 342 RNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAG 401

Query: 362 TPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLIT 421
             VLPHI N  ILT+  SA N+ ++  +R L  +++   APK   +  K GVP++AV ++
Sbjct: 402 IKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVS 461

Query: 422 AVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
            +   LAYLNVS+   +VF+W  NI+ I+GF+ W+   I+++RF + + + G+  D LP+
Sbjct: 462 FLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPF 520

Query: 482 KAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF-NVSDFFAAYISVFLFFIVWAIFQTIYR 540
           K    P                     F P +  V+DF AAYI++ +F ++W   +   R
Sbjct: 521 KTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTR 580

Query: 541 T 541
           T
Sbjct: 581 T 581

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  306 bits (784), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 163/419 (38%), Positives = 247/419 (58%), Gaps = 8/419 (1%)

Query: 67  SIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVT 126
           +  ++ ++  LK RH+ MI++GG IGTGLF+     L  AGP G LI +++ G++ Y + 
Sbjct: 78  ATARSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMV 137

Query: 127 QSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-T 185
            S+ E+A   PV   FT ++ RFI  + G AN + Y   W +T  LE+      + YW T
Sbjct: 138 MSVAELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHT 197

Query: 186 DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEG 245
           D    + ++A+FWV++V  NMF V+ YGE EF  +  K++ I+GF+I ++ ++CG GP  
Sbjct: 198 DKKYRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGT 257

Query: 246 PIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRK 304
                RYW  PG +     A + +  +F G+ S  ++AAF++ G+ELVG+ A E  NPRK
Sbjct: 258 GYIGARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRK 312

Query: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPV 364
            VP A  +VF+RI +FY+  L  IG+LVPY DP+L G  +    A SPF+IAI N     
Sbjct: 313 DVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVD-AAASPFVIAIKNQGISG 371

Query: 365 LPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVF 424
           LP + N VIL  ++S GNS VY  SR L  L+     PK FS   + G P + + +T+ F
Sbjct: 372 LPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAF 431

Query: 425 GFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           G +A++  S+   EVFDWL+ ++ ++   TW  I + HIRF + L  +G S ++L + +
Sbjct: 432 GLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFAS 490

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  308 bits (788), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 167/454 (36%), Positives = 267/454 (58%), Gaps = 14/454 (3%)

Query: 33  SNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIG 92
           S+S++D+ L   K + +T++ I   SS+  +P+    Q  +K+++KPRH  M++LG  IG
Sbjct: 111 SSSRLDNELN-PKSSYITVDGIKQ-SSQEQEPK----QENLKKSIKPRHTVMMSLGTGIG 164

Query: 93  TGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFIS 151
           TGL +  S  L NAGP G +I + ++G+  Y + Q+ GE+A  +  +   F  +    + 
Sbjct: 165 TGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVD 224

Query: 152 PAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKW 211
           PAVG +  +++   W     LEL      I+YWT  V  + ++ IF+VL++  N+F  K 
Sbjct: 225 PAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILVINIFGAKG 284

Query: 212 YGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKA 270
           Y E +F+    K++ I GF I ++ + CG AG +G IG RYWR PG +       + +  
Sbjct: 285 YAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAFRG-----DTSIQ 339

Query: 271 RFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGL 330
           RF G V++ ++AAF +  +E + +TA E  NPRKA+P A  K+ +RIL  ++ SL  +G 
Sbjct: 340 RFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGF 399

Query: 331 LVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSR 390
           LVPY   +L G+  GS    SP++IA+ +    V+PH  NAVIL +++S  NS  Y  SR
Sbjct: 400 LVPYTSDQLLGA-AGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSR 458

Query: 391 ILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIA 450
           IL  L+K   APK F    + G P +A++++AVFG +A+   S   ++VF WLL I+ ++
Sbjct: 459 ILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLS 518

Query: 451 GFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
              TW+ I +SHIRF + +K +G S  ++ YK++
Sbjct: 519 QLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQ 552

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  305 bits (781), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 172/437 (39%), Positives = 256/437 (58%), Gaps = 8/437 (1%)

Query: 47  NNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNA 106
             + +E +D + + +        ++ ++  LK RH+ MIA+GG IGTGLF+     L  A
Sbjct: 62  KRVEVEEVDPNLTDLEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTA 121

Query: 107 GPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSW 166
           GP G LI + + GT+ +++  +LGE+A   PV+  FT ++ RFI  + G A  + Y   W
Sbjct: 122 GPAGILIGWSITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQW 181

Query: 167 AITFALELSIVGQIIQYWTDAVPL-EAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVI 225
            +   LE+      + YW   V   + ++A+FW+++V  NMF V+ YGE EF  + IKV 
Sbjct: 182 LVVLPLEIVAASITVAYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVT 241

Query: 226 AIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAF 284
           A+IGF+I  + +VCG GP G     RYW  PG +       + +  +F G+ S  ++AAF
Sbjct: 242 AVIGFIILGIVLVCGGGPVGGYVGARYWHNPGAF-----VGSTSGQKFHGFCSVFVTAAF 296

Query: 285 TYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDN 344
           ++ G+EL+G+   E KNPRKAVP A  +VF+RIL+FYI  L  IG LVPYNDP+L  S +
Sbjct: 297 SFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSS 356

Query: 345 GSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKF 404
               + SPF+IAI+      LP + N VIL +++S GNS +Y  SR L  LS+    PK 
Sbjct: 357 -VDASASPFVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKI 415

Query: 405 FSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIR 464
            S   + G P + + I++ FG +A++  SN   E+F+WLL I+ ++ F TW  I I HIR
Sbjct: 416 VSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIR 475

Query: 465 FMQTLKHRGISRDDLPY 481
           F   LK +G   D+LP+
Sbjct: 476 FRGALKAQGRGTDELPF 492

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  306 bits (785), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 165/470 (35%), Positives = 261/470 (55%), Gaps = 8/470 (1%)

Query: 17  HSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRA 76
           H N   S ++  G     S  D   +   + N     + +   +    E    Q  +K+ 
Sbjct: 87  HPNSPDSSNSIGGGATPISTNDSSSQLDNELNPKGSFVTESGIKQPSQEQDQNQENLKKT 146

Query: 77  LKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT-F 135
           +KPRH+ M++LG  IGTGL +  S  L NAGP G +I + ++G+  Y + Q+ GE+A  +
Sbjct: 147 IKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIY 206

Query: 136 IPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIA 195
             +   F  +    + PA+G +  ++Y   W     LEL      I+YWT  V  + ++ 
Sbjct: 207 SDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVV 266

Query: 196 IFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRK 254
           IF+VL++  N+F  K Y E +F+    K++ IIGF I ++ + CG AG +G IG RYW  
Sbjct: 267 IFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHN 326

Query: 255 PGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVF 314
           PG +       N    RF G V++ ++AAF +  +E + +TA E  NPRKA+P A  K+ 
Sbjct: 327 PGAF-----RGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMI 381

Query: 315 FRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVIL 374
           +RIL  ++GSL  +G LVPY   +L G+ +GS    SP++IA+ +    V+PH  NAVIL
Sbjct: 382 YRILFVFLGSLVLVGFLVPYTSDQLLGA-SGSATKASPYVIAVASHGVRVVPHFINAVIL 440

Query: 375 TTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSN 434
            +++S  N   Y  SRIL  L+K   APK F    + G P +A+L++++FG +A+   S 
Sbjct: 441 LSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSP 500

Query: 435 DAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
             ++VF WLL I+ ++   TW+ I +SHIRF + +K +G S  ++ YK++
Sbjct: 501 KEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQ 550

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  305 bits (780), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 170/449 (37%), Positives = 263/449 (58%), Gaps = 13/449 (2%)

Query: 35  SKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTG 94
           ++I D  + ++      E +D + +       +  +A +K  LK RH+ M+A+GG IG+G
Sbjct: 62  TRIKDSFKRAEK-----EEVDPNLTEAERIAINTAKAPLKHTLKGRHMQMVAIGGAIGSG 116

Query: 95  LFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAV 154
           LF+  S  L  AGP G +I + L  T+ Y +  +LGE+A   PV+  FT ++ RFI  + 
Sbjct: 117 LFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVFPVSGGFTTYATRFIDESF 176

Query: 155 GAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVPLEAWIAIFWVLLVSFNMFPVKWYG 213
           G A+ + Y   W  T  LE+      + YW T     + ++A+FW+++V  N+F V+ +G
Sbjct: 177 GFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDGFVALFWLVIVIINLFGVRGFG 236

Query: 214 EFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARF 272
           E EF  ++IKV+ +IGF+I  + +V G GPEG     RYW  PG +    +  N    +F
Sbjct: 237 EAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAF----VGDNAG-TQF 291

Query: 273 LGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLV 332
            G  S  ++AAF++ G+ELVGITA E  NPRK+VPRA  +V +RI++FY+GSL  IGLLV
Sbjct: 292 KGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLV 351

Query: 333 PYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRIL 392
           PY DP+L G+ +    A SPF+IAI+      LP + N VIL  ++S GNS ++ GSR +
Sbjct: 352 PYTDPRLIGASSVDASA-SPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTI 410

Query: 393 FGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGF 452
             LS+    P+ F    + G P + +++ + FG +A++  S    EVF WL+ ++ ++  
Sbjct: 411 AALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSL 470

Query: 453 ITWLLISISHIRFMQTLKHRGISRDDLPY 481
            TW  I + HIRF   LK +G S ++LP+
Sbjct: 471 FTWGGICLCHIRFRMALKAQGRSTNELPF 499

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  303 bits (776), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 178/501 (35%), Positives = 271/501 (54%), Gaps = 20/501 (3%)

Query: 47  NNLTLEAIDDDSSRMFDPEGSI---GQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103
           N L LE++  +     D    +   G  ++K+ L  RHV  IALGGTIGTGLF+  S  L
Sbjct: 29  NELDLESLTREKITRSDSSSEVEAEGNGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTL 88

Query: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-----VTSSFTVFSQRFISPAVGAAN 158
              GP G +I++++I T+ Y +  +LGEM  ++P        S      R++  ++  A 
Sbjct: 89  KTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFAT 148

Query: 159 GYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFW 218
           G+ Y++ + I  A E +    ++ YWT +VP   WI IF  ++   N   VK++GE EFW
Sbjct: 149 GWNYYYCFVILVAAECTAASGVVTYWTTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFW 208

Query: 219 VASIKVIAIIGFLIYSLCMVCGAGPEG-PIGFRYWRKPGPWGNGIIAKNVNKARFLGWVS 277
            ASIK++ I+G ++ S  +  G GP    +GF YW+ PG + + I   +     FL   +
Sbjct: 209 FASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGTFAHHITGGS--WGSFLDIYT 266

Query: 278 SLISAAFTY-QGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYND 336
            +I  AF +  G ELV +T+ E  + R+ + +A  +  +R++ FYI     I ++V YND
Sbjct: 267 GIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYND 326

Query: 337 P----KLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRIL 392
           P     LE    G+  A SPF+I I N    VLPHI NA IL++  SAGNS ++  SR L
Sbjct: 327 PVLLNALEEGKEGA--ASSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSL 384

Query: 393 FGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGF 452
             ++ N  APK F K  + GVP+ +V ++A+   LA+LNVS+   +VFDW  NI+ I+GF
Sbjct: 385 MTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGF 444

Query: 453 ITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPH 512
           + W+   I+++RF + + +  +  D LP+K    P                     F P 
Sbjct: 445 LGWICAIIAYLRFRKAIFYNNM-YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPR 503

Query: 513 F-NVSDFFAAYISVFLFFIVW 532
           F + SDF AAYI++ LF I+W
Sbjct: 504 FWSGSDFVAAYITLPLFLILW 524

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  303 bits (776), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 176/486 (36%), Positives = 277/486 (56%), Gaps = 9/486 (1%)

Query: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124
           +G      +K+ L+ RHVSMIA+GG++GTGL I     L  AGP   LIA+ ++G + ++
Sbjct: 51  DGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFT 110

Query: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           V   LGEMA +IP+   FT ++ R+  PA+G A G+ Y F + +    +L+    +IQ+W
Sbjct: 111 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFW 169

Query: 185 TDAVPLE--AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242
             A  +    WI +   ++V  N   V+++GEFEFW++S KV+ ++  +I  L +  G G
Sbjct: 170 IPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGG 229

Query: 243 P-EGPIGFRYWRKPGPWGNGIIAKNVNKA---RFLGWVSSLISAAFTYQGTELVGITAGE 298
           P    +GFRYW  PG +          K    +F+ ++S  + A F Y GTEL GI A E
Sbjct: 230 PTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAE 289

Query: 299 TKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAI 357
            K+PR+ VPRAI    +RI++FY+ ++F +G+ V YNDP L + S      A SP+++AI
Sbjct: 290 CKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAI 349

Query: 358 LNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIA 417
            N   PVLP++FNA +LT + SA NS++YVGSR L+GL+ +  APK F++T K GVP+ A
Sbjct: 350 ENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNA 409

Query: 418 VLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRD 477
           +    +F  LAY++VS  A+  F + +N+T+I G ++W+ I I++I F +  + +GI + 
Sbjct: 410 LACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKS 469

Query: 478 DLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXF-APHFNVSDFFAAYISVFLFFIVWAIFQ 536
            L Y A   P                     F     +V  F   YI + ++   +  ++
Sbjct: 470 TLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYK 529

Query: 537 TIYRTK 542
            +++TK
Sbjct: 530 IVHKTK 535

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  302 bits (773), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 180/504 (35%), Positives = 263/504 (52%), Gaps = 26/504 (5%)

Query: 27  RSGMHVSNSKIDD------PLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPR 80
            +G  VSN  + D       +     NN   E    +    FDP+     + VKR LK R
Sbjct: 9   HTGEVVSNRGLKDAYNEVTEMEVDPKNNEYAEEQSLNREDTFDPD-----SGVKRQLKDR 63

Query: 81  HVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTS 140
           H+S++ALGG IG G  I     L   GP+  L+ F +IG LA+ + +S+GEM T  P   
Sbjct: 64  HISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPSGG 123

Query: 141 SFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVL 200
            FT  ++RF S A+ A  GY Y   +    A E + +  I+Q+W   VPL  +I IFW  
Sbjct: 124 GFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVPLYGYILIFWAA 183

Query: 201 LVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWG 259
              F +  V  +GE E+W+A  K++ ++ + I+S+  + G     P  GF+YW  PG   
Sbjct: 184 FQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGALS 243

Query: 260 NGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILI 319
           NG          F G  +  +  +  Y GTE V + A E+KNPR+AVP AI + F+RILI
Sbjct: 244 NG----------FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQTFWRILI 293

Query: 320 FYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIIS 379
            Y+G   F G+ VPYND  L   +  + + +SP  IAI     P   H+ NA IL T IS
Sbjct: 294 VYLGISIFYGVTVPYNDENL---NFATKVLKSPIAIAISRAGWPAGVHLVNAFILITCIS 350

Query: 380 AGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEV 439
           A N ++Y+GSR L  L+   LAPK  + T + GVP  A+ +    G ++ +NVS  A + 
Sbjct: 351 AINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDA 410

Query: 440 FDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXX 499
           +++++N++ +  FI W +IS++H+RF +  K +G +RD+LPYKAK  P            
Sbjct: 411 YNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIF 470

Query: 500 XXXXXXXXXFAPHFNVSDFFAAYI 523
                    F P F+  +F  AYI
Sbjct: 471 LGLVQGWSYFKP-FDAKNFVDAYI 493

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  302 bits (774), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 160/431 (37%), Positives = 249/431 (57%), Gaps = 8/431 (1%)

Query: 52  EAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGS 111
           E +DD    +F+         + R L  RH+  +A+GG IGTGLF++    L   GP   
Sbjct: 52  EDMDDVEKAIFNTTKR--SLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASL 109

Query: 112 LIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFA 171
           +IA+ +I T  +++  +LGE+A   PV   F V+  R + P++G A    Y   WA+   
Sbjct: 110 VIAWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLP 169

Query: 172 LELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFL 231
           LEL      I+YW ++V  +AW+A+F+V +   ++  VK +GE EF ++ +K++AI GF 
Sbjct: 170 LELVAASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFT 229

Query: 232 IYSLCMVCGAGPE-GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTE 290
           I  + ++CG GP+ G IG +YW  PG +           ++F G  S  ++AAF+Y GTE
Sbjct: 230 ILGIVLICGGGPKNGYIGAKYWNDPGSF-----VGASPGSQFKGLCSVFVTAAFSYSGTE 284

Query: 291 LVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQ 350
           LVG++A E+ NPR  +P+A  + F+ I + Y+  L  IG LV ++DPKL  + +   +A 
Sbjct: 285 LVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAA 344

Query: 351 SPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTK 410
           SP +IAI N     LP + NA+IL  IIS  NS+VY  SR +  +++    P+ F+    
Sbjct: 345 SPLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDN 404

Query: 411 HGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLK 470
            G P +A++ T VFG L+++  SN  +E+F WL  ++ ++    WL I+ISHIRF + L 
Sbjct: 405 RGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALN 464

Query: 471 HRGISRDDLPY 481
            +G S D+LPY
Sbjct: 465 TQGYSLDELPY 475

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  304 bits (778), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 164/454 (36%), Positives = 263/454 (57%), Gaps = 14/454 (3%)

Query: 33  SNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIG 92
           S+S++D+ L   K + +T++ I     +    E    Q  +K+++KPRH  M++LG  IG
Sbjct: 111 SSSQLDNELN-RKSSYITVDGI-----KQAPQEQEQKQENLKKSIKPRHTVMMSLGTGIG 164

Query: 93  TGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFIS 151
           TGL +  S  L NAGP G +I + ++G+  Y + Q+ GE+A  +  +   F  +    + 
Sbjct: 165 TGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVD 224

Query: 152 PAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKW 211
           PA+G +  +++   W     LEL      I+YWT  V  + ++ IF+VL++  N+F  K 
Sbjct: 225 PALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKG 284

Query: 212 YGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKA 270
           Y E +F+    K++ IIGF I ++ + CG AG +G IG +YWR PG +       +    
Sbjct: 285 YAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRG-----DTPIQ 339

Query: 271 RFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGL 330
           RF G V++ ++AAF +  +E + +TA E  NPRKA+P A  K+ +RIL  ++ SL  +G 
Sbjct: 340 RFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGF 399

Query: 331 LVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSR 390
           LVPY   +L G+  GS    SP++IA+ +    V+PH  NAVIL +++S  NS  Y  SR
Sbjct: 400 LVPYTSDQLLGA-AGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSR 458

Query: 391 ILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIA 450
           IL  L+K   APK F    + G P +A+L++A+FG +A+   S   ++VF WLL I+ ++
Sbjct: 459 ILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLS 518

Query: 451 GFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
              TW+ I +SHIRF + +K +G S  ++ YK++
Sbjct: 519 QLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQ 552

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  301 bits (772), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 177/523 (33%), Positives = 281/523 (53%), Gaps = 28/523 (5%)

Query: 44  SKDN-NLTLEAIDDDS----------SRMFDPEGSI----GQAEVKRALKPRHVSMIALG 88
           +KD  N T+E +D +S           ++ D +G       +  +++ LK RH+ MIALG
Sbjct: 33  AKDKYNKTIEFVDVESQQSTSSATISEKLGDGDGDADPFANEGSLQQGLKSRHIQMIALG 92

Query: 89  GTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-----VTSSFT 143
           G IGTGLF+  S  L   GP G  I++++I ++ Y +    GEM  ++P      + S  
Sbjct: 93  GAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAA 152

Query: 144 VFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVS 203
               R++  ++G A  + Y++ + I  A E +    +++YWT AVP   WI IF  ++V 
Sbjct: 153 HLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVI 212

Query: 204 FNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGI 262
            N  PVK+YGE EFW ASIK++ I+G +I S  +  G GP    +GFRYW++PG +   I
Sbjct: 213 LNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHI 272

Query: 263 IAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPRKAVPRAINKVFFRILIFY 321
           +       RFL   S +I   F +  G ELV +T+ E ++ R+ + +A  +  +R++ FY
Sbjct: 273 MKGGF--GRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFY 330

Query: 322 IGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIIS 379
           +     I ++V YNDP L  +          SPF+I I N    VLPHI NA IL++  S
Sbjct: 331 VLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWS 390

Query: 380 AGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEV 439
           AGN+ ++  +R L  +++N  AP+ F K  + GVP++A+ ++     LA+LNVS+   +V
Sbjct: 391 AGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADV 450

Query: 440 FDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXX 499
           F+W  NI+ I+GFI W+   +++IRF + +   G+  D LP+K    P            
Sbjct: 451 FNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKTWGQPYAVYYSLFVISL 509

Query: 500 XXXXXXXXXFAP-HFNVSDFFAAYISVFLFFIVWAIFQTIYRT 541
                    F P ++  SDF AAYI++ +F ++W   +   RT
Sbjct: 510 ITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRT 552

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  302 bits (774), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 178/542 (32%), Positives = 289/542 (53%), Gaps = 26/542 (4%)

Query: 23  SQSARSGM---HVSNSKIDDPLRFSK-------DNNLTLEA---IDDDSSRMFDPEGSIG 69
           ++S  SG+   H  +++ DD +R  K        +N T+     +D D  +    EG   
Sbjct: 47  TESLSSGLRRNHPYDNEKDDAIRMEKISKNHSASSNGTIREDLIMDVDVEKSPSVEGDNE 106

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
             ++K+ L+ RHV +IALGG IGTGL +  S  L   GP G  I++++I  + Y +  +L
Sbjct: 107 PHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCAL 166

Query: 130 GEMATFIPVTSSFTVFSQ-----RFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           GEM  F+P   S +  S      R++  ++G A G+ Y++ + I  A E +    +++YW
Sbjct: 167 GEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYW 226

Query: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP- 243
           T AVP   WI IF  ++V  N+  VK YGE EFW ASIK++ I+G +I S  +  G GP 
Sbjct: 227 TTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPN 286

Query: 244 EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNP 302
              +GFRYW+ PG + + +   ++    F    + +I  AF +  G ELV +T+ E  + 
Sbjct: 287 HDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQ 344

Query: 303 RKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNC 360
           R+ + +A  +  +R++ FY+     I ++VPYNDP L  +          SPF+I I N 
Sbjct: 345 RRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNA 404

Query: 361 RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI 420
              VLPHI N  IL++  SA N+ ++  +R L  +++   APK   +  + GVP++AV +
Sbjct: 405 GIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGV 464

Query: 421 TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP 480
           + +   LAYLNVS+   +VF+W  NI+ I+GF+ W+   I+++RF + + + G+  D LP
Sbjct: 465 SFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLP 523

Query: 481 YKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF-NVSDFFAAYISVFLFFIVWAIFQTIY 539
           +K    P                     F P +  ++DF AAYI++ +F ++W   +   
Sbjct: 524 FKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYT 583

Query: 540 RT 541
           RT
Sbjct: 584 RT 585

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  300 bits (769), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 159/435 (36%), Positives = 244/435 (56%), Gaps = 10/435 (2%)

Query: 52  EAIDDDSSRMFDPEGSI----GQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAG 107
           E I  D   + D E ++      +++ + L  RH+  +A+GG IGTGLF++    L   G
Sbjct: 63  ENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGG 122

Query: 108 PVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWA 167
           P   ++A++++ T  +++  +LGE+A   PV   F V+  RF+ P+ G A    Y   WA
Sbjct: 123 PASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWA 182

Query: 168 ITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAI 227
           +   LEL      I+YW + +  +AW+AIF+  +   NM  VK +GE EF ++ IK++AI
Sbjct: 183 VLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAI 242

Query: 228 IGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY 286
           IGF I  + + CG GP G  IG RYW  PG +       +    RF G  +  ++AAF+Y
Sbjct: 243 IGFTILGIVLACGGGPSGEYIGGRYWNDPGAF-----VGDTPGRRFKGVCAVFVTAAFSY 297

Query: 287 QGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGS 346
            GTELV ++A E+ NPR  +P+A  + F+ I + YI  L  IG LVPYND +L   ++  
Sbjct: 298 SGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSV 357

Query: 347 YIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFS 406
             A SP +IAI N     LP + NA+IL  I+S  NS VY  SR +  +++    PK  +
Sbjct: 358 DAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLN 417

Query: 407 KTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFM 466
              K G P  A+  T +FG L+++  S+  +EVF WL  ++ ++    W  I++SHIRF 
Sbjct: 418 YIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFR 477

Query: 467 QTLKHRGISRDDLPY 481
           Q +K +  S ++LP+
Sbjct: 478 QAMKAQDRSLNELPF 492

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  300 bits (768), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 170/416 (40%), Positives = 244/416 (58%), Gaps = 8/416 (1%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           ++ ++R LK RH+ MIA+GG IGTGLF+     L   GP   LI + LIG + YSV  ++
Sbjct: 77  RSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAM 136

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAV 188
           GE+A   PV   FT +  RF+  + G A  Y+Y   W +   LE+      + YW T A 
Sbjct: 137 GELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAK 196

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIG 248
             + ++A+F+V++V  NMF VK YGE EF  + IKV  ++GF+I  + ++CG GP G   
Sbjct: 197 YRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYV 256

Query: 249 F-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307
             +YW  PG + NG    N  + RF    S  ++AAF++ GTELVG+ A ET+NPRKA+P
Sbjct: 257 GGKYWHNPGAF-NG---DNAGQ-RFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALP 311

Query: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367
           RA  +VF+RI +FYI SL  IGLLVPY    L GS +    A SPF++AI       LP 
Sbjct: 312 RAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVD-AAASPFVLAIKTHGISGLPS 370

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
           + N VIL +++S GNS+VY  SR L  L+     P+ FS   + G P + +L T  FG L
Sbjct: 371 VINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLL 430

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            ++  S    +VF+WL+ ++ ++   TW  I I H+RF + L  +G S D+L + +
Sbjct: 431 CFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTS 486

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  300 bits (767), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 169/437 (38%), Positives = 253/437 (57%), Gaps = 8/437 (1%)

Query: 47  NNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNA 106
             + LE +D + +          Q+ ++R LK RH+ MIA+GG IGTGLF+     L   
Sbjct: 51  KRVELEELDPNLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTG 110

Query: 107 GPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSW 166
           GP G LI + LIG + Y V  S+GE+A   PV+  FT ++ RF+  + G A  Y Y   W
Sbjct: 111 GPAGVLIGWGLIGLMIYCVVMSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQW 170

Query: 167 AITFALELSIVGQIIQYW-TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVI 225
            +   LE+      + +W T     + ++A+F++++V  N F V+ YGE EF  + IKVI
Sbjct: 171 LVVLPLEIVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVI 230

Query: 226 AIIGFLIYSLCMVC-GAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAF 284
            +IGF+I  + +VC G    G IG +YW  PG +     + +   +RF G  S  ++AAF
Sbjct: 231 TVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAF 285

Query: 285 TYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDN 344
           ++ GTELVG+ + ET NPRKA+PRA  +VF+RIL+FYI SL  IGLLVP+   +L G+ +
Sbjct: 286 SFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSS 345

Query: 345 GSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKF 404
               A SPF++AI       LP + N VIL +++S GNS VY  SR +  L++    P  
Sbjct: 346 VD-AAASPFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHI 404

Query: 405 FSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIR 464
           F+   + G P +A++ T VFG L+++  S    +VF+WLL ++ ++   +W  I I HIR
Sbjct: 405 FAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIR 464

Query: 465 FMQTLKHRGISRDDLPY 481
           F + L  +G S D+L +
Sbjct: 465 FRRALSAQGRSTDELAF 481

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  301 bits (772), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 165/455 (36%), Positives = 263/455 (57%), Gaps = 16/455 (3%)

Query: 33  SNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIG 92
           S+S++D+ L   K + +T++ I          E    Q  +K+++KPRH  M++LG  IG
Sbjct: 111 SSSQLDNELN-RKSSYITVDGIKQSPQ-----EQEQKQENLKKSIKPRHTVMMSLGTGIG 164

Query: 93  TGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFIS 151
           TGL +  S  L NAGP G +I + ++G+  Y + Q+ GE+A  +  +   F  +    + 
Sbjct: 165 TGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVD 224

Query: 152 PAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKW 211
           PA+G +  +++   W     LEL      I+YWT +V  + ++ IF+VL+V  N+F  K 
Sbjct: 225 PALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKG 284

Query: 212 YGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPW-GNGIIAKNVNK 269
           Y E +F+    K++ I+GF I ++ + CG AG +G IG +YWR PG + G+  I      
Sbjct: 285 YAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQ----- 339

Query: 270 ARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIG 329
            RF G V++ ++AAF +  +E + +TA E  NPRKA+P A  K+ +RIL  ++ SL  +G
Sbjct: 340 -RFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVG 398

Query: 330 LLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGS 389
            LVPY   +L G+  GS    SP++IA+ +    V+PH  NAVIL +++S  N   Y  S
Sbjct: 399 FLVPYTSDQLLGA-AGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSS 457

Query: 390 RILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAI 449
           RIL  L+K   APK F    + G P  A+L++A+FG +A+   S   ++VF WLL I+ +
Sbjct: 458 RILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGL 517

Query: 450 AGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           +   TW+ I +SHIRF + +K +G S  ++ YK++
Sbjct: 518 SQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQ 552

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  300 bits (767), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 161/445 (36%), Positives = 250/445 (56%), Gaps = 18/445 (4%)

Query: 52  EAIDDDSSRMFDPEGSIGQA----------EVKRALKPRHVSMIALGGTIGTGLFISISG 101
           E +D D   + D E    Q           E+K+ +KPRHV +I+LG  IGTGL +  + 
Sbjct: 75  ENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAK 134

Query: 102 PLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGY 160
            L NAGP G LI + ++GT  Y + Q+ GE+A ++  ++  F V+    + PA G +  +
Sbjct: 135 ALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAW 194

Query: 161 MYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVA 220
           +Y   W     LEL      I+YWT  V  + ++ IF+VL++  N F  + Y E EF+  
Sbjct: 195 VYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFN 254

Query: 221 SIKVIAIIGFLIYSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSL 279
             K++ +IGF I  + +   GAG +G IG RYW  PG +     A +     F G ++++
Sbjct: 255 CCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAF-----AGDRPIDHFKGIMATM 309

Query: 280 ISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL 339
           ++AAF +  TE + +TA E  NPRKA+P A  KV +RIL  ++GS+  +G LVPY+  +L
Sbjct: 310 VTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQL 369

Query: 340 EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNN 399
            GS  GS    SP+++A+      V+PH  NAVIL +++S GNS  Y  SR+L+ L++  
Sbjct: 370 MGS-GGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQG 428

Query: 400 LAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLIS 459
            APKFF    + G PF A++   VF  +++   S   ++VF WLL I+ ++   TW  I 
Sbjct: 429 NAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAIC 488

Query: 460 ISHIRFMQTLKHRGISRDDLPYKAK 484
           +SHIRF + +  +  S  ++ +KA+
Sbjct: 489 LSHIRFRKAMFVQKRSLGEIGFKAQ 513

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  300 bits (767), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 172/533 (32%), Positives = 288/533 (54%), Gaps = 18/533 (3%)

Query: 27  RSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQA----EVKRALKPRHV 82
           +  +  ++SK+++     K +N  L  I  + +     E  I +     ++K+ L  RH+
Sbjct: 52  KETLTFNSSKLEECKIEDKISNFDLSQIGYNGNETIISEELINEDGRKNKLKQGLNARHI 111

Query: 83  SMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSF 142
            +IALGG IGTGLF+     L   GP G + ++++I T+ Y +   LGEM  ++P   S 
Sbjct: 112 QLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNVLGEMVCYLPGDGSD 171

Query: 143 TVFS-----QRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIF 197
           +  S     +R++  ++  A G+ Y++ + +  A E +    +++YWT  VP  AWI +F
Sbjct: 172 SAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEYWTKVVPKPAWIVMF 231

Query: 198 WVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPG 256
            +++   NM PV+ YGE EFW A  K++ I+G +I S  +  G GP    +GFRYW  PG
Sbjct: 232 QLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGGGPNHDRLGFRYWITPG 291

Query: 257 PWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPRKAVPRAINKVFF 315
            + N I   N +   FL     +I  AF++  G ELV + + E  +PR+ + +A  +  +
Sbjct: 292 SFANTI--TNGSFGNFLDVYKGIILGAFSFILGPELVVLPSSECSDPRRNIKKASKRFIW 349

Query: 316 RILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNCRTPVLPHIFNAVI 373
           R++ FYI     I ++V YNDP L  +   +      SPF+I I N    VLPHI N  I
Sbjct: 350 RLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGIQNAGIDVLPHIINVCI 409

Query: 374 LTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVS 433
           L +  S+GN+ ++  SR L  ++ N+ APK   K  + GVP++AV+++ +   +AYLN S
Sbjct: 410 LISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVAVIVSIILSCIAYLNCS 469

Query: 434 NDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXX 493
               +VF W  N++ I+GF+ W+++S++++RF + +++ G+ +D LPY     P      
Sbjct: 470 KSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM-KDRLPYTTWGQPYLIIYS 528

Query: 494 XXXXXXXXXXXXXXXFAP-HFNVSDFFAAYISVFLFFIVWAIFQ-TIYRTKLF 544
                            P ++NVSDF AAY+++ +F ++W   +   YR K+F
Sbjct: 529 LISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIGHKFYKYRFKIF 581

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  299 bits (765), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 159/418 (38%), Positives = 246/418 (58%), Gaps = 13/418 (3%)

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
           ++K+ ++PRHV MI LG  +GTGL +     L +AGP G +I + ++ T  Y V Q++GE
Sbjct: 98  KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGE 157

Query: 132 MA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPL 190
           MA  ++ +   F+ +    I P +  A  ++Y   W     LEL      IQYWT  V  
Sbjct: 158 MAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTKVNA 217

Query: 191 EAWIAIFWVLLVSFNMFP-VKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIG 248
           + ++ IF++L++  N+F   + Y E EF+    K++ + GF I  + ++CG AG  G IG
Sbjct: 218 DIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGFIG 277

Query: 249 FRYWRKPGPW--GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAV 306
            RYW  PG +   NGI        RF G VS+L++AAF + GTE + ITA E  NPRKA+
Sbjct: 278 ARYWHSPGAFRGDNGI-------NRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRKAI 330

Query: 307 PRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLP 366
           P A  KV +R LI Y+GS+  +G LVPYN  +L GS +G     SP++IA+ +    V+P
Sbjct: 331 PSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGS-SGPATKASPYVIAVASHGIRVVP 389

Query: 367 HIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGF 426
           H  NAVIL ++ S  +S  Y  SR+L  L++   APK F+   K G P +  ++ A+   
Sbjct: 390 HFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAIIAI 449

Query: 427 LAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           +++   S+   +VF+WLL+I+ ++   TW +IS+SHIRF + +K +G S D++ +K++
Sbjct: 450 ISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKSQ 507

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  296 bits (758), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 166/444 (37%), Positives = 250/444 (56%), Gaps = 19/444 (4%)

Query: 45  KDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLW 104
           K   + L+ ++ DS   FDP      + VKRALK RH+S++ALGG IG G  I     L 
Sbjct: 19  KIAEVELQRLETDSLNEFDP-----HSGVKRALKNRHISLLALGGIIGPGCLIGAGNALN 73

Query: 105 NAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWF 164
             GP+  L+ F +IG + +S+ +S+GE+ T  P    F   ++RF S  + A +GY Y  
Sbjct: 74  KGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIV 133

Query: 165 SWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKV 224
            +    A E + +  I+Q+W   VP+  +  IFW   + F +  V  +GE E+W+A  K+
Sbjct: 134 VFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKI 193

Query: 225 IAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAA 283
           + ++ F I+S+  + G  P + PIGF+YW+ PG   +G          F G     +  +
Sbjct: 194 LGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALSHG----------FRGIAVVFVFCS 243

Query: 284 FTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSD 343
             Y GTE V + A E++NPRKAVP A+ + F+RILI Y+G  FF G+ VPYNDP L G+ 
Sbjct: 244 TFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTL-GAQ 302

Query: 344 NGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPK 403
             S   +SP  IA+         H+ NA IL T ISA NS++Y+GSR L  L+   LAP+
Sbjct: 303 TKSL--KSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPR 360

Query: 404 FFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHI 463
             + T K GVP  A+++    G ++ +NVS  A   +++++N++ +  FI W  ISI+H+
Sbjct: 361 ILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHL 420

Query: 464 RFMQTLKHRGISRDDLPYKAKFMP 487
           RF +    +G S  +LPY+A F P
Sbjct: 421 RFRKAWVAQGRSLSELPYRALFYP 444

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  298 bits (762), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 169/437 (38%), Positives = 261/437 (59%), Gaps = 8/437 (1%)

Query: 47  NNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNA 106
             + LE +D + +       +  ++ +K  LK RH+ MIA+GG IGTGLF+     L  A
Sbjct: 61  KRIELEELDPNLTDAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTA 120

Query: 107 GPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSW 166
           GP G LI + + GT+ YS+  ++GE+A   PV+  FT ++ RFI  + G A  + Y   W
Sbjct: 121 GPAGILIGWTVTGTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQW 180

Query: 167 AITFALELSIVGQIIQYW-TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVI 225
            IT  LE+      + YW  DA   + ++A+FWV  V  N+F VK YGE EF  A IKV+
Sbjct: 181 LITLPLEIVSASITVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVV 240

Query: 226 AIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAF 284
            IIGF+I ++ ++CG GP G     +YW  PG +       +    +F G+ +  I+A+F
Sbjct: 241 TIIGFIIMAVILICGGGPVGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASF 295

Query: 285 TYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDN 344
           ++ G+E+VG+   E++NPRK+VP A  +VF+RI +FY+  L  IG+LVPYND +L G+ +
Sbjct: 296 SFGGSEVVGVAGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASS 355

Query: 345 GSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKF 404
               A SPF+IA++N     LP + N VIL +++S GNS++Y+ SR L  L++    PK 
Sbjct: 356 VD-AAASPFVIAVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKI 414

Query: 405 FSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIR 464
            +   ++G P +A+ I + FG +A++  S+   EVF+WLL ++ ++   +W  I I HIR
Sbjct: 415 VAYIDRNGRPLVAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIR 474

Query: 465 FMQTLKHRGISRDDLPY 481
           F + L  +G S D+LP+
Sbjct: 475 FRRALVAQGRSTDELPF 491

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  298 bits (764), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 159/435 (36%), Positives = 251/435 (57%), Gaps = 8/435 (1%)

Query: 52  EAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGS 111
           E   D+++    P        +K+ ++PRHV MIALG  IGTGL +     L +AGP G 
Sbjct: 95  ELEKDETTDKIAPHTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGL 154

Query: 112 LIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITF 170
           LI + ++G++ Y + Q+ GEMA  +  +T  +  +    +    G A  ++Y   W    
Sbjct: 155 LIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVC 214

Query: 171 ALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGF 230
            LEL      I+YWT +V  + ++ IF+VL+++ N+F  + Y E EF+    K++ + GF
Sbjct: 215 PLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGF 274

Query: 231 LIYSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGT 289
            I  + + V GAG +G IG +YW +PG + NG+ A +    RF G V++L++AAF + G+
Sbjct: 275 FILGIIIDVGGAGNDGYIGGKYWHEPGAF-NGVHAID----RFKGVVATLVTAAFAFGGS 329

Query: 290 ELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIA 349
           E + IT  E  NPRKA+P A  ++ +RIL  ++ ++  +G LVPYN  +L GS  G   A
Sbjct: 330 EFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKA 389

Query: 350 QSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTT 409
            SP++IAI +    V PH  NAVIL +++S  NS+ Y  +R+   LS+   APK FS   
Sbjct: 390 -SPYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYID 448

Query: 410 KHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTL 469
           + G P IA+ ++A+F  +A+   S    +VF WLL I+ ++   TW  I +SHIRF + +
Sbjct: 449 RAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAM 508

Query: 470 KHRGISRDDLPYKAK 484
           K +G S  +L +K++
Sbjct: 509 KVQGRSLGELGFKSQ 523

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  297 bits (761), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 173/432 (40%), Positives = 248/432 (57%), Gaps = 8/432 (1%)

Query: 54  IDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLI 113
           + DD S +         A +K  LK RH+ MIA+GG IGTGLF+     L  AGP G LI
Sbjct: 62  VTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILI 121

Query: 114 AFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALE 173
            + L GT+ Y +  ++GE++   P++  FT ++ RFI  + G AN + Y   W     LE
Sbjct: 122 GWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLE 181

Query: 174 LSIVGQIIQYW-TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLI 232
           +      + YW TD    + ++A+FWV++V  N+F VK YGE EF  + IKV+ +IGF+I
Sbjct: 182 IVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFII 241

Query: 233 YSLCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTEL 291
             + + CG GPEG     +Y+  PG +       +   ARF G  S  ++AAF++ G+EL
Sbjct: 242 MGIVLNCGGGPEGGYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSEL 296

Query: 292 VGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQS 351
           +GI A E+  PRK+VP+A  +VF+RI +FY+ SL  +GLLVPY D +L G+ +    A S
Sbjct: 297 IGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVD-AAAS 355

Query: 352 PFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKH 411
           PF+IAI +     LP + N VIL  ++S GNS VY  SR L  L++ N  PK F    + 
Sbjct: 356 PFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRS 415

Query: 412 GVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKH 471
           G P   +  T+ FG +A++  S    EVF WLL ++ ++   TW  I   HIRF   L  
Sbjct: 416 GRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTA 475

Query: 472 RGISRDDLPYKA 483
           +G S D+LP+KA
Sbjct: 476 QGRSTDELPFKA 487

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  297 bits (760), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 169/416 (40%), Positives = 252/416 (60%), Gaps = 8/416 (1%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           Q  +K  LK RH+ MIA+GG IGTGL +     L   GP   LI +  +GT+ Y++  +L
Sbjct: 82  QTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMAL 141

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAV 188
           GE+A   P++  FT ++ RFI  + G A  + Y   W +T  LE+      + YW TD  
Sbjct: 142 GELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPK 201

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE-GPI 247
             + ++A+FW+++V  NMF VK YGE EF  + IKVI IIGF+I  + + CG GPE G I
Sbjct: 202 YRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYI 261

Query: 248 GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307
           G +Y+  PG +     A +   A+F G  S  ++AAF++ G+ELVG+ A E+ +PRK+VP
Sbjct: 262 GGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVP 316

Query: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367
           +A  +VF+RI +FYI SL  IGLLVPYND +L G+ +    A SPF+IAI+      LP 
Sbjct: 317 KAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVD-AAASPFVIAIVTHGIKGLPS 375

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
           + N VIL  ++S GNS ++  SR    L++    P+ F+   + G P + ++IT+  G +
Sbjct: 376 VVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLI 435

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           A++  SN  ++VF+WLL ++ ++   TW  I I HIRF + L  +G S D+L +K+
Sbjct: 436 AFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKS 491

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  298 bits (762), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 163/443 (36%), Positives = 256/443 (57%), Gaps = 10/443 (2%)

Query: 44  SKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103
           S  N   LE   +DS+   +P        +K+ ++PRHV MIALG  IGTGL +     L
Sbjct: 89  SSRNAQGLE--KNDSTDKINPPAGNKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTAL 146

Query: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMY 162
            +AGP G LI + ++G++ Y + Q+ GE+A  +  +T  +  +    +    G A  ++Y
Sbjct: 147 VHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVY 206

Query: 163 WFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASI 222
              W     LEL      I+YWT +V  + ++ IF+VL+++ N+F  + Y E EF+    
Sbjct: 207 CLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCC 266

Query: 223 KVIAIIGFLIYSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLIS 281
           K++ + GF I S+ + V GAG +G IG +YW  PG + NG  + +    RF G V++L++
Sbjct: 267 KILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAF-NGKHSID----RFKGVVATLVT 321

Query: 282 AAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEG 341
           AAF + G+E + IT  E  NPRKA+P A  ++ +RIL  ++ ++  +G LVPYN  +L G
Sbjct: 322 AAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLG 381

Query: 342 SDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLA 401
           S  G   A SP++IAI +    V+PH  NAVIL +++S  NS+ Y  +R+   LS+   A
Sbjct: 382 SGGGGTKA-SPYVIAIASHGVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYA 440

Query: 402 PKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISIS 461
           PKFFS   + G P IA+ ++A+F  +A+   S   ++VF WLL I+ ++   TW  I  S
Sbjct: 441 PKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFS 500

Query: 462 HIRFMQTLKHRGISRDDLPYKAK 484
           HIRF + +K +G S  +L +K++
Sbjct: 501 HIRFRRAMKVQGRSLGELGFKSQ 523

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  297 bits (760), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 163/447 (36%), Positives = 253/447 (56%), Gaps = 15/447 (3%)

Query: 47  NNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNA 106
           ++  L+  D   S+    E  I     +R L PR VSMI +GG IGT LF+SI   +   
Sbjct: 95  DDFVLQNRDSPKSQSLSLEERIA----RRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQG 150

Query: 107 GPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSW 166
           GP   LIAF L   +   +++ +  M T++PVT SF  F++RF+  + G A G+ Y+   
Sbjct: 151 GPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQ 210

Query: 167 AITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIA 226
           A     E++ V  +++YWTD +P  A I++  +L  S N++ V ++GE EF+++  KV+ 
Sbjct: 211 AANVCFEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVL 270

Query: 227 IIGFLIYSLCMVCGAGPEGPI-GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFT 285
            IG +I+++ ++ G  P+  + GF+ W  PG +   I   +V   RF G++S L+ A + 
Sbjct: 271 AIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYISDGSV--GRFHGFMSCLVFALYV 328

Query: 286 YQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL-----E 340
           + G + +G  A E  NPRK +P +  KVF R++IFYIG    +G+L+PYNDP +     E
Sbjct: 329 FWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKE 388

Query: 341 GSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNL 400
           G+        SP++ A+      VLPHI N +ILT+IISAGNS++Y  SR+L  L+ +N 
Sbjct: 389 GAVGA---GASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQ 445

Query: 401 APKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISI 460
           AP+ F  TTK GVP    +   V   LAYL+VSN    V  W LN+   A  I ++ I +
Sbjct: 446 APRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICV 505

Query: 461 SHIRFMQTLKHRGISRDDLPYKAKFMP 487
           S+++F +    + +    LPY +  +P
Sbjct: 506 SYLQFRKGCLAQNVDLKSLPYYSSSLP 532

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  296 bits (758), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 160/439 (36%), Positives = 256/439 (58%), Gaps = 9/439 (2%)

Query: 49  LTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGP 108
           L+ +++ DD+             ++K+ ++PRHV M++LG  IGTGL +     L +AGP
Sbjct: 75  LSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGP 134

Query: 109 VGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWA 167
            G +I + ++ +  Y + Q++GEMA  ++ +   F  +    + PA+  +  ++Y   W 
Sbjct: 135 AGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWF 194

Query: 168 ITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFP-VKWYGEFEFWVASIKVIA 226
               LEL      IQYWT  V  + ++ IF++L+++ N+F   + Y E EF   S K++ 
Sbjct: 195 CVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILM 254

Query: 227 IIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFT 285
           +IGF I  + ++CG AG +G IG +YWR PG +  G    N    RF G VS+L++AAF+
Sbjct: 255 MIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-RGSDGPN----RFKGVVSTLVTAAFS 309

Query: 286 YQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNG 345
           +  TE + ITA E  NPRKA+P A  KV +R L+ Y+ S+  +GLLVPY+  +L GS + 
Sbjct: 310 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSA 369

Query: 346 SYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFF 405
           +  A SP+++A+      V+PH  NAVIL ++ S  +S  Y  SR+L  L++   APK F
Sbjct: 370 ATKA-SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVF 428

Query: 406 SKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRF 465
           +   + G P +  L+ AV   +A+   S+   EVF+WLL I+ ++   TW LI +SHIRF
Sbjct: 429 TFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRF 488

Query: 466 MQTLKHRGISRDDLPYKAK 484
            + +K +G S D++ YK++
Sbjct: 489 RRAMKVQGRSIDEIGYKSQ 507

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  295 bits (755), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 184/470 (39%), Positives = 267/470 (56%), Gaps = 15/470 (3%)

Query: 21  SQSQSARSGMHVSNSKIDDPLRFSKDNNLT-----LEAIDDDSSRMFDPEGSIGQAE--V 73
           +Q Q   SG   ++   ++    SK  +       +E ++ D +     + +I  A   +
Sbjct: 18  AQEQYVESGEFTNHEASNEESSGSKWQDFKNSFKRMEVVELDPNLTEAEKIAIATANSPL 77

Query: 74  KRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA 133
           KR LK RH+ MIA+GG IGTGLF+     L  AGP G LI + L GT+ Y +  ++GE+A
Sbjct: 78  KRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGELA 137

Query: 134 TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVPLEA 192
              PV+  FT ++ RFI  + G AN + Y   W +   LE+      + YW TD    + 
Sbjct: 138 VTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRDG 197

Query: 193 WIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRY- 251
           ++A+F+V++VS NMF VK YGE EF  + IKVI +IGF+I  + +VCG GP G       
Sbjct: 198 FVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGGAN 257

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311
           W  PG +       N    RF G  S  ++AAF++ G+ELVG+ + ET NPRK++PRA  
Sbjct: 258 WHNPGAF-----VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAAK 312

Query: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNA 371
           +VF+RI +FYI SL  IGLLVPYND +L G+ +    A SPF++AI N     LP + N 
Sbjct: 313 QVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVD-AAASPFVLAIKNHGIKGLPSVVNV 371

Query: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
           VIL  ++S GNS V+  SR L  L++    PK F    + G P + +  T+ FG L+++ 
Sbjct: 372 VILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIA 431

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
            S    EVFDWLL ++ ++   TW+ I I H+RF + L  +G S D+L +
Sbjct: 432 ASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSF 481

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  295 bits (755), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 162/460 (35%), Positives = 250/460 (54%), Gaps = 20/460 (4%)

Query: 23  SQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHV 82
           S    SG++ + + I    RF  D+++  E I++                + + L  RH+
Sbjct: 50  SAKGSSGVNQTTNDITSSGRFHSDDDVQQEDINN--------------TNLSKELSVRHL 95

Query: 83  SMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSF 142
             +A+GG IGTGLF++    L   GP   +I +++I T  ++V  SLGE++   PV   F
Sbjct: 96  LTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGF 155

Query: 143 TVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLV 202
            V+S RF+ P+   A    Y   W +   LEL      I+YW D +  +AW+AIF+  + 
Sbjct: 156 NVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIA 215

Query: 203 SFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNG 261
             NM  VK +GE EF ++ IK++AIIGF I  + + CG GP G     +YW  PG +   
Sbjct: 216 MANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAF--- 272

Query: 262 IIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFY 321
               + +  +F G  S  ++AAF+Y G E+  ++A E+KNPR+ +P+A  + F+ I I Y
Sbjct: 273 --VGHDSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISY 330

Query: 322 IGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAG 381
           +  L  IG LVP NDP+L    +    A SP +IAI N R   LP + NA+IL  ++S  
Sbjct: 331 VTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVA 390

Query: 382 NSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFD 441
           NS VY  SR +  ++     PKF  +  K G P  A+++T  FG L+++  S+   EVF 
Sbjct: 391 NSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFT 450

Query: 442 WLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           WL  ++ ++    W+ I++SHIRF Q +K +  S D+LP+
Sbjct: 451 WLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPF 490

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  294 bits (752), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 163/423 (38%), Positives = 243/423 (57%), Gaps = 18/423 (4%)

Query: 62  FDP--EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIG 119
           F P  +GS     +KR+LK RH+ MIA+GG+IGTGLF+     +   GP+  +I + + G
Sbjct: 72  FKPPLDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAG 131

Query: 120 TLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQ 179
           +        LGE+    PV  +F  +S RF+ P++      +Y   W     LE+     
Sbjct: 132 SQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAM 191

Query: 180 IIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVC 239
            +QYW  ++    W+AIF+  +VS N+F  + +GE EF  +S+KV+ I GF+I  + ++C
Sbjct: 192 TVQYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLIC 251

Query: 240 GAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGE 298
           G GP+   +G +YW  PG   +G          F G +S L+ A+++  GTE+V + +GE
Sbjct: 252 GGGPDHDFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGE 301

Query: 299 TKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAIL 358
           T +P K +P AI + F+RIL F++ SL  IG LVPY +  L G   GS +  SPF+IAI 
Sbjct: 302 T-DP-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLG---GSSVNNSPFVIAIK 356

Query: 359 NCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAV 418
             +  VLP I NAVIL +I+S GNS ++  SR L  ++   L P+FF    + G P   +
Sbjct: 357 LHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGI 416

Query: 419 LITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDD 478
           +  ++FG LA+L  S+   EVFDWL+ I  +A  I WL I+ISHIRF   +K +G S D+
Sbjct: 417 ITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDE 476

Query: 479 LPY 481
           L +
Sbjct: 477 LEF 479

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  293 bits (751), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 246/416 (59%), Gaps = 8/416 (1%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           Q  +K  LK RH+ MIA+GG IGTGL +     L   GP   LI +   GT+ YS+  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMAL 142

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAV 188
           GE+A   P++  FT ++ RFI  + G AN + Y   W +   LE+      + +W TD  
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIG 248
             + ++A+FW+++V  NMF VK YGE EF  + IKVI ++GF+I  + + CG GPEG   
Sbjct: 203 YRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 249 F-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307
             +YW  PG +     A +   A+F G  S  +++AF++ G+ELVG+ A E+ +PRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVP 317

Query: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367
           +A  +VF+RI +FYI SL  +GLLVPYNDP L G+ +    A SPF+IAI       LP 
Sbjct: 318 KAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVD-AAASPFVIAIKTHGIKGLPT 376

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
           + N VIL  ++S GNS +Y  SR +  L++    P+ F+   + G P + + +T+ FG +
Sbjct: 377 VVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLI 436

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           A++  S    +VF+WLL ++ ++   TW  I I HIRF + L  +G   D+L +K+
Sbjct: 437 AFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKS 492

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  293 bits (749), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 169/469 (36%), Positives = 259/469 (55%), Gaps = 23/469 (4%)

Query: 18  SNLSQSQSARSGMHVSNSKIDDP--LRFSKDNNLTLEAIDDDSSRMFDP--EGSIGQAEV 73
           S LS + + +  +   +S +++   L  S+ N   L     DS   F P  +GS     +
Sbjct: 12  SELSNTSAVQRVLKKRSSVLEESRLLEESRTNKRGLVRRCIDS---FKPPVDGSFDPDNL 68

Query: 74  KRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA 133
           KR LK RH+ MIA+GG+IGTGLFI     L   GP+  LI + L GT        LGE+ 
Sbjct: 69  KRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVT 128

Query: 134 TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAW 193
              PV  +F  +S RF+ P+V      +Y   W     LE+      +++WT +V    W
Sbjct: 129 VRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPVVW 188

Query: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYW 252
           +A+F+ L++S N+F V+W+G+ +F  + IK++ I GF+I  L ++ G GP    IG RYW
Sbjct: 189 VAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYW 248

Query: 253 RKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINK 312
             PG   NG          F G  + +++A+++  G+E+  + +GET +P K +P AI +
Sbjct: 249 HDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KEIPHAIKQ 296

Query: 313 VFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAV 372
           +F+RI+ F++ SL  +G LVPY + +L G   GS +  SPF+IAI      VLPHI N V
Sbjct: 297 IFWRIIFFFLVSLTLVGFLVPYTNDQLLG---GSNVNNSPFVIAIKMHNIRVLPHIINGV 353

Query: 373 ILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNV 432
           IL +I+S GNS ++  SR L  ++   L P+ F    + G P   +L  ++FG LA+L  
Sbjct: 354 ILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVK 413

Query: 433 SNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           S+    VF WL+ +  +A  + WL I++SHIRF   +K +G S D+L +
Sbjct: 414 SSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEF 462

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  294 bits (752), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 177/541 (32%), Positives = 287/541 (53%), Gaps = 23/541 (4%)

Query: 21  SQSQSARSGMHVSNSKIDDPLRFSK-------DNNLTLE---AIDDDSSRMFDPEGSIGQ 70
           S S  +R+     +++ DD +R  K        +N T+     +D D  +    +G    
Sbjct: 43  SASSGSRNNHQRYDNEKDDDIRMEKISKDQSASSNGTIHEELVMDVDLEKSPSADGDNEP 102

Query: 71  AEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLG 130
            ++K+ L+ RHV +IALGG IGTGL +  S  L   GP G  I++++I  + Y +  +LG
Sbjct: 103 RKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALG 162

Query: 131 EMATFIPVTSSFTVFSQ-----RFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT 185
           EM  F+P   S +  S      R++  ++G A G+ Y++ + I  A E +    +++YWT
Sbjct: 163 EMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWT 222

Query: 186 DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEG 245
            AVP   WI +F +++V  N   VK YGE EFW ASIK++ I+G +I S  +  G GP+ 
Sbjct: 223 TAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKH 282

Query: 246 P-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPR 303
             +GFRYW+ PG + + +   ++    F    + +I  AF +  G ELV +T+ E  + R
Sbjct: 283 DRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQR 340

Query: 304 KAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNCR 361
           + + +A  +  +R++ FY+     I ++VPYNDP L  +          SPF+I I N  
Sbjct: 341 RNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAG 400

Query: 362 TPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLIT 421
             VLPHI N  ILT+  SA N+ ++  +R L  +++   APK   K  + GVP++AV  +
Sbjct: 401 IKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAAS 460

Query: 422 AVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
            +   LAYLNVS+   +VF+W  NI+ I+GF+ W+   I+++RF + + + G+  D LP+
Sbjct: 461 FLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPF 519

Query: 482 KAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF-NVSDFFAAYISVFLFFIVWAIFQTIYR 540
           K    P                     F P +  V+DF AAY+++ +F ++W   +   R
Sbjct: 520 KTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTR 579

Query: 541 T 541
           T
Sbjct: 580 T 580

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  293 bits (750), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 169/478 (35%), Positives = 266/478 (55%), Gaps = 21/478 (4%)

Query: 18  SNLSQSQSAR--SGMHVSNSKI----DDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIG-- 69
           +NL  S S +  SG    N+K+     D  + ++ +    + I++++S   D EG +   
Sbjct: 29  NNLQSSSSEKNYSGQTTRNNKLIHRFVDSFKRAEGSTTHTKQINENTS---DLEGDVNSF 85

Query: 70  --QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQ 127
              +++K+++K RHV M+ LG  IGTGL ++ +  L   GP   +I + L+  + Y + Q
Sbjct: 86  TSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQ 145

Query: 128 SLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTD 186
           + GEMA   P + ++F  +S  FIS   G A  ++Y F W     LEL      I++W D
Sbjct: 146 AAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWND 205

Query: 187 AVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEG 245
            +  + +I IF+V L+  + F VK YGE EF     K++ I GF+I S+ + CG AG +G
Sbjct: 206 TINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDG 265

Query: 246 PIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKA 305
            IG +YWR PG +     A + +  RF      L++A F++ G EL  ++  E  NPRK 
Sbjct: 266 YIGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKT 320

Query: 306 VPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVL 365
            P A  +  +RIL+ Y+ ++  IG  VPYND +L G+  GS    SP+++A       V+
Sbjct: 321 TPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGA-GGSATHASPYVLAASIHGVKVV 379

Query: 366 PHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFG 425
           PHI NAVIL ++IS  NS++Y G R++  L++    PKF     + G P IA+++ +VFG
Sbjct: 380 PHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFG 439

Query: 426 FLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            + ++  S+  + VF WL  I  ++   TW  I +SH+RF Q +K +G S D+L YKA
Sbjct: 440 VIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  293 bits (750), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 159/421 (37%), Positives = 250/421 (59%), Gaps = 8/421 (1%)

Query: 66  GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSV 125
           G  G  ++K+ +K RHV MI+LG  IGTG+ +     L N GP G +I + ++G+  Y +
Sbjct: 89  GDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCI 148

Query: 126 TQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
            Q+ GE+A  +  ++  F  +    I PA+G +  ++Y   W     LEL      I+YW
Sbjct: 149 IQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYW 208

Query: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGP 243
           T +V  + ++AIF+VL ++ N+F  + Y E EF+  + KV+ I GF I  + + CG AG 
Sbjct: 209 TTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGN 268

Query: 244 EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPR 303
           +G IG +YW  PG +      K ++   F G VS+L++AAF +  TE + +TA E  NPR
Sbjct: 269 DGYIGGKYWNDPGSFSGD---KPID--HFKGVVSTLVTAAFAFGATEFIALTAAEQANPR 323

Query: 304 KAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTP 363
           K++P A  KV +RI++ ++GS+  +G LVP+N  +L GS  GS    SP++IAI +    
Sbjct: 324 KSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGS-GGSATHASPYVIAIASHGVK 382

Query: 364 VLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAV 423
           V+PH  NAVIL +++S GNS  Y  SR+L  L++   AP F     + G P +A++I+AV
Sbjct: 383 VVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAV 442

Query: 424 FGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           FG ++++  S   + VF WLL I+ ++   TW  I +SHIRF + +K +G S  +L +K+
Sbjct: 443 FGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKS 502

Query: 484 K 484
           +
Sbjct: 503 Q 503

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  293 bits (750), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 162/460 (35%), Positives = 260/460 (56%), Gaps = 9/460 (1%)

Query: 27  RSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSI-GQAEVKRALKPRHVSMI 85
           +SG      +  D  + ++ +    + I++++S + D   SI   +++K+++K RHV M+
Sbjct: 44  KSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMM 103

Query: 86  ALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTV 144
           +LG  IGTGL ++ +  L   GP   +I ++L+  + Y + Q+ GEMA   P + ++F  
Sbjct: 104 SLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNA 163

Query: 145 FSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSF 204
           +S  FIS + G A  ++Y F W     LEL      IQ+W D +  + +I IF+V LV  
Sbjct: 164 YSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDKINPDIYILIFYVFLVFI 223

Query: 205 NMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGII 263
           + F VK YGE EF     K++ I GF+I S+ + CG AG +G IG  YW  PG +     
Sbjct: 224 HFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF----- 278

Query: 264 AKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIG 323
           A + +  RF      L++A F++ G EL  ++  E  NPRK+ P A  +  +RI++ Y+ 
Sbjct: 279 AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLL 338

Query: 324 SLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNS 383
           ++  IG  VPYND +L G+  GS    SP+++A       ++PHI NAVIL +++S  NS
Sbjct: 339 TMILIGFNVPYNDDQLMGA-GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANS 397

Query: 384 NVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWL 443
           ++Y G R++  L++   APKF     + G P  A+++  VFG +A++  S+  + VF WL
Sbjct: 398 SLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWL 457

Query: 444 LNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
             I  ++   TW  I +SH+RF Q +K +G S D+L YKA
Sbjct: 458 AAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  292 bits (748), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 160/464 (34%), Positives = 258/464 (55%), Gaps = 13/464 (2%)

Query: 21  SQSQSARSGMHVSNSKIDDPLR--FSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALK 78
           S+ +SARS    ++ + D   +   S      LE +D  S  + D +     A   + L 
Sbjct: 23  SRLRSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQEVEDQD-----ARYNKDLS 77

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPV 138
            RH+  +A+GG IGTGLF++    L   GP   +I +++I T  +++  +LGE+++  PV
Sbjct: 78  VRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPV 137

Query: 139 TSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFW 198
              F V+  RF+ P+ G A    Y   WA+   LEL      I+YW   +  +AW+AIF+
Sbjct: 138 VGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFY 197

Query: 199 VLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGP 257
            +++  N+  VK +GE EF ++ +K++AIIGF I  + + CG GP+G     +YW  PG 
Sbjct: 198 TIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGA 257

Query: 258 WGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRI 317
           +       +    RF G  S  ++AAF+Y GTEL+ ++A E+ NPR  +P+A  + F+ I
Sbjct: 258 F-----VGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLI 312

Query: 318 LIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTI 377
            + YI  L  +G LV  +DP+L    +   +A SP +IAI N     LP + NA+IL  +
Sbjct: 313 TVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAV 372

Query: 378 ISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQ 437
           +S  NS VY  SR +  +++    PK F+   + G P  A++ T +FG L+++  S+  +
Sbjct: 373 LSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQE 432

Query: 438 EVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           EVF WL  ++ ++    W  I++SHIRF +T+K RG + D+LP+
Sbjct: 433 EVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPF 476

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  294 bits (752), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 160/449 (35%), Positives = 252/449 (56%), Gaps = 17/449 (3%)

Query: 46  DNNLTLEAIDDDSSRMFDPEGSIGQAE-----VKRALKPRHVSMIALGGTIGTGLFISIS 100
           +N+LT     +   R+ +     GQ +     +K+++KPRHV MI+LG  IGTGL +  +
Sbjct: 110 ENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNA 169

Query: 101 GPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFISPAVGAANG 159
             L NAGP G +I + ++G+  Y + Q+ GEMA  +  +   F  +    + P  G A  
Sbjct: 170 KALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVA 229

Query: 160 YMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWV 219
           ++Y   W     LEL      I+YWT  V  +A++ IF+V+++   +F  + Y E EF+ 
Sbjct: 230 WVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFF 289

Query: 220 ASIKVIAIIGFLIYSLCM-VCGAGPEGPIGFRYWRKPGPW--GNGIIAKNVNKARFLGWV 276
              K++ IIGF I  + +   GAG +G +G +YW  PG +   NGI        RF G +
Sbjct: 290 NCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNGI-------QRFKGIM 342

Query: 277 SSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYND 336
           ++ +SAAF +  TE + +TA E  NPRKA+P A  KV +R++  ++G++  +G LVP++ 
Sbjct: 343 ATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDS 402

Query: 337 PKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLS 396
            +L G+  GS    SP+++AI      V+PH  NAVIL ++ S  NS  Y  SR+L GL+
Sbjct: 403 DQLMGA-GGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLLGLA 461

Query: 397 KNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWL 456
           +   APKFF    + G PF A+   A+FG +A+   S    +VF WLL I+ ++   TW+
Sbjct: 462 QQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWI 521

Query: 457 LISISHIRFMQTLKHRGISRDDLPYKAKF 485
            I +SHIRF + +  +G S  ++ +KA+ 
Sbjct: 522 AICVSHIRFRRAMTVQGRSLGEIGFKAQL 550

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  290 bits (743), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 178/470 (37%), Positives = 266/470 (56%), Gaps = 17/470 (3%)

Query: 18  SNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSI--GQAEVKR 75
           SN S + +  +G   S SK  D     KD+   +E I  D +     + +I   Q  +K 
Sbjct: 36  SNGSAASAEEAG---SGSKWQD----FKDSFKRVEPIAVDPNLTEAEKVAIVTAQTPLKH 88

Query: 76  ALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATF 135
            LK RH+ MIA+GG IGTGL +     L   GP   LI +   GT+ Y++  +LGE+A  
Sbjct: 89  HLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVI 148

Query: 136 IPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVPLEAWI 194
            P++  FT ++ RFI  + G AN + Y   W +   LE+      + +W TD    + ++
Sbjct: 149 FPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFV 208

Query: 195 AIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWR 253
           A+FWV++V  NMF VK YGE EF  + IKVI ++GF+I  + + CG GPEG     +YW 
Sbjct: 209 ALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWH 268

Query: 254 KPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKV 313
            PG +     A +   A+F G  S  +++AF++ G+ELVG+ A E+  PRK+VP+A  +V
Sbjct: 269 DPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQV 323

Query: 314 FFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVI 373
           F+RI +FYI SL  IGLLVPYND  L G+ +    A SPF+IAI       LP + N VI
Sbjct: 324 FWRITLFYILSLLMIGLLVPYNDKNLIGASSVD-AAASPFVIAIKTHGIKGLPSVVNVVI 382

Query: 374 LTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVS 433
           L  ++S GNS +Y  SR +  L++    P+ F+   + G P + + +T+ FG +A++  S
Sbjct: 383 LIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAAS 442

Query: 434 NDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
               +VF+WLL ++ ++   TW  I I HIRF + L  +G   D+L +K+
Sbjct: 443 KKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKS 492

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  291 bits (744), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 165/447 (36%), Positives = 246/447 (55%), Gaps = 23/447 (5%)

Query: 38  DDPLRFSKDNNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRHVSMIALGGTIGTGL 95
           + P       N+    +D      F P  +GS   + +KR LK RH+ MIA+GG+IGTGL
Sbjct: 31  ESPEPVVTKRNIFQRCVDS-----FKPPVDGSFDTSNLKRTLKSRHLIMIAIGGSIGTGL 85

Query: 96  FISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVG 155
           FI     L   GP+  +I + + G+        LGE+    PV  +F  +S RF+ P++ 
Sbjct: 86  FIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSIS 145

Query: 156 AANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEF 215
                +Y   W     LE+      IQYW  ++    W+AIF+ ++VS N+F  + +GE 
Sbjct: 146 FVVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEA 205

Query: 216 EFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLG 274
           EF  ++IK I I GF+I  + ++CG GP+   IG +YW  PG   +G          F G
Sbjct: 206 EFVFSTIKAITICGFIILCIVLICGGGPDHEFIGAKYWHDPGALAHG----------FPG 255

Query: 275 WVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPY 334
            +S L+ A+++  GTE+  + +GET +P K +P AI +VF+RIL F++ SL  +G LVPY
Sbjct: 256 VLSVLVVASYSLGGTEMTCLASGET-DP-KELPSAIKQVFWRILFFFLASLTLVGFLVPY 313

Query: 335 NDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFG 394
            +  L G   GS +  SPF+IAI       LP I NAVIL +I+S GNS ++  SR L  
Sbjct: 314 TNENLLG---GSSVDNSPFVIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTLCS 370

Query: 395 LSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFIT 454
           ++   L P+FF    + G P   ++  ++FG LA+L  S+   EVFDWL+ I  +A  I 
Sbjct: 371 MAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIV 430

Query: 455 WLLISISHIRFMQTLKHRGISRDDLPY 481
           WL I++SHIRF   +K +  + D+L +
Sbjct: 431 WLSINLSHIRFRLAMKAQNKTLDELEF 457

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  292 bits (748), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 160/435 (36%), Positives = 254/435 (58%), Gaps = 13/435 (2%)

Query: 52  EAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGS 111
           E+ D+  +R  +   S+     K+ ++PRHV MIALG  IGTGL +     L +AGP G 
Sbjct: 100 ESSDNIGARTGNKSDSL-----KKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGL 154

Query: 112 LIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITF 170
           LI + ++G++ Y + Q+ GEMA  +  +T  +  +    +    G A  ++Y   W    
Sbjct: 155 LIGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVC 214

Query: 171 ALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGF 230
            LEL      I+YWT +V  + ++ IF+VL+++ N+F  + Y E EF+    K++ + GF
Sbjct: 215 PLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGF 274

Query: 231 LIYSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGT 289
            I  + + V GAG +G IG +YW  PG + NG  + +    RF G V++L++AAF + G+
Sbjct: 275 FILGIIIDVGGAGNDGFIGGKYWHDPGAF-NGKHSID----RFKGVVATLVTAAFAFGGS 329

Query: 290 ELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIA 349
           E + IT  E  NPRKAVP A  ++ +RIL  ++ ++  +G LVPYN  +L GS  G   A
Sbjct: 330 EFIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKA 389

Query: 350 QSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTT 409
            SP++IA+ +    V+PH  NAVIL +++S  NS+ Y  +RIL  LS+   AP+ F+   
Sbjct: 390 -SPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYID 448

Query: 410 KHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTL 469
           K G P IA+ ++A+FG +A+   S    +VF WLL I+ ++   TW  I +SHIRF + +
Sbjct: 449 KAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAM 508

Query: 470 KHRGISRDDLPYKAK 484
           K +G S  +L ++++
Sbjct: 509 KVQGRSLGELGFRSQ 523

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  289 bits (739), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 159/501 (31%), Positives = 263/501 (52%), Gaps = 9/501 (1%)

Query: 45  KDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLW 104
           K+    +E    DS+   D  GS  +A + R L P  VS++ LG  +GTGL I     L 
Sbjct: 5   KNTVTVVEPTLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALA 64

Query: 105 NAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWF 164
             GP+   +A++  G++   V  SL EMA F P+   F+ +  +++ PA G A G+ Y+ 
Sbjct: 65  RGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFL 124

Query: 165 SWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKV 224
            +AI  +  L+  G +I YW   + +  W+ + +      N   V+++G+ E ++   K+
Sbjct: 125 KYAIVLSANLTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKL 184

Query: 225 IAIIGFLIYSLCMVCGAGPE-GPIGFRYWRKPG--PWGNGIIAKNVNKARFLGWVSSLIS 281
             ++   I  L + CG GP+   IGFRYWR+ G  P+    + K  N  +FLGW + +I 
Sbjct: 185 TILLLIFIVCLVITCGGGPDHTTIGFRYWRESGFLPY----LVKG-NTGKFLGWWACVIQ 239

Query: 282 AAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEG 341
           + F + G+E++GI  GET NPRK +P+A   V  RI +FYI  +F +GL V  ++ KL  
Sbjct: 240 SIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVH 299

Query: 342 SDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLA 401
           + +    A SPF+IAI      VLP   NA +L  I S+  +++Y+ SR L+GL+K+  A
Sbjct: 300 AHSTDANA-SPFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAA 358

Query: 402 PKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISIS 461
           PK F +  KH +P +  ++ ++ GFLAY+N    A  VF ++ +  ++ G + W  I ++
Sbjct: 359 PKIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVA 418

Query: 462 HIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAA 521
           +I + + +K  G+  D++P++  F P                     F   FN   F  +
Sbjct: 419 YIHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITS 478

Query: 522 YISVFLFFIVWAIFQTIYRTK 542
           YI +F   ++   ++  Y+TK
Sbjct: 479 YIGIFANVLLVLGYKLYYKTK 499

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  291 bits (744), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 177/541 (32%), Positives = 281/541 (51%), Gaps = 24/541 (4%)

Query: 52  EAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGS 111
           + ID + + M   EG   + +V R LK RH+ +IALGG IGTGLFI   G L   GP   
Sbjct: 48  QIIDVEDASMELIEGQ--EHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPL 105

Query: 112 LIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQR--FISPAVGAANGYMYWFSWAIT 169
           LI++M++    + +   L EM   +P++   ++F+    +++  +    G   +++ ++ 
Sbjct: 106 LISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMI 165

Query: 170 FALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIG 229
              E++    +IQYWTDA     +I+IF V+ VS  M PV ++GE EFWV+ IK+  I G
Sbjct: 166 APSEITATAILIQYWTDANS-AIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITG 224

Query: 230 FLIYSLCMVCGAGP--EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQ 287
            +I  + +  G  P  +  +GF YW+ PG +   ++  N  K  FL   +++I + F+Y 
Sbjct: 225 LVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHLVPGNTGK--FLACWTAIIKSGFSYV 282

Query: 288 GT-ELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL-----EG 341
              E+V   A E K+PR+ +PR   +  +R+ +FY+     IG++V Y++ +L      G
Sbjct: 283 LVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAG 342

Query: 342 SDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLA 401
             N    A SPF+I I      VLPHI NA ILT+  S G S +Y  SR+L  ++ N   
Sbjct: 343 ESNA---AASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAV 399

Query: 402 PKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISIS 461
           PK F+ T + G P+ +    +VF  LAYLN S+ +  VF WL NI  I+GF+ W+L+ + 
Sbjct: 400 PKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVV 459

Query: 462 HIRFMQTLKHRGISRDDLPYKAKFM-PXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFA 520
           ++RF + ++H  ++ D +P++ +FM P                      A ++NVSDFFA
Sbjct: 460 YLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFA 518

Query: 521 AYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEE----PKNLWEKF 576
            Y ++ L  +++      Y+T   R L                 E+ E    PKN  EK 
Sbjct: 519 CYTTLGLAAVLYIGAAIYYKTIKLRDLDEVAAEIIPKIAMADEEEKGEVPIVPKNWLEKV 578

Query: 577 W 577
           W
Sbjct: 579 W 579

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  291 bits (744), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 160/437 (36%), Positives = 245/437 (56%), Gaps = 19/437 (4%)

Query: 46  DNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWN 105
             N+    +D   S +   +GS   + +KR LKPRH+ MIA+GG+IGTGLF+     +  
Sbjct: 54  KRNIFQRCVDSFKSPL---DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAE 110

Query: 106 AGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFS 165
            GP+G +I + + G+        LGE+    PV  +F  +  RF+ P++      +Y   
Sbjct: 111 GGPLGVVIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQ 170

Query: 166 WAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVI 225
           W     LE+      +QYW  ++    W+AIF+ ++VS N+F V+ +GE EF  ++IK I
Sbjct: 171 WFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAI 230

Query: 226 AIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAF 284
            + GF+I  + ++CG GP+   IG +YW  PG   NG          F G +S L+ A++
Sbjct: 231 TVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLANG----------FPGVLSVLVVASY 280

Query: 285 TYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDN 344
           +  G E+  + +GET +P K +P AI +VF+RIL F++ SL  +G LVPY +  L G   
Sbjct: 281 SLGGIEMTCLASGET-DP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLG--- 335

Query: 345 GSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKF 404
           GS +  SPF+IAI       LP I NAVIL +++S GNS ++  SR L  ++   L P +
Sbjct: 336 GSSVDNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWW 395

Query: 405 FSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIR 464
           F    + G P + ++  ++FG LA+L  S    EVF+WL+ I  +A  I WL I++SHIR
Sbjct: 396 FGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIR 455

Query: 465 FMQTLKHRGISRDDLPY 481
           F   +K +G S D+L +
Sbjct: 456 FRLAMKAQGKSLDELEF 472

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  291 bits (745), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 164/474 (34%), Positives = 260/474 (54%), Gaps = 16/474 (3%)

Query: 18  SNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLE----AIDDDSSRMFDPEGSIGQAEV 73
           +N +Q   + S +  +     D  +   DNN   E     I++  S  F+ + +    ++
Sbjct: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN---NQL 80

Query: 74  KRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA 133
           ++ ++PRHV MI+LG  IGTGL +     L NAGP G LI ++++ +  Y + Q+ GEMA
Sbjct: 81  QKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMA 140

Query: 134 -TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEA 192
             ++ +   F  +    +  A   A  ++Y   W     LEL      I+YW + V  + 
Sbjct: 141 VNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDV 200

Query: 193 WIAIFWVLLVSFNMFP-VKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFR 250
           ++ IF++L+++ N+F   + Y E EF+    K++ I GF I  + ++CG AG  G IG  
Sbjct: 201 FVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVS 260

Query: 251 YWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAI 310
           YW  PG +       +    RF G VS+L++AAF++  TE + ITA E  NPRKA+P A 
Sbjct: 261 YWNNPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAA 315

Query: 311 NKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFN 370
            KV +R L  Y+GS+  +G LVPYN P+L GS + S    SP++IA+ +    + PH  N
Sbjct: 316 KKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKS-SQTKASPYVIAVASHGIRIAPHFIN 374

Query: 371 AVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYL 430
           AVIL +++S  NS+ Y  SR+L  L+K   APK F+   + G P   ++  ++   +A+ 
Sbjct: 375 AVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFC 434

Query: 431 NVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
             S    EVF WLL I+ ++   TW  I +SHIRF + +K +G S ++L YK++
Sbjct: 435 ASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  291 bits (745), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 165/416 (39%), Positives = 242/416 (58%), Gaps = 8/416 (1%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           Q  +K  LK RH+ MIA+GG IGTGL +     L   GP   LI +   GT+ Y++  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAV 188
           GE+A   P++  FT ++ RFI  + G AN + Y   W +   LE+      + +W TD  
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIG 248
             + ++A+FW+ +V  NMF VK YGE EF  + IKVI ++GF+I  + + CG GP G   
Sbjct: 203 YRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYI 262

Query: 249 F-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307
             +YW  PG +     A +   A+F G  S  ++AAF++ G+ELVG+ A E+  PRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVP 317

Query: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367
           +A  +VF+RI +FYI SL  IGLLVPYND  L G+ +    A SPF+IAI       LP 
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVD-AAASPFVIAIKTHGIKGLPS 376

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
           + N VIL  ++S GNS +Y  SR +  L++    P+ FS   + G P + + +T+ FG +
Sbjct: 377 VVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLI 436

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           A++  S    EVF+WLL ++ ++   TW  I I HIRF + L  +G   D+L +K+
Sbjct: 437 AFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKS 492

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  291 bits (744), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 159/437 (36%), Positives = 252/437 (57%), Gaps = 14/437 (3%)

Query: 51  LEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVG 110
           L+ +D + S       +  ++ +KR LK RH+ MIA+GG+IGTGLF+     L   GP  
Sbjct: 62  LDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAA 121

Query: 111 SLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITF 170
            ++A++L G++ YSV Q++GE+   +PV+ S+  +  RFI P+ G A  Y Y     +T 
Sbjct: 122 VILAWILTGSMVYSVVQAIGELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTM 181

Query: 171 ALELSIVGQIIQYWT-DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIG 229
            LE+      + YW  D    + ++A+F+V ++  N   VK YGE EF  + IKV+AI+G
Sbjct: 182 PLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVG 241

Query: 230 FLIYSLCMVCGAGPE--GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQ 287
           F+I  + +VCG G    G IG +YW  PG + +G          F G+ +  +++AF++ 
Sbjct: 242 FIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHG----------FKGFAAIFVTSAFSFS 291

Query: 288 GTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY 347
           G+E+  + A E+KNPR+ +P+A  +VF+RI +FY+ SL  IG LVPY +  L  S +   
Sbjct: 292 GSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSS-VD 350

Query: 348 IAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSK 407
            + SPF+IAI       LP + N VIL  ++S GN+ V+  SR    L+     PK F+ 
Sbjct: 351 ASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAY 410

Query: 408 TTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQ 467
             + G P   ++++ VFG L++L+ S     VF+W+L ++ +  F TW  I + H+RF Q
Sbjct: 411 VDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQ 470

Query: 468 TLKHRGISRDDLPYKAK 484
            L+ +G S D+L +KA+
Sbjct: 471 GLRAQGRSTDELAFKAQ 487

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  291 bits (745), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 164/460 (35%), Positives = 251/460 (54%), Gaps = 20/460 (4%)

Query: 23  SQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHV 82
           S     GM  + + I    R S+DN+  +E +D            I    + + L  RH+
Sbjct: 50  STKGSPGMKQTTNDITSSER-SRDND-DVEQVD------------INNTNLNKDLSVRHL 95

Query: 83  SMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSF 142
             +A+GG IGTGL+++    L   GP   +I +++IGT  ++V  SLGE++   PV   F
Sbjct: 96  LTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGF 155

Query: 143 TVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLV 202
            V+  RF+ P+   A    Y   W +   LEL      I+YW D +  +AW+AIF+  + 
Sbjct: 156 NVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIA 215

Query: 203 SFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNG 261
             NM  VK +GE EF ++ IK+++IIGF I  + + CG GP G     +YWR PG +   
Sbjct: 216 LANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAF--- 272

Query: 262 IIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFY 321
            +  N +  +F G  S  ++AAF+Y G E+  ++A E+KNPR+ +P+A  + F+ I   Y
Sbjct: 273 -VGHN-SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASY 330

Query: 322 IGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAG 381
           +  L  IG LVP NDP+L    +    A SP +IAI N R   LP + NA+IL  ++S  
Sbjct: 331 VTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVA 390

Query: 382 NSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFD 441
           NS VY  SR +  ++     PKF ++  K G P  A+L+T  FG L+++  SN   EVF 
Sbjct: 391 NSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFT 450

Query: 442 WLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           WL  ++ ++    W+ I++SHIRF + +K +  S D+LP+
Sbjct: 451 WLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPF 490

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  291 bits (746), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 169/442 (38%), Positives = 257/442 (58%), Gaps = 13/442 (2%)

Query: 43  FSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGP 102
           F K  ++ L+    ++ R+     +  +A ++  LK R  +MIA+GG IG+GLF+  S  
Sbjct: 76  FKKAEDVELDPNLTEAERIAQ---ATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTA 132

Query: 103 LWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMY 162
           L   GP G +I + L  T+ YS+  +LGE+A   PV   FT ++ RF+  + G AN + Y
Sbjct: 133 LRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNY 192

Query: 163 WFSWAITFALELSIVGQIIQYW-TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVAS 221
              W +   LE+      + YW T     + ++A+FW+++V  NMF VK +GE EF  + 
Sbjct: 193 ALQWLVVLPLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSI 252

Query: 222 IKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPW-GNGIIAKNVNKARFLGWVSSL 279
           IKV  +IGF+I  + +VCG GP+G     +YW  PG + G+G      + A+F G  S  
Sbjct: 253 IKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHG------SGAQFKGVCSVF 306

Query: 280 ISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL 339
           ++AAF++ G+EL+GITA E  NPRK++P A  +V +RI++FY+G+L  IGLLVPYND +L
Sbjct: 307 VTAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRL 366

Query: 340 EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNN 399
            G+ +    A SPF+IAI+      LP + N VIL  ++S GNS ++  SR +  LS   
Sbjct: 367 IGASSVD-AAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQG 425

Query: 400 LAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLIS 459
             PK F    + G P + + IT+ FG LA++  S    EVF+WLL ++ ++   TW  I 
Sbjct: 426 FLPKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGIC 485

Query: 460 ISHIRFMQTLKHRGISRDDLPY 481
           + HIRF   LK +G   ++L +
Sbjct: 486 LCHIRFRMALKAQGRDTNELTF 507

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  290 bits (743), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 159/476 (33%), Positives = 254/476 (53%), Gaps = 18/476 (3%)

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
            +K  L+ RH+ +IALGGTIGTGLF+  S  L N GP   +I++++I T+ Y +    GE
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 132 MATFIPVTSS-------FTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           M  ++P                 +++  ++G A  + Y++ + +  A E +    I++YW
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYW 174

Query: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE 244
           T  +P    I +F  ++   N  PVK+YGE EFW A IK+  I G +I +  + CG  P 
Sbjct: 175 TSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPN 234

Query: 245 GP----IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGET 299
                 +GF YW+ P  + + +   N +   FL   ++LI  AF +  G ELV +T+ E 
Sbjct: 235 NEDNSFVGFHYWKNPSSFRDYV--TNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSEC 292

Query: 300 KNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSD--NGSYIAQSPFLIAI 357
            + R+ + +A  +  +R++ FYI     I ++VPYNDP L  +   N      SPF+I I
Sbjct: 293 VDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGI 352

Query: 358 LNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIA 417
            N    +LPHI N  ILT+ +SAGN+ ++  +R L  + KN  AP+ FS+  +HGVP++A
Sbjct: 353 QNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVA 412

Query: 418 VLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRD 477
           + ++ +   LA+LN S  + +VF W  NI+ I+GFI W    I+++RF +T+ + G+  D
Sbjct: 413 LSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YD 471

Query: 478 DLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHF-NVSDFFAAYISVFLFFIVW 532
            LP+K K                          P F N  DF AAYI++ +F +++
Sbjct: 472 RLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLY 527

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  293 bits (749), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 232/417 (55%), Gaps = 8/417 (1%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
            AE+++ +KPRHV M++LG  IGTGL +  + PL  AGP   +I + ++GT  Y + Q+ 
Sbjct: 156 NAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQAC 215

Query: 130 GEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAV 188
           GEMA  +  +T SF  F    + P    A  ++Y   W     LEL      IQYWT  V
Sbjct: 216 GEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKV 275

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGA-GPEGPI 247
             + ++ IF+VL++  N F  K Y E EF   + KV+ I GF I ++C+  GA G +G I
Sbjct: 276 DPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYI 335

Query: 248 GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307
           G +YW  PG +            RF G + + ++AAF +  TE + +TA E  NPRKA+P
Sbjct: 336 GAKYWNDPGAFRG-----QTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIP 390

Query: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367
            A  K+ +R+L+ ++ ++  IG LVPY+  +L GS  GS    SP+++AI      V  H
Sbjct: 391 SAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGS-GGSATKASPYVLAISLHGVRVAQH 449

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
             NAVIL ++IS GNS  Y  SR+L  L++   APK F    + G P IA+  +AV   +
Sbjct: 450 FVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVI 509

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           A+   S    EVF WL+ I  ++   TW  I +SH+RF + +K +G S  ++ Y ++
Sbjct: 510 AFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQ 566

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  290 bits (742), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 164/464 (35%), Positives = 255/464 (54%), Gaps = 10/464 (2%)

Query: 22  QSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRH 81
             +S   G   + S + D L   K +N  +E ++D +S +     S+    + + L  RH
Sbjct: 23  DEKSILEGKSSTQSSLLD-LTLKKCDN-GIEVVNDATSTV--SNASVTNVNLNKNLSIRH 78

Query: 82  VSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSS 141
           +  +A+GG IG GLF++    L + GP   +I +++I T  ++V  +LGEMA   PV   
Sbjct: 79  LLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAFPVVGG 138

Query: 142 FTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLL 201
           F V+  RF+ P+VG A    Y   W +   LEL      I+YW D +  +AW+AIF+ ++
Sbjct: 139 FNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTINSDAWVAIFYAVI 198

Query: 202 VSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGN 260
              NM  VK +GE EF ++ +K++AIIGF I  + + CG GP+G     +YW  PG +  
Sbjct: 199 AFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGSF-- 256

Query: 261 GIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIF 320
                + +  +F G  S  ++AAF+Y G E+  ++A E+K+PR+ +P+A  + F+ I   
Sbjct: 257 ---VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLITAS 313

Query: 321 YIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISA 380
           YI  L  IG LVPY++P+L    +    A SP +IAI N     LP + NA+IL +IIS 
Sbjct: 314 YITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILISIISV 373

Query: 381 GNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVF 440
            NS VY  SR +  ++     P+      K G P  A+L T  FG L+++  S+   EVF
Sbjct: 374 ANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAEVF 433

Query: 441 DWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
            WL  ++ ++    W+ I+ISHIRF Q +K +  S D+LPY ++
Sbjct: 434 TWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQ 477

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  290 bits (743), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 172/475 (36%), Positives = 258/475 (54%), Gaps = 14/475 (2%)

Query: 17  HSNLSQSQSARSGMHVSNSKIDDPLR-----FSKDNNLTLEAIDDDSSRMFDPEGSIGQA 71
           +SNL +S S+          ++  L      F + N+ T +A  D      +   S   +
Sbjct: 23  NSNLRESISSNDLSDGDRGFVNRKLHNFCNSFKRANSDTFDASQDLEGASINSVRS--NS 80

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
           + K+++K RHV M++LG  IGTGL ++    L   GP G LI + L+  +AY + Q+ GE
Sbjct: 81  KFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGE 140

Query: 132 MATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPL 190
           MA   P +  +F V+S  FIS + G A  ++Y   W     LEL      I+YW  ++  
Sbjct: 141 MAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNSSINP 200

Query: 191 EAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF- 249
           +A+IAIF+ ++V  + F    YGE EF  ++ KV  I GF+I S+ + CG    G     
Sbjct: 201 DAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYIGG 260

Query: 250 RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRA 309
            YWR PG +  G          F G    L++A F+Y G EL  +T  E  NPRKAVP A
Sbjct: 261 EYWRNPGAFAGG-----SPIGHFKGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVPSA 315

Query: 310 INKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIF 369
             K  +RILI Y+ ++  IG LVPYN  +L GS   S    SP++IA+ +    V+PHI 
Sbjct: 316 TKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVIAVASHGVKVVPHII 375

Query: 370 NAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAY 429
           NAVIL +++S GNS +Y   R+L  L++   APK FS   + G P +A++  ++FG L++
Sbjct: 376 NAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGLLSF 435

Query: 430 LNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           +  S+  ++VF WL  I  ++   TW  I +SH+RF   +K++G S  +L YK+K
Sbjct: 436 VAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSK 490

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  291 bits (746), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 159/452 (35%), Positives = 252/452 (55%), Gaps = 12/452 (2%)

Query: 38  DDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAE-VKRALKPRHVSMIALGGTIGTGLF 96
           + P     D   T E   + S     P    G++E +K ++KPRHV MI+LG  IGTG+ 
Sbjct: 87  EQPSTLEHDLTKTFEGTLEPSEDGTQPAEVAGKSEELKHSIKPRHVIMISLGTGIGTGML 146

Query: 97  ISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFISPAVG 155
           +     L N+GP G +I + ++G+  Y + Q+ GEMA  +  +   F  +    I PA+G
Sbjct: 147 VGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALG 206

Query: 156 AANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFP-VKWYGE 214
            +  ++Y   W     LEL      I+YWT  V  + ++ IF+VL++  N+      Y E
Sbjct: 207 FSVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYAE 266

Query: 215 FEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPW-GNGIIAKNVNKARF 272
            EF+  S K++ ++GF I  + ++CG AG +G IG RYW  PG + G   I       RF
Sbjct: 267 AEFFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAFRGEHAID------RF 320

Query: 273 LGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLV 332
            G VS+L++AAF +  +E++G+TA E  NPRKA+P A  K+ +RI+  Y+GS+  +G LV
Sbjct: 321 KGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLV 380

Query: 333 PYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRIL 392
           P+N  +L GS  G  +  SP+++A+      V+PH  NAVIL +++S  NS  Y  SR+L
Sbjct: 381 PWNSDQLLGSSGGG-VKASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLL 439

Query: 393 FGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGF 452
            GL++   APK F    + G P + + + A+   +++   S    +VF WLL I+ ++  
Sbjct: 440 LGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQL 499

Query: 453 ITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
            TW  I +SHIRF + +  +G S  ++ +K++
Sbjct: 500 FTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQ 531

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  290 bits (741), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 166/462 (35%), Positives = 256/462 (55%), Gaps = 14/462 (3%)

Query: 24  QSARSGMHVSNSKIDDPLRF---SKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPR 80
           QS+R+ M    S+  D  +    S + +  LE ++  S    D E S       + L  R
Sbjct: 23  QSSRNDMSPLTSEAPDFKKADAASGNESWALENVESTSGTS-DAEDS----RYNKDLSVR 77

Query: 81  HVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTS 140
           H+  +A+GG IGTGLF++    L   GP   +I +++I T  +++  +LGE+++  PV  
Sbjct: 78  HLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVG 137

Query: 141 SFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVL 200
            F V+  RF+ P+ G A    Y   WA+   LEL      I+YW   +  +AW+AIF+ +
Sbjct: 138 GFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDAWVAIFYTI 197

Query: 201 LVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWG 259
           +   N+  VK +GE EF ++ +K++AIIGF I  + + CG GPEG     +YW  PG + 
Sbjct: 198 IFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAF- 256

Query: 260 NGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILI 319
                 N +  RF G  S  ++AAF+Y GTEL+ ++A E+ NPR  +P+A  + F+ I +
Sbjct: 257 ----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITV 312

Query: 320 FYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIIS 379
            YI  L  +G LVP +DP+L    +   +A SP +IAI N     LP + NA+IL  ++S
Sbjct: 313 CYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLS 372

Query: 380 AGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEV 439
             NS VY  SR +  +++    PK FS   + G P  A+L T +FG L+++  SN  + V
Sbjct: 373 VANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQETV 432

Query: 440 FDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           F WL  ++ ++    W  I++SHIRF  T+K RG S D+LP+
Sbjct: 433 FTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPF 474

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  290 bits (742), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 180/515 (34%), Positives = 278/515 (53%), Gaps = 20/515 (3%)

Query: 42  RFSKDNNLTLEAIDDDSSRMFDPEGSIGQAE---VKRALKPRHVSMIALGGTIGTGLFIS 98
           + +KD +   E ID   +   D E      E   +K+ LK RHV +IALGGTIGTGL + 
Sbjct: 38  QLTKDKHK--ETIDYSETSSLDEEKQQQPEENGKLKQGLKSRHVQLIALGGTIGTGLLVG 95

Query: 99  ISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFS-----QRFISPA 153
            S  L   GP G   ++++I T  Y +  + GEM  ++P   S +  S     ++++  +
Sbjct: 96  SSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRS 155

Query: 154 VGAANGYMYWFSWAITFALELSIVGQIIQYWTDA--VPLEAWIAIFWVLLVSFNMFPVKW 211
           +G A+ + Y++ + I  A E +    +++YW  A  VP  AWI IF   +V+ NM PV +
Sbjct: 156 LGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNF 215

Query: 212 YGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKA 270
           YGE EFW ASIK++ I+G +I S  +  G GP    +GFRYW++PG + + I   +    
Sbjct: 216 YGESEFWFASIKILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFADHI--TDGTGG 273

Query: 271 RFLGWVSSLISAAFTY-QGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIG 329
            FL   + +I   F +  G ELV +T+ E  + R+ + +A  +  +R++IFY+     I 
Sbjct: 274 NFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSIS 333

Query: 330 LLVPYNDPKLEGSDNGSY--IAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYV 387
           ++V YNDP L+ +   S      SPF+I I N    VLPHI N  I+T+  SAGN+ ++ 
Sbjct: 334 VIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFA 393

Query: 388 GSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNIT 447
            SR L  ++ +  APKFFSK  + GVP++AV  + +F  LAYLNVS+    VF+W  NI+
Sbjct: 394 SSRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNIS 453

Query: 448 AIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXX 507
            I+GFI W+   +++IRF + +    +  D LPYK                         
Sbjct: 454 TISGFIGWICACVAYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQ 512

Query: 508 XFAPHF-NVSDFFAAYISVFLFFIVWAIFQTIYRT 541
            F P F +  DF AAYI++ +F ++W   + + R+
Sbjct: 513 IFIPRFWDYKDFIAAYITLPVFIVLWIGHKLVTRS 547

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  288 bits (738), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 180/504 (35%), Positives = 258/504 (51%), Gaps = 27/504 (5%)

Query: 33  SNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIG 92
             S+ DD  +FSK+     +  +  S   FDP        VKRALK RH+S++ALGG IG
Sbjct: 12  DESRSDDLSKFSKEEP---DTHNIKSFEQFDP-----NTGVKRALKNRHISLLALGGIIG 63

Query: 93  TGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISP 152
            G  +     L   GP+  L+ F +IG +A++V +S+GEM T  P  S F+  S+RF S 
Sbjct: 64  PGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRFHSD 123

Query: 153 AVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWY 212
           A+ A +GY Y   +    A E + +  I+Q+W   VPL  +I IF V    F M  V  +
Sbjct: 124 ALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFSVAFQVFQMLGVGIF 183

Query: 213 GEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKAR 271
           GEFE+W+A  K+I +I + I+S+  + G     P  GF YW  PG   +G          
Sbjct: 184 GEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHYWNNPGALADG---------- 233

Query: 272 FLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLL 331
           F G     +  +  Y GTE V + A E++NP KAVP AI + F+RI+I Y+G   F G  
Sbjct: 234 FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFYGAT 293

Query: 332 VPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRI 391
           VPYND  L          +SP  IAI         H+ NA IL T +SA N ++Y+GSR 
Sbjct: 294 VPYNDTSLGAHTKA---LKSPIAIAITRAGWEGGVHLVNAFILITCVSAINGSLYIGSRT 350

Query: 392 LFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAG 451
           L  L+   LAPKF   T K GVP  A+ +    G ++ +NVS  A   + +++N++ +  
Sbjct: 351 LIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVSVGASNAYSYIVNLSGVGV 410

Query: 452 FITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAP 511
           FI W +IS++H+RF +    +G S  +LPYK+   P                     F P
Sbjct: 411 FIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFVP 470

Query: 512 HFNVSDFFAAYI----SVFLFFIV 531
            F+  DF  AYI    +V L+ ++
Sbjct: 471 -FSAKDFVDAYILLPAAVILYIVI 493

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  290 bits (742), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 163/457 (35%), Positives = 257/457 (56%), Gaps = 11/457 (2%)

Query: 30  MHVSNSKIDDPLR-FSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALG 88
           ++VS+S  DD L+  +K+    ++A  + +S + D    I    + + L  RH+  +A+G
Sbjct: 48  VNVSSSGNDDILKGDTKEYPRDVKATPEAASYVED----INNTNLNKDLSVRHLLTLAVG 103

Query: 89  GTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQR 148
           G IGTGLF++    L   GP   +I ++++ T  ++V  SLGE+A   PV   F V+  R
Sbjct: 104 GAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITR 163

Query: 149 FISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFP 208
           FI P+   A    Y   W +   LEL      I+YW D +  +AW+AIF+  +   NM  
Sbjct: 164 FIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANMLD 223

Query: 209 VKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNV 267
           VK +GE EF ++ +K++AIIGF I  + + CG GP G     +YW  PG +       + 
Sbjct: 224 VKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAF-----VGHS 278

Query: 268 NKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFF 327
             ++F G  S  ++AAF+Y G E+  ++A E++NP++ +P+A  + F+ I + Y+G L  
Sbjct: 279 AGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTL 338

Query: 328 IGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYV 387
           IG LVPYNDP+L    +    A SP +IAI N     LP + NA+IL  I+S  NS VY 
Sbjct: 339 IGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYA 398

Query: 388 GSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNIT 447
            SR +  ++     PKF SK  K G P  A+L+T  FG L+++  S+  +EVF WL  ++
Sbjct: 399 CSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALS 458

Query: 448 AIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
            ++    W+ I++S IRF   +K +G S D++P+ ++
Sbjct: 459 GLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQ 495

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  289 bits (739), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 176/546 (32%), Positives = 273/546 (50%), Gaps = 23/546 (4%)

Query: 48  NLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAG 107
           +LT  + D + +     +   G   +K+ LK  H+ +IA+GG IGTGLF+  S  L+  G
Sbjct: 27  DLTSYSNDSEKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCG 86

Query: 108 PVGSLIAFMLIGTLAYSVTQSLGEMATFIP-------VTSSFTVFSQRFISPAVGAANGY 160
           P G  I++ ++ T+ Y V  +L EM  F+P          S +    R++  ++G A G+
Sbjct: 87  PAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGW 146

Query: 161 MYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVA 220
            Y + + I  A E +    ++ YWT AVP  AWI IF  ++V  N   V++YG  E    
Sbjct: 147 NYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFC 206

Query: 221 SIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSL 279
           S+K+  I+G +I S+ +  G GP    +GFR+W+ PG W   +   +    R    ++ +
Sbjct: 207 SLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHL--ADGGAGRLSDIITGV 264

Query: 280 ISAAFTY-QGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPK 338
           I A F +  G ELV +T+ E ++ R+ + +A  +  +R++ FY  S    G++V  NDP 
Sbjct: 265 IRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPV 324

Query: 339 LEG--SDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLS 396
           L    S        SPF+I I N    VLPHI N  IL++  S+GNS +Y  +R L  LS
Sbjct: 325 LLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLS 384

Query: 397 KNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWL 456
           +   APK F++  + GVP+  V     F  LAYLNVS+   +VF+W  NI+ I+GF+ W+
Sbjct: 385 QEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWI 444

Query: 457 LISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVS 516
              ++++RF + +    +  D LP+K  F P                     F  H+N  
Sbjct: 445 CSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFV-HWNYK 502

Query: 517 DFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXXXXXXXXXWEEEE-------P 569
           DF AAYI++ LF I+W   +   RT   + +                 E +E       P
Sbjct: 503 DFIAAYITLPLFLILWLGHKAYTRT-WSQWMISVSEIDVTTGLREIEEETKELNARRIPP 561

Query: 570 KNLWEK 575
           +NLWEK
Sbjct: 562 RNLWEK 567

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 165/467 (35%), Positives = 264/467 (56%), Gaps = 19/467 (4%)

Query: 19  NLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALK 78
           NL  ++ +RSG+     +  D  + ++D+  T   ++D +  + D       + +K+A+K
Sbjct: 32  NLDATEESRSGL---VHRFVDSFKRAQDS--TENDLEDGTKPLGD------ASHLKKAMK 80

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP- 137
            RHV M+ +G  IGTGL ++ +  L   GP   +I ++L+  + Y + Q+ GEMA   P 
Sbjct: 81  SRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPT 140

Query: 138 VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIF 197
           +  +F  ++  FIS   G A  ++++  W   F LEL      I+YW D +  + +I IF
Sbjct: 141 LPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIF 200

Query: 198 WVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPG 256
           +V L+  + F VK YGE EF   S KV+ I GF+I S+ + CG AG +G IG +YWR PG
Sbjct: 201 YVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPG 260

Query: 257 PWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFR 316
            +  G    +V K  F G    L++A F+Y G EL  ++  E +NPRK+ P+A  +  +R
Sbjct: 261 SFAEG---DSVEK--FKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYR 315

Query: 317 ILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTT 376
           ILI Y+ ++  IG  VP+N+ +L GS  GS    SP+++A       V+PH  NAVIL +
Sbjct: 316 ILIIYLLTMILIGFNVPHNNDQLMGS-GGSATHASPYVLAASIHGVKVVPHFINAVILIS 374

Query: 377 IISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDA 436
           +IS  NS +Y   R++  L++   APKF     + G P  A+++ AVFG + +++ S+  
Sbjct: 375 VISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKE 434

Query: 437 QEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           +EVF WL  I  ++   TW  I +SH+RF Q +K  G S +++ ++A
Sbjct: 435 EEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRA 481

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 166/438 (37%), Positives = 249/438 (56%), Gaps = 23/438 (5%)

Query: 47  NNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLW 104
            N+   AID      F P  +GS   + +K+ LK RH+ MIA+GG+IGTGLFI     L 
Sbjct: 63  RNIFQRAIDS-----FKPPEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALA 117

Query: 105 NAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWF 164
             GP+  +I + + G+        LGE+    PV  +F  +S RF+ P++      +Y  
Sbjct: 118 TGGPLAVIIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVI 177

Query: 165 SWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKV 224
            W     LE+      +QYW +++    W+AIF+V +VS N+F V+ +GE EF  ++IKV
Sbjct: 178 QWFFVLPLEIISSAMTVQYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKV 237

Query: 225 IAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAA 283
           I I GF++  + ++ G GP+   +G RYW  PG   NG          F G +S ++ A+
Sbjct: 238 ITISGFILLCIILIAGGGPDHVYVGSRYWHNPGCLANG----------FPGVLSVMVVAS 287

Query: 284 FTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSD 343
           ++  GTE+  + +GET +P K +P AI +VF+RIL F++ SL  +G LVPY +  L G  
Sbjct: 288 YSLGGTEMTCLASGET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLG-- 343

Query: 344 NGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPK 403
            GS +  SPF+IAI      VLP I NAVIL +I+S GNS ++  SR L  ++  +L P 
Sbjct: 344 -GSSVDNSPFVIAIKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPW 402

Query: 404 FFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHI 463
           +F    + G P + ++  ++FG LA+L  S    EVFDWL+ I  +A  I WL I++SHI
Sbjct: 403 WFGYIDRAGRPLVGIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHI 462

Query: 464 RFMQTLKHRGISRDDLPY 481
           RF   +K +G S ++L +
Sbjct: 463 RFRLAMKAQGRSLNELEF 480

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  290 bits (741), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 164/472 (34%), Positives = 264/472 (55%), Gaps = 13/472 (2%)

Query: 19  NLSQSQSARSGMHVSNSKI----DDPLRFSKDNNLTLEAIDDDSSRMFDPEGSI-GQAEV 73
            +S  + A SG    + K+     +  + ++ +      I++++S + D   SI   +++
Sbjct: 32  QISSREKAYSGQPSKSEKLIHRLANSFKRAEGSITKTRQINENTSDLEDGIESITSDSKL 91

Query: 74  KRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA 133
           K+++K RHV M++LG  IGTGL ++ +  L   GP   +I ++L+  + Y + Q+ GEMA
Sbjct: 92  KKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQAAGEMA 151

Query: 134 TFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEA 192
              P + ++F  +S  FIS   G A  ++Y F W     LEL      IQYW D +  + 
Sbjct: 152 VTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYWNDKLNPDV 211

Query: 193 WIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRY 251
           +I IF++ L+  ++F VK YGE EF     K++ I GF+I S+ + CG AG +G IG  Y
Sbjct: 212 YILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGYIGGAY 271

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311
           W  PG +     A + + ARF      L++  F++ G EL  ++  E  NPRK+ P A  
Sbjct: 272 WHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKSTPVAAK 326

Query: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNA 371
           +  +RI+I Y+ ++  IG  VPYND +L G+  GS    SP+++A       ++PHI NA
Sbjct: 327 RSIYRIVIIYLLTMILIGFNVPYNDDQLMGA-GGSATHASPYVLAASIHGVKIVPHIINA 385

Query: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
           VIL +++S  NS++Y G R++  LS+   APKF     + G P  A+++  +FG +A++ 
Sbjct: 386 VILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFGVIAFVA 445

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            S+  + VF WL  I  ++   TW  I +SH+RF Q +K +G S D+L YKA
Sbjct: 446 ASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  289 bits (740), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 158/419 (37%), Positives = 242/419 (57%), Gaps = 10/419 (2%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
              +K+ +K RH+ MI+LG  IGTGL +     L + GP GS I F+++G   Y V Q+ 
Sbjct: 87  HENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAA 146

Query: 130 GEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW--TD 186
           GE+A  +  +   F  +    I PA+G A  ++Y   W   F LEL      I++W  + 
Sbjct: 147 GELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSR 206

Query: 187 AVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGA-GPEG 245
           +V  + ++AIF+VL++  N F  + Y E EF+  S KV+ +IGF I  + +  GA G  G
Sbjct: 207 SVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSG 266

Query: 246 PIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKA 305
            IG +YWR PG  G        +   F G V++L++AAF+   +E V +TA E  NPRK+
Sbjct: 267 YIGGKYWRDPGSLGG-----RTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKS 321

Query: 306 VPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVL 365
           +P A  K+ ++I + ++GS+  IG LVP +  +L GS N S +  SP++IA+      V+
Sbjct: 322 IPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGS-NDSDLHVSPYVIAVRMHGVNVV 380

Query: 366 PHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFG 425
           P   NAVIL +++S GNS  Y  SR+L  L++ N APK F    + G P +A++I+ +FG
Sbjct: 381 PSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFG 440

Query: 426 FLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
            + ++  S   +EVF WLL I+ ++   TW  I +SHIRF + L  +G S D+L +KA+
Sbjct: 441 TICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQ 499

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  287 bits (734), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 168/489 (34%), Positives = 265/489 (54%), Gaps = 16/489 (3%)

Query: 50  TLEAIDDDSSR-----MFDPEGSIGQAE--VKRALKPRHVSMIALGGTIGTGLFISISGP 102
           TL+  + D+ +       D + +IG++   ++R  K RHV M+A+ G IGTGL I     
Sbjct: 16  TLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTA 75

Query: 103 LWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMY 162
           L   GP   LIAF+  G+L   V  SL EMA+F P+  SF+ ++ R++ PA+G A G+ Y
Sbjct: 76  LKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNY 135

Query: 163 WFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASI 222
           +  +AI  A ELS +G ++QYW + + +  +I +F V+L+S N   +K+YGE EFW A +
Sbjct: 136 FLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALL 195

Query: 223 KVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPG--PWGNGIIAKNVNKARFLGWVSSL 279
           K + +I   +  L + CG GP +  IGFRYWR+    P+    + K     RFLGW + +
Sbjct: 196 KFLVLIICFVTGLVLTCGGGPSKETIGFRYWREYAFVPY----LVKGTT-GRFLGWWACV 250

Query: 280 ISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL 339
           I + + Y G+E +G+  GE  NP+K +P A   V FRI  FYI  +  +GL++  +D  L
Sbjct: 251 IQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTL 310

Query: 340 EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNN 399
             +   S  + SPF+IA  N     LP   NA+++  I SA N+ +YV SR  +GL+K+ 
Sbjct: 311 ANAKT-SDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDG 369

Query: 400 LAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLIS 459
           +APK F    ++GVPF   L+  +   L+++N+SN +  +F +L +   + G + WL + 
Sbjct: 370 MAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVL 429

Query: 460 ISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFF 519
           IS+I + +      + RD +P++  F P                     F   F    F 
Sbjct: 430 ISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFI 489

Query: 520 AAYISVFLF 528
            +YI + +F
Sbjct: 490 VSYIGIAVF 498

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  290 bits (742), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 167/432 (38%), Positives = 257/432 (59%), Gaps = 10/432 (2%)

Query: 57  DSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFM 116
           DS  + + EG   +  +K+++KPRHV MI+LG  IGTGL +  +  L +AGP G  I + 
Sbjct: 109 DSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYA 168

Query: 117 LIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELS 175
           ++G+  Y + Q+ GEMA T+  +   F  +    +SP +G A  ++YW  WA    LEL 
Sbjct: 169 IMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELV 228

Query: 176 IVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSL 235
                I+YWT  V  + ++ IF+ L++  N+F  + Y E EF+    KV+ I GF I  +
Sbjct: 229 TASMTIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGI 288

Query: 236 CMVCG-AGPEGPIGFRYWRKPGPW-GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVG 293
            + CG AG +G IG +YW  PG + G+  I       RF G  ++L++AAF + G+E + 
Sbjct: 289 IINCGGAGNDGYIGGKYWHDPGAFRGDKAID------RFKGVAATLVTAAFAFGGSEFIA 342

Query: 294 ITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPF 353
           +TA E  NPRKA+P A  K+ +RI+I ++GS+  +G LVP+N  +L GSD+ S    SP+
Sbjct: 343 LTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDS-SKTKASPY 401

Query: 354 LIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGV 413
           +IAI +    V+PH  NAVIL +++S GNS  Y  SRIL  LS+   APKFF+   + G 
Sbjct: 402 VIAISSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGR 461

Query: 414 PFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRG 473
           P  A++I A+F  +A+   S+  ++VF WLL I+ ++   TW  I +SHIRF + +  +G
Sbjct: 462 PARAMVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQG 521

Query: 474 ISRDDLPYKAKF 485
            S  ++ +K++ 
Sbjct: 522 RSLGEIGFKSEL 533

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  287 bits (735), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 182/525 (34%), Positives = 281/525 (53%), Gaps = 34/525 (6%)

Query: 41  LRFSKDNNLTLEAIDDDSSRMFDPEG-----SIGQA-------EVKRALKPRHVSMIALG 88
           L+  K ++LT E +  D + +   EG     +I Q        ++K+ LK RH+ M+ L 
Sbjct: 2   LKTVKSSSLTKEKVAIDEAEVQLEEGVTLDETIKQGVLHNDRTKLKQGLKARHIKMLTLV 61

Query: 89  GTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQR 148
           G  GTGLF+S  G L   GPVG LIA++L+G +      ++ E+A+F+P T +    S++
Sbjct: 62  GVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQ 121

Query: 149 FISPAVGAANGYMYWFSWAITFAL----ELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSF 204
           FI  AVG      + F W  T++     ELS    ++ YWTD  P   +I IF VL +  
Sbjct: 122 FIDEAVG------FTFGWISTYSSLMPGELSATAVVMTYWTDLSP-AIFITIFGVLFILT 174

Query: 205 NMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIA 264
           N++ +++YGE E++   +K+  I   +I  L +  G   +  +GF YWR PGP+   ++ 
Sbjct: 175 NIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLVG 234

Query: 265 KNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGS 324
            +  K  F+G+ ++L S  ++Y G + + I AGETKN R A+      VF RI++ Y+ +
Sbjct: 235 GDTGK--FVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLIT 292

Query: 325 LFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSN 384
           +F + L+VPYND KL  + +G+    SPF+IA+      VLPHI NA+ILT+  SAGN  
Sbjct: 293 VFVLTLIVPYND-KLIATGSGN-ARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLA 350

Query: 385 VYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLL 444
           +  GSR LF L+  N APK F KT+K G+P++ VL  + F  LAY++ S  +  VF W  
Sbjct: 351 IIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQ 410

Query: 445 NITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXX 504
            + +    + W+LIS +HI   + L+ +G SR DLPY     P                 
Sbjct: 411 ELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTG 470

Query: 505 XXXXFAP-HFNVSDFFAAYISVFL---FFIVWAIFQTIYRTKLFR 545
               F   +F++  FF+ Y  + L    F  W +F+   +T+  R
Sbjct: 471 GFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFK---KTRYLR 512

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  290 bits (741), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 160/448 (35%), Positives = 247/448 (55%), Gaps = 18/448 (4%)

Query: 45  KDNNLTLEAIDDDSSRMFDPEGSIGQAEVK--RALKPRHVSMIALGGTIGTGLFISISGP 102
           K  N+ +  +D    +    +G   + E +  + +KPRH+ MI+LG  IGTGL +     
Sbjct: 76  KRRNVFVRIVDSFKRQKVRNDGEFAETETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQV 135

Query: 103 LWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYM 161
           L  +GP G +I + +   + Y V Q+ GE+   +  +T ++T +    I PAVG A   +
Sbjct: 136 LSKSGPAGLVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSML 195

Query: 162 YWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVAS 221
           Y   W     L+L      I+YWT  V  + ++A   VL+++ NMF  K Y E EF+   
Sbjct: 196 YTLQWLTVLPLQLVTAAMTIRYWTTNVNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNC 255

Query: 222 IKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLI 280
            K++ + GF+I  + + CG AG +  IG +YW+ PG + NG          F G  +   
Sbjct: 256 CKLLMMAGFVILGIVINCGGAGDKEYIGVKYWQTPGAFANG----------FKGVAAVFC 305

Query: 281 SAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLE 340
            AAF+Y G E++ +TA E  NPRKA+P A  KV +R+L  Y+ +   +  LVPYN P L 
Sbjct: 306 YAAFSYGGIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALL 365

Query: 341 GSDN-GSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNN 399
           GS+N GS    SPF+IA+ +    V+PHI NA IL ++IS  NS++Y G R+L  LS+  
Sbjct: 366 GSNNDGSGSDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQG 425

Query: 400 LAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLIS 459
            APK F+   + G P I VL++   G +A+L      +EVF WLL ++ ++    W+ I+
Sbjct: 426 YAPKCFNYIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSIT 485

Query: 460 ISHIRFMQTLKHR--GI-SRDDLPYKAK 484
           ISH+RF   ++ +  G+ +RD + Y A+
Sbjct: 486 ISHLRFRDAIRSQLGGLRARDVVEYTAQ 513

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  288 bits (738), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 158/447 (35%), Positives = 248/447 (55%), Gaps = 23/447 (5%)

Query: 38  DDPLRFSKDNNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRHVSMIALGGTIGTGL 95
           DD      + N+    +D      F P  +GS   + +KR LKPRH+ MIA+GG+IGTGL
Sbjct: 47  DDDDGEHSNRNIFQRCVDS-----FKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGL 101

Query: 96  FISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVG 155
           F+     +   GP+G ++ + + G+        LGE+    PV  +F  +  RF+ P++ 
Sbjct: 102 FVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSIS 161

Query: 156 AANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEF 215
                +Y   W     LE+      +QYW  ++    W+AIF+ ++V  N+F  + +GE 
Sbjct: 162 FVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFGARGFGEA 221

Query: 216 EFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLG 274
           EF  +++K I + GF+I S+ ++CG GP+   IG +YW  PG   NG          F G
Sbjct: 222 EFAFSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGCLANG----------FPG 271

Query: 275 WVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPY 334
            ++ L+ A+++  G E+  + +GET +P K +P AI +VF+RIL F++ SL  +G LVPY
Sbjct: 272 VLAVLVVASYSLGGIEMTCLASGET-DP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPY 329

Query: 335 NDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFG 394
            +  L G   GS +  SPF+IA+      VLP I NAVIL +++S GNS ++  SR L  
Sbjct: 330 TNQNLLG---GSSVDNSPFVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCS 386

Query: 395 LSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFIT 454
           ++   L P +F    + G P + ++  ++FG LA+L  S    +VF+WL+ I  +A  I 
Sbjct: 387 MAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIV 446

Query: 455 WLLISISHIRFMQTLKHRGISRDDLPY 481
           WL I++SHIRF   +K +G S D+L +
Sbjct: 447 WLSINLSHIRFRLAMKAQGKSLDELEF 473

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  288 bits (738), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 155/421 (36%), Positives = 241/421 (57%), Gaps = 7/421 (1%)

Query: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124
           +  +    ++R+++PRHV+M+++   IGTGL ++    L   GP G +I +  +  +AY 
Sbjct: 71  QTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYI 130

Query: 125 VTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQY 183
           + Q+ GEMA   P +  +F  +S  FIS   G A+ ++Y   W   F LEL      I+Y
Sbjct: 131 MMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKY 190

Query: 184 WTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AG 242
           WTD+V  + +IAIF+V ++  + F  + YGE EF     KV+ I GF+I ++ + CG AG
Sbjct: 191 WTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAG 250

Query: 243 PEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNP 302
             G IG RYW  PG +  G  A     ++F G+   L++  F+Y GTEL  +T  E  +P
Sbjct: 251 NSGYIGARYWHDPGAFAVGDPA-----SKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSP 305

Query: 303 RKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRT 362
           R+A+  A  +  +RIL+ Y+ ++  IG LVP+   +L GS   S    SP+++A+     
Sbjct: 306 RRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGV 365

Query: 363 PVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITA 422
            V+PHI NAVIL  ++S GNS +Y G R+L  L++   APKF +   + G P +A++  +
Sbjct: 366 KVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACS 425

Query: 423 VFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYK 482
           V G LA++  S+  ++VF WL  I  ++   TW  I +SHIRF Q +K+ G S   L YK
Sbjct: 426 VIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYK 485

Query: 483 A 483
           +
Sbjct: 486 S 486

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  288 bits (737), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 157/429 (36%), Positives = 239/429 (55%), Gaps = 21/429 (4%)

Query: 59  SRMFDP-----EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLI 113
            RM D      +GS     +K++LK RH+ MIA+GG+IGTGLFI     L   GP+  +I
Sbjct: 54  QRMVDSFKPPLDGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALII 113

Query: 114 AFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALE 173
            + + GT        LGE+    PV  +F  +  RF+ P++      +Y   W     LE
Sbjct: 114 GWTVAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLE 173

Query: 174 LSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIY 233
           +      ++YW  +VP  AW+AIF+  +   N+  V+ +GE EF  + IKV+ IIGF+I 
Sbjct: 174 IIAAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIIL 233

Query: 234 SLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELV 292
            + ++CG GP+   +G +YW  PGP  NG          F G  +  + A+++  GTE+ 
Sbjct: 234 CVVLICGGGPKHEFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMA 283

Query: 293 GITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSP 352
            + +GET +P K +P AI +VF+RI+ F++ SL  +G LVPY +  L G   GS +  SP
Sbjct: 284 CLASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMG---GSSVDNSP 338

Query: 353 FLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHG 412
           F+IAI       LP + NAVIL +++S GNS ++  SR L  ++   L P+ F    + G
Sbjct: 339 FVIAIRLHGIKALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAG 398

Query: 413 VPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHR 472
            P + +L    FG LA+L  S+ + +VF WL+ I  +A  + WL I++SHIRF   +K +
Sbjct: 399 RPLVGILTNLAFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQ 458

Query: 473 GISRDDLPY 481
           G+S D+L +
Sbjct: 459 GVSLDELEF 467

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  289 bits (740), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 153/414 (36%), Positives = 244/414 (58%), Gaps = 8/414 (1%)

Query: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132
           +K+ ++PRHV MIALG  IGTGL +     L +AGP G LI + ++G++ Y + Q+ GEM
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEM 175

Query: 133 A-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           A  +  +T  +  +    +    G A  ++Y   W     LEL      I+YWT +V  +
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 235

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCM-VCGAGPEGPIGFR 250
            ++ IF+VL+++ N+F  + Y E EF+    K++ + GF I  + + V GAG +G IG +
Sbjct: 236 VFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGK 295

Query: 251 YWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAI 310
           YW  PG + NG  A +    RF G  ++L++AAF + G+E + IT  E  NPRKA+P A 
Sbjct: 296 YWHDPGAF-NGKHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAA 350

Query: 311 NKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFN 370
            ++ +RIL  ++ ++  +G LVPYN  +L GS  G   A SP++IA+ +    V+PH  N
Sbjct: 351 KQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKA-SPYVIAVASHGVRVVPHFIN 409

Query: 371 AVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYL 430
           AVIL +++S  NS+ Y  +R+   LS+   APK FS   + G P IA+ ++A+F  +A+ 
Sbjct: 410 AVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFC 469

Query: 431 NVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
             S   ++VF WLL I+ ++   TW  I +SH+RF + +K +G S  +L +K++
Sbjct: 470 AASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQ 523

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  287 bits (734), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 161/424 (37%), Positives = 242/424 (57%), Gaps = 6/424 (1%)

Query: 67  SIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVT 126
           S+ +   +R L PR VSMI +GG IGT LF+SI   + + GP   LIAF L   +   ++
Sbjct: 39  SLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLS 98

Query: 127 QSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTD 186
           Q +  M T++PVT SF  F++RF+  + G + G+ Y+   A     E++ V  ++++WTD
Sbjct: 99  QCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTD 158

Query: 187 AVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP 246
            +P  A I+I   L  S N+F V  +GE EF+++  KVI  IG + +++ ++ G  P+  
Sbjct: 159 KIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHK 218

Query: 247 I-GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKA 305
           + GF+ W  PG +   I   +  K  F G++S LI A + + G + +G  A E  NPRK 
Sbjct: 219 VLGFKNWSNPGAFAEYISKGSAGK--FHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKV 276

Query: 306 VPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEG--SDNGSYIAQSPFLIAILNCRTP 363
           +P +  KVF R++IFYIG    +G+LVP+ND  +    S+       SP++ A+      
Sbjct: 277 IPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIG 336

Query: 364 VLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAV 423
           VLPHI N +ILT+IISAGNS++Y  SR+L  L+    APK F K TK GVP    +   +
Sbjct: 337 VLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYCCVAVLL 395

Query: 424 FGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
              LAYL+VSN    V  W LN+   A  I ++ I IS+++F +  K + I    LPY +
Sbjct: 396 VCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSS 455

Query: 484 KFMP 487
            F+P
Sbjct: 456 SFLP 459

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  288 bits (736), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 156/432 (36%), Positives = 243/432 (56%), Gaps = 16/432 (3%)

Query: 55  DDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIA 114
            DD    +D E     +++K+ +K RH+ MI+LG  IGTGL +     L  AGP G +I 
Sbjct: 47  QDDDVVGYDEETGT-SSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIG 105

Query: 115 FMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALE 173
           + +   + Y + Q+ GE+   +  +T ++T +S   + PA+G +  ++Y   W   F L+
Sbjct: 106 YGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQ 165

Query: 174 LSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIY 233
           L      I+YWTD  P + ++AI + L+V  N+F  K Y E EF   + KV+ ++GF+I 
Sbjct: 166 LVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVIL 224

Query: 234 SLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELV 292
            + + CG AG +G IG RYW  PG +  G          F G       AAF Y G E++
Sbjct: 225 GIIINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEVM 274

Query: 293 GITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSP 352
            +TA E +NPRK++P A  KV +RIL+ Y+ +   +  LVPY+ P+L  +  GS    SP
Sbjct: 275 VLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPEL--TSTGSASRASP 332

Query: 353 FLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHG 412
           F+IAI +    V+PHI NAVIL  ++S GNS++Y   R+L  LS+   APK F+   + G
Sbjct: 333 FVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQG 392

Query: 413 VPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHR 472
            P +  L+    G LA++  S+  ++VF WLL I+ ++    W+ I +SH+RF   +K +
Sbjct: 393 RPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQ 452

Query: 473 GISRDDLPYKAK 484
           G S  ++ YK++
Sbjct: 453 GRSLGEVGYKSQ 464

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  285 bits (728), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 165/471 (35%), Positives = 252/471 (53%), Gaps = 29/471 (6%)

Query: 21  SQSQSARSGMHVSNSKI-------DDPLRFSKDNNLTLEAIDDDSSRMFDP--EGSIGQA 71
           S  ++  SG  + +S         +D +R    N   L+ + D     F P  +GS    
Sbjct: 16  SHLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDS----FKPPEDGSFHSD 71

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
            +K++LK RH+ MIA+GG+IGTGLFI     L   GP+  +I + + GT        LGE
Sbjct: 72  NLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGE 131

Query: 132 MATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           +    PV  +F  +  RF+ P++      +Y   W     LE+      ++YW  +V   
Sbjct: 132 ITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPV 191

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFR 250
            W+AIF+ ++   N+  V+ +GE EF  + IKVI I+GF+I  + ++CG GP+   +G +
Sbjct: 192 VWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAK 251

Query: 251 YWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAI 310
           YW  PGP  NG          F G    L+ A+++  GTE+  + +GET +P K +P AI
Sbjct: 252 YWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGET-DP-KELPSAI 299

Query: 311 NKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFN 370
            +VF+RI+ F++ SL  +G LVPY +  L G   GS +  SPF+IAI       LP I N
Sbjct: 300 KQVFWRIVFFFLVSLTLVGFLVPYTNQNLMG---GSSVDNSPFVIAIRLHGINALPSIVN 356

Query: 371 AVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYL 430
           AVIL +++S GNS ++  SR L  ++   L P+ F    + G P   +L   +FG LA+L
Sbjct: 357 AVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFL 416

Query: 431 NVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
             S  A +VF WL+ I  +A  + WL I+ISHIRF   +K +G+  ++L +
Sbjct: 417 VKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEF 467

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  285 bits (728), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 165/471 (35%), Positives = 252/471 (53%), Gaps = 29/471 (6%)

Query: 21  SQSQSARSGMHVSNSKI-------DDPLRFSKDNNLTLEAIDDDSSRMFDP--EGSIGQA 71
           S  ++  SG  + +S         +D +R    N   L+ + D     F P  +GS    
Sbjct: 16  SHLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDS----FKPPEDGSFHSD 71

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
            +K++LK RH+ MIA+GG+IGTGLFI     L   GP+  +I + + GT        LGE
Sbjct: 72  NLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGE 131

Query: 132 MATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           +    PV  +F  +  RF+ P++      +Y   W     LE+      ++YW  +V   
Sbjct: 132 ITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPV 191

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFR 250
            W+AIF+ ++   N+  V+ +GE EF  + IKVI I+GF+I  + ++CG GP+   +G +
Sbjct: 192 VWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAK 251

Query: 251 YWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAI 310
           YW  PGP  NG          F G    L+ A+++  GTE+  + +GET +P K +P AI
Sbjct: 252 YWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGET-DP-KELPSAI 299

Query: 311 NKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFN 370
            +VF+RI+ F++ SL  +G LVPY +  L G   GS +  SPF+IAI       LP I N
Sbjct: 300 KQVFWRIVFFFLVSLTLVGFLVPYTNQNLMG---GSSVDNSPFVIAIRLHGINALPSIVN 356

Query: 371 AVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYL 430
           AVIL +++S GNS ++  SR L  ++   L P+ F    + G P   +L   +FG LA+L
Sbjct: 357 AVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFL 416

Query: 431 NVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
             S  A +VF WL+ I  +A  + WL I+ISHIRF   +K +G+  ++L +
Sbjct: 417 VKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEF 467

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  289 bits (740), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 160/429 (37%), Positives = 244/429 (56%), Gaps = 10/429 (2%)

Query: 59  SRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLI 118
           +++  P  +     +K+ ++PRHV MI+LG  IGTGL +     L NAGP G +I + ++
Sbjct: 116 NQLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIM 175

Query: 119 GTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIV 177
           G++ Y + Q+ GEMA  +  +   + V+    +    G A  ++Y   W     LEL   
Sbjct: 176 GSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTA 235

Query: 178 GQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCM 237
              I+YWT +V  + ++AIF+ L++  N+F  K Y E EF+    KV+ +IGF I S+ +
Sbjct: 236 SLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITI 295

Query: 238 VCG-AGPEGPIGFRYWRKPGPW-GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGIT 295
             G AG +G +G  YW  PG + G+  I        F G   +L++AAF Y GTE + +T
Sbjct: 296 TAGGAGNDGYLGGLYWHTPGAFRGDSSID------HFKGICGTLVTAAFAYGGTEFLALT 349

Query: 296 AGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLI 355
           A E  NPR A+P A  KV +RI+  Y+ S+  IG LVP++  +L GSD GS  + SP+++
Sbjct: 350 AAEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSD-GSATSASPYVL 408

Query: 356 AILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPF 415
           A       V+PH  NAVIL +++S GNS  Y  SR+L  L++   APK+F    + G P 
Sbjct: 409 AASLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPA 468

Query: 416 IAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGIS 475
            A+L++A+FG +A+   S    EVF WLL I+ ++   TW  I +SHIRF   +K +G S
Sbjct: 469 RAMLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRS 528

Query: 476 RDDLPYKAK 484
             ++ Y A+
Sbjct: 529 LGEVGYLAQ 537

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  285 bits (730), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 161/496 (32%), Positives = 260/496 (52%), Gaps = 17/496 (3%)

Query: 55  DDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIA 114
           D+  S   D +       + R LKPR VS++ LG  +GTGL I     L   GP+   IA
Sbjct: 18  DECESEEIDEK----NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIA 73

Query: 115 FMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALEL 174
           ++  G+L   V  SL EMA+F P+   F+ +  R++ PA G A G+ Y+  +AI  +  L
Sbjct: 74  YLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANL 133

Query: 175 SIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYS 234
           +  G +I YW   V +  W+ + +V +   N   VK++GE E  +   K++ ++   I  
Sbjct: 134 TAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITC 193

Query: 235 LCMVCGAGP-EGPIGFRYWRKPG--PW--GNGIIAKNVNKARFLGWVSSLISAAFTYQGT 289
           L + CG  P     GFRYWR+ G  P+  G G         +FLGW + ++ + F + G+
Sbjct: 194 LIITCGGAPNHTTTGFRYWRESGALPYLVGGG-------TGKFLGWWACVVQSIFGFMGS 246

Query: 290 ELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIA 349
           E++GI  GET NP+K +P++   VFFRI   Y+  +F +GL +   + KL  + +    A
Sbjct: 247 EMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANA 306

Query: 350 QSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTT 409
            SPF+IAI +    VLP+  NA +L  IIS+ N+++Y+ SR L+GL+K+  APK F    
Sbjct: 307 -SPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVN 365

Query: 410 KHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTL 469
           +  VP +  +  ++ GFLAY+N    A  VF ++ +  ++ G + W  I I++I + + +
Sbjct: 366 RFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAI 425

Query: 470 KHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFF 529
           K +GIS DD+P++  F P                     F   F+   F  +YI VF   
Sbjct: 426 KAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANI 485

Query: 530 IVWAIFQTIYRTKLFR 545
           ++   ++  ++TK  +
Sbjct: 486 LMVIGYKLYFKTKFVK 501

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  289 bits (740), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 166/519 (31%), Positives = 274/519 (52%), Gaps = 15/519 (2%)

Query: 35  SKIDDPLRFSKDNNLT--LEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIG 92
             ID P     +N LT  L  +       F P        +++ +KPRHV +++LG  IG
Sbjct: 91  EDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIG 150

Query: 93  TGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFIS 151
           TGL +     L  AGP G +I + ++G+  Y + Q+ GEMA  +  +  +F  +    + 
Sbjct: 151 TGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVD 210

Query: 152 PAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKW 211
            A G +  ++Y   W     LEL      IQYWT  V  + ++ IF+VL++  N+F  K 
Sbjct: 211 EAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIFYVLIIFINVFGAKG 270

Query: 212 YGEFEFWVASIKVIAIIGFLIYSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKA 270
           Y E EF+  S KV+ + GF I ++ +   GAG +G IG +YW  PG +      K+++  
Sbjct: 271 YAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD---KSID-- 325

Query: 271 RFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGL 330
           RF   +S+  +AAF +  +E + I A E  NPR+A+P A   + +RIL  ++ S+  +G 
Sbjct: 326 RFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGF 385

Query: 331 LVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSR 390
           LVPYN  +L GS + +  A SP++IA+ +    V+PH  NAVIL +++S  NS  Y   R
Sbjct: 386 LVPYNSTELMGSGSAATKA-SPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCR 444

Query: 391 ILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIA 450
           IL+ LS+   AP +F+   + G P  A++++A+F  +A+   S+  ++VF WLL I+ ++
Sbjct: 445 ILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLS 504

Query: 451 GFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFA 510
              TW+ I +SHIRF + +K +G S D++ +K++                         A
Sbjct: 505 QLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIA 564

Query: 511 P----HFNVSDFFAAYISVFLFFIVWAIFQTIYRT-KLF 544
           P    H +  +FF  Y+++ +  +++  ++   R  KLF
Sbjct: 565 PIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLF 603

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  288 bits (738), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 166/446 (37%), Positives = 251/446 (56%), Gaps = 12/446 (2%)

Query: 42  RFSKDNNLTLEAIDDDSSRMFDPEGSIGQAE----VKRALKPRHVSMIALGGTIGTGLFI 97
           R S D  L     DD  S          Q E    +K+ +KPRHV MI+LG  IGTGL +
Sbjct: 85  RTSMDAALNKTKFDDAISSSISETNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLV 144

Query: 98  SISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFISPAVGA 156
                L  AGP   +I + ++GT  Y + Q+ GE+A  +  +   F  +    + PA+G 
Sbjct: 145 GNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGF 204

Query: 157 ANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFE 216
           +  ++Y   W     LEL      I+YWT  V  + ++ IF+VL+++ N F  + Y E E
Sbjct: 205 SVAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAE 264

Query: 217 FWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGW 275
           F+    KV+ + GF I  + +  G AG +G +G +YW  PG + NG   K+++  RF G 
Sbjct: 265 FFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAF-NG--DKSID--RFKGV 319

Query: 276 VSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYN 335
           + + ++AAF +  TE + +TA E  NPRKA+P A  KV +RI+  ++ S+  IG LVPYN
Sbjct: 320 MDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYN 379

Query: 336 DPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGL 395
             +L GS  GS I  SP++IA+ +    V+PH  NAVIL +++S GNS  Y  SR+L  L
Sbjct: 380 SDQLLGS-GGSGIKASPYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSL 438

Query: 396 SKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITW 455
           ++   APK+F    + G PF A+L++A+FG +A+   S    EVF WLL I+ ++   TW
Sbjct: 439 AQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTW 498

Query: 456 LLISISHIRFMQTLKHRGISRDDLPY 481
           + I +SHIRF + ++ +G S  ++ Y
Sbjct: 499 ITICVSHIRFRRAMQVQGRSLGEVGY 524

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  287 bits (734), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 163/467 (34%), Positives = 253/467 (54%), Gaps = 9/467 (1%)

Query: 19  NLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSI---GQAEVKR 75
           N+   Q   S +            +S +  L   A + D + M D E +I     +++ +
Sbjct: 7   NMDTKQQDLSSLSEVGQSFAKEETWSVEKQLKPLAEEKDYADMNDVEKAIYNTKDSKLNK 66

Query: 76  ALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATF 135
            L  RH+  +A+GG IGTGLF++    L   GP   +IA+ +I T  +++  SLGE++  
Sbjct: 67  DLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSAT 126

Query: 136 IPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIA 195
            PV   F V+  RF+ P+ G A  + Y   WAI   LEL      I+YW  ++  +AW++
Sbjct: 127 FPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSINPDAWVS 186

Query: 196 IFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRK 254
           IF+V +   NM  VK +GE EF ++ +K++AIIGF I  + ++CG GP G     +YW  
Sbjct: 187 IFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWND 246

Query: 255 PGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVF 314
           PG +     A+     RF G  +  I+AAF+Y G ELVG++A E++NPR  +P+A  + F
Sbjct: 247 PGAFVGDTPAQ-----RFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTF 301

Query: 315 FRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVIL 374
           + I + Y+  L  IG LVP NDP L    +    A SP +IAI N     LP + NA+IL
Sbjct: 302 WLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAIIL 361

Query: 375 TTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSN 434
             ++S  NS VY  SR +  +++    P+  +   K G P  A+ IT + G L+++  SN
Sbjct: 362 IALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASN 421

Query: 435 DAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
              EVF WL  ++ ++    W  I+++H+RF   +KH+  S ++LPY
Sbjct: 422 KRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPY 468

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  287 bits (734), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 158/447 (35%), Positives = 251/447 (56%), Gaps = 24/447 (5%)

Query: 38  DDPLRFSKDNNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRHVSMIALGGTIGTGL 95
           DD  +++ + N+    +D      F P  +GS   + +KR LKPRH+ MIA+GG+IGTGL
Sbjct: 47  DDDGQYN-NRNIFQRCVDS-----FKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGL 100

Query: 96  FISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVG 155
           F+     +   GP+G ++ + + G+        LGE+    PV  +F  +  RF+ P++ 
Sbjct: 101 FVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHGLGEITVRFPVVGAFANYGTRFLDPSIS 160

Query: 156 AANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEF 215
                +Y   W     LE+      +QYW  ++    W+AIF+ ++VS N+F  + +GE 
Sbjct: 161 FVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGARGFGEA 220

Query: 216 EFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLG 274
           EF  +++K I + GF+I  + ++CG GP+   IG +YW  PG   +G          F G
Sbjct: 221 EFAFSTVKAITVGGFIILCIVLICGGGPDHEFIGAKYWHDPGCLAHG----------FPG 270

Query: 275 WVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPY 334
            +S L+ A+++  G E+  + +GET +P K +P AI +VF+RI+ F++ SL  +G LVPY
Sbjct: 271 VLSVLVVASYSLGGIEMTCLASGET-DP-KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPY 328

Query: 335 NDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFG 394
            +  L G   GS +  SPF+IAI      VLP I NAVIL +++S GNS ++  SR L  
Sbjct: 329 TNQNLLG---GSSVDNSPFVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCS 385

Query: 395 LSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFIT 454
           ++   L P +F    + G P + ++  ++FG LA+L  S    EVF+WL+ I  +A  I 
Sbjct: 386 MAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIV 445

Query: 455 WLLISISHIRFMQTLKHRGISRDDLPY 481
           WL I++SH+RF   +K +G S D+L +
Sbjct: 446 WLSINLSHVRFRLAMKAQGKSLDELEF 472

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  286 bits (732), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 158/423 (37%), Positives = 243/423 (57%), Gaps = 18/423 (4%)

Query: 62  FDP--EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIG 119
           F P  +GS     +K++LK RH+ MIA+GG+IGTGLFI     L   GP+  +I + + G
Sbjct: 65  FKPPEDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAG 124

Query: 120 TLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQ 179
           +        LGE+    PV  +F  ++ RF+ P++      +Y   W     LE+     
Sbjct: 125 SQIVGTIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAI 184

Query: 180 IIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVC 239
            +QYW D++    ++AIF+ ++VS N+F  + +GE EF  +++K+I I GF+I  + ++ 
Sbjct: 185 TVQYWNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIA 244

Query: 240 GAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGE 298
           G GP+   IG +YW  PG   +G          F G +S L+ A+++  GTE+  + +GE
Sbjct: 245 GGGPDHEYIGAKYWHNPGSLAHG----------FKGVLSVLVVASYSLGGTEMTCLASGE 294

Query: 299 TKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAIL 358
           T +P K +P AI +VF+RIL F++ SL  +G LVPY +P L G   GS +  SPF+IAI 
Sbjct: 295 T-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLG---GSSVDNSPFVIAIK 349

Query: 359 NCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAV 418
                VLP I NAVIL +I+S GNS ++  SR L  ++  +L P +F    + G P   +
Sbjct: 350 IHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGI 409

Query: 419 LITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDD 478
           +I ++FG LA+L  S+   EVFDWL+ I  +A  I WL I+I H+RF   +K +  + D+
Sbjct: 410 IINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDE 469

Query: 479 LPY 481
           L +
Sbjct: 470 LEF 472

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  285 bits (729), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 172/486 (35%), Positives = 268/486 (55%), Gaps = 25/486 (5%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           + ++K+ LK RH+ M+ L G  GTGLF+S  G L   GPVG LIA++ +G +      ++
Sbjct: 46  RTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAI 105

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFAL----ELSIVGQIIQYWT 185
            E+A+F+P T +    +++FI  +VG      + F W  T++     ELS    I++YWT
Sbjct: 106 AEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMRYWT 159

Query: 186 DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEG 245
           D  P   +I +F +L V  N++ +++YGE E+    +K++ I   +I  L +  G G +G
Sbjct: 160 DVSP-AVFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLG-GTKG 217

Query: 246 P--IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPR 303
              +GF YWR+PGP+ N ++  ++ K  F+G+ +++ S  ++Y G + + I AGETKN R
Sbjct: 218 QERLGFHYWREPGPFANYLVGGHIGK--FVGFWAAISSVVYSYSGIQNIAILAGETKNSR 275

Query: 304 KAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTP 363
            A+      VF RI++ Y+ ++F + L+VPYND KL  +  G+    SPF+IA+      
Sbjct: 276 HAIFHGAKNVFLRIIVLYLVTVFILTLIVPYND-KLIATGTGT-ARSSPFVIAMNRAGIK 333

Query: 364 VLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAV 423
           VLPHI NA+ILT+  SAGN  +  GSR LF L+  N APK F +T+K G+P++ V+  + 
Sbjct: 334 VLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISS 393

Query: 424 FGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           F  LAY++ S  +  VF W   + +    + W+LIS +HI   + LK +G SR DLPY  
Sbjct: 394 FLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYST 453

Query: 484 KFMPXXXXXXXXXXXXXXXXXXXXXF-APHFNVSDFFAAYISVFL---FFIVWAIFQTIY 539
              P                     F   HF++  FF  Y  + L    F  W +F+   
Sbjct: 454 PMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFK--- 510

Query: 540 RTKLFR 545
           +TK  R
Sbjct: 511 KTKYLR 516

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  286 bits (733), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 178/439 (40%), Positives = 266/439 (60%), Gaps = 8/439 (1%)

Query: 47  NNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNA 106
             + +E +D + + +        ++ ++  LK RH+ MIA+GG IGTGLF+     L  A
Sbjct: 62  KRIEVEEVDPNLTDIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTA 121

Query: 107 GPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSW 166
           GP G LI + + GT+ +++  +LGE+A   PV+  F  ++ RFI  + G AN + Y F W
Sbjct: 122 GPAGILIGWGITGTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQW 181

Query: 167 AITFALELSIVGQIIQYWTDAVP-LEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVI 225
            +   LE+      + YW   V   + ++A+FW+++V  NMF V+ YGE EF  + IKVI
Sbjct: 182 LVALPLEIVAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVI 241

Query: 226 AIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAF 284
           A+IGF+I  + +VCG GP G     RYW  PG +     A +    RF G+ S  ++AAF
Sbjct: 242 AVIGFIILGIILVCGGGPVGGYVGGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAF 296

Query: 285 TYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDN 344
           ++ G+ELVGI + E+KNPRK+VP+A  +VF+RIL+FYI  L  +GLLVPY DP+L GS +
Sbjct: 297 SFAGSELVGIASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGS-S 355

Query: 345 GSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKF 404
           G   + SPF+IAI+      LP + N VIL +++S GNS++Y  SR L  LS+    PK 
Sbjct: 356 GVDASASPFVIAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKT 415

Query: 405 FSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIR 464
            +   + G P + + I + FG +A++  SN  +++F+WLL I+ I+ F+TW  I   HIR
Sbjct: 416 VAYIDRKGRPLVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIR 475

Query: 465 FMQTLKHRGISRDDLPYKA 483
           F   LK  G S D+LP+K+
Sbjct: 476 FRSALKVNGRSDDELPFKS 494

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  286 bits (732), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 160/447 (35%), Positives = 250/447 (55%), Gaps = 24/447 (5%)

Query: 38  DDPLRFSKDNNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRHVSMIALGGTIGTGL 95
           DD  ++S + N+    +D      F P  +GS   + +KR LKPRH+ MIA+GG+IGTGL
Sbjct: 47  DDNHQYS-NRNIFQRCVDS-----FKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGL 100

Query: 96  FISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVG 155
           F+     +   GP+G ++ + + G+        LGE+    PV  +F  +  RF+ P++ 
Sbjct: 101 FVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSIS 160

Query: 156 AANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEF 215
                +Y   W     LE+      +QYW  ++    W+AIF+V++VS N+F V+ +GE 
Sbjct: 161 FVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVVWVAIFYVIIVSINLFGVRGFGEA 220

Query: 216 EFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLG 274
           EF  ++IK I + GF+I  + ++ G GP+   +G +YW  PG   NG          F G
Sbjct: 221 EFAFSTIKAITVCGFIILCIVLIFGGGPDHEYVGAKYWYDPGCLANG----------FPG 270

Query: 275 WVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPY 334
            +S L+ A+++  G E+  + +GET +P K +P AI +VF+RIL F++ SL  +G LVPY
Sbjct: 271 ILSVLVVASYSLGGIEMTCLASGET-DP-KGLPSAIKQVFWRILFFFLVSLTLVGFLVPY 328

Query: 335 NDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFG 394
            +  L G   GS +  SPF+IAI      VLP I N VIL +++S GNS ++  SR L  
Sbjct: 329 TNQNLLG---GSSVDNSPFVIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCS 385

Query: 395 LSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFIT 454
           ++   L P +F    + G P + ++  ++FG LA+L  S    +VF+WL+ I  +A  I 
Sbjct: 386 MAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIV 445

Query: 455 WLLISISHIRFMQTLKHRGISRDDLPY 481
           WL I++SHIRF   +K +G   D+L +
Sbjct: 446 WLSINVSHIRFRMAMKAQGKKLDELEF 472

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  285 bits (729), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 152/418 (36%), Positives = 239/418 (57%), Gaps = 6/418 (1%)

Query: 68  IGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQ 127
           +    + + L  RH+  +A+GG+IGTGLF++    L + GP   ++ +++I T  ++V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 128 SLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDA 187
           SLGE+A   P+   F V+  RF+ P+VG A    Y   W +   LEL      I+YW D 
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 188 VPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPI 247
           +  +AW+AIF+V +V  NM  VK +GE EF ++ +K++AIIGF I  + +  G GP G  
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 248 G-FRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAV 306
             F+YW  PG +  G      N ++F G  S  ++AAF++ G E++ ++A E+KNPRK +
Sbjct: 218 LGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 307 PRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLP 366
           P+A  + F+ +   Y+  L  +G LVPYND +L  +      A SP +IAI N     LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 367 HIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGF 426
            + NA+IL  I+S  NS VY  SR +  ++     PK  SK  K G P  A+++T +FG 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 427 LAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           L+++  S+   EVF WL  ++ ++    W+ I+ S IRF + ++ +  S D+LPY ++
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQ 450

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  284 bits (726), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 164/452 (36%), Positives = 246/452 (54%), Gaps = 19/452 (4%)

Query: 37  IDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLF 96
           + D   FS  N  T++  DD     FDP        VKRALK RH+S++ALGG IG G  
Sbjct: 1   MSDVKAFSPLNIKTVKIRDDRDVSEFDP-----NTGVKRALKNRHISLLALGGIIGPGCL 55

Query: 97  ISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGA 156
           +     L   GP+  L+ F++IG +A++V +S+GEM T  P    FT  ++RF S A+ A
Sbjct: 56  VGAGNALQKGGPLALLLGFVIIGIIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSA 115

Query: 157 ANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFE 216
             GY Y   +    A E + +  I+Q+W   VPL A+  IFW++   F +  V  +GE E
Sbjct: 116 VCGYAYVIVFFAVLANEYNTLSSILQFWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETE 175

Query: 217 FWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLGW 275
           +W++ +K++ +I + I+S+  + G     P  GF YW+ PG   +G          F G 
Sbjct: 176 YWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFGFHYWKDPGSLSHG----------FKGI 225

Query: 276 VSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYN 335
               +  +  Y GTE V +TA E+KNP K+VP A+ +  +RI++ YIG   F G  VP+N
Sbjct: 226 AVVFVFCSSFYSGTESVALTATESKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFN 285

Query: 336 DPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGL 395
           DP L  +     + +SP  IAI         H+ NA IL + ISA N ++Y+GSR L  L
Sbjct: 286 DPNLSVNTK---VLKSPIAIAISRAGWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNL 342

Query: 396 SKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITW 455
           +   LAPKF + T K GVP  A+ I    G ++ +N+S  A   + +++N++ +  FI W
Sbjct: 343 AYEGLAPKFLAWTDKRGVPIPAITIFNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVW 402

Query: 456 LLISISHIRFMQTLKHRGISRDDLPYKAKFMP 487
            +IS +H+R  +    +G   ++LPYKA F P
Sbjct: 403 GVISYTHLRLRKAWVAQGRLLEELPYKALFYP 434

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  285 bits (729), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 167/481 (34%), Positives = 251/481 (52%), Gaps = 21/481 (4%)

Query: 44  SKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103
           + D   T E  + ++S ++DP     +  VKRALK RH+S++ALGG IG G  +     L
Sbjct: 28  TPDQIETGEGKNHNAS-LYDP-----KTGVKRALKDRHISLLALGGIIGPGCLVGAGNAL 81

Query: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYW 163
              GP+  L+ F +IG +A+++ +S+GEM T  P    FT  ++RF S ++ A  GY Y 
Sbjct: 82  AKGGPLALLLGFSIIGIIAFTIMESIGEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYI 141

Query: 164 FSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223
             +    A E + +  I Q+W   VPL  +I IFW    +F M  V  +GE E+W++  K
Sbjct: 142 VVFFAVMANEYNTLSSIFQFWGPQVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFK 201

Query: 224 VIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISA 282
           ++ ++ F I+S   + G   + P  GF YW  PG   +G          F G     +  
Sbjct: 202 ILGLVAFYIFSTIYISGGIKDRPAFGFHYWNNPGALSHG----------FKGIAEVFVFC 251

Query: 283 AFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS 342
           +  Y GTE V  +A E+KNP +A+P AI + F+RIL+ YIG  FF G+ VPYND  L   
Sbjct: 252 STFYSGTESVAYSASESKNPNRAIPLAIRQTFWRILVVYIGIGFFYGVTVPYNDHNL--- 308

Query: 343 DNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAP 402
           + G+   +SP  IAI         H+ NA IL T ISA N ++++GSR +  L+   LAP
Sbjct: 309 NAGTKALKSPISIAITRAGWEGGTHLVNAFILVTCISAINGSLFIGSRTITNLAHEGLAP 368

Query: 403 KFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISH 462
           KF + T + GVP  A+ +    G ++ +NVS  A   + +++N++ +  FI W  I ++H
Sbjct: 369 KFLAWTDRRGVPIPAITLFNALGLVSLMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTH 428

Query: 463 IRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAY 522
           +RF +    +G +  +LPYKA F P                     F P F   DF  AY
Sbjct: 429 LRFRKAWIKQGRTVKELPYKALFYPYTQIIGIAANIFLALIQGWTSFVP-FKAGDFVDAY 487

Query: 523 I 523
           +
Sbjct: 488 V 488

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  286 bits (731), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 158/417 (37%), Positives = 240/417 (57%), Gaps = 8/417 (1%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
             ++K+ ++PRHV MI+LG  IGTGL +     L+N GP G  + F ++GT  Y V Q+ 
Sbjct: 86  HEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQAA 145

Query: 130 GEMATFIPVTSS-FTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAV 188
           GEMA   P  S  F  +    + P  G A  ++Y   W   F LEL      I+YWT A+
Sbjct: 146 GEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTAI 205

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGA-GPEGPI 247
             + ++A+F++L++  N F  + Y E EF+  + KV+ IIGF I  + +  GA G +G I
Sbjct: 206 NPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGYI 265

Query: 248 GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307
           G +YWR+PG +G      +     F G VS+L++AAF+   +E V +TA E  NPRK+VP
Sbjct: 266 GAKYWREPGSFGG-----HTAIDHFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKSVP 320

Query: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367
            A  K+ +++ + ++GS+  IG LVP N  +L GS + S +  SP++IA+ +    V+PH
Sbjct: 321 SAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSS-VHVSPYVIAVASHGVRVVPH 379

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
             NAVIL +++S GNS  Y  SR+L  L++   AP  F    + G P +A++++   G L
Sbjct: 380 FINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCL 439

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
            ++  S   + VF WLL I+ ++   TW  I ISHIRF + L  +G   D L +KA+
Sbjct: 440 CFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQ 496

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  286 bits (732), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 161/428 (37%), Positives = 242/428 (56%), Gaps = 11/428 (2%)

Query: 60  RMFDPEGSIGQA-----EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIA 114
            M D E ++  A     ++ + L  RH+  +A+GG IGTGLF++    L   GP   LIA
Sbjct: 91  EMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIA 150

Query: 115 FMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALEL 174
           + LI T  +++  SLGE+A+  PV   F V+  RF+ P+ G A    Y   WA+   LEL
Sbjct: 151 WTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLEL 210

Query: 175 SIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYS 234
           +     I+YW + +  +AW+AIF+V +   NM  VK +GE EF ++ +K++AI GF I  
Sbjct: 211 AAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILG 270

Query: 235 LCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVG 293
             ++CG GP G     +YW  PG +       +   A+F G  S  ++AAF+Y GTELVG
Sbjct: 271 TVLICGGGPVGGFIGAKYWHDPGAF-----VGDTPGAQFKGLCSVFVTAAFSYSGTELVG 325

Query: 294 ITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPF 353
           ++A E+ NPR  +PRA  + F+ I   Y+  L   G LVP NDP+L    +   +A SP 
Sbjct: 326 VSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPL 385

Query: 354 LIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGV 413
           +IAI N     +P + NA+IL  IIS  NS+VY  SR +  +++    PK F+   + G 
Sbjct: 386 VIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGR 445

Query: 414 PFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRG 473
           P +A+L T VFG L+++  S+  + +F WL  ++ ++    W  I+ISHIRF + +  + 
Sbjct: 446 PLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQ 505

Query: 474 ISRDDLPY 481
            S D+LPY
Sbjct: 506 RSLDELPY 513

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  285 bits (730), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 153/434 (35%), Positives = 244/434 (56%), Gaps = 8/434 (1%)

Query: 54  IDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLI 113
           +  DS    D +  +   ++K+ +K RHV M++LG  IGTGL ++ +  L  AGP   +I
Sbjct: 56  LKQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVI 115

Query: 114 AFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFAL 172
           A+ ++  + Y + Q+ GEMA   P +  +F  +   FIS   G A  ++++  W     L
Sbjct: 116 AYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPL 175

Query: 173 ELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLI 232
           EL      +QYW D++  + ++ IF+V L+  + F VK YGE EF     K++ + GF+I
Sbjct: 176 ELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFII 235

Query: 233 YSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTEL 291
           +S+ + V GAG  G IG +YW  PG +       + N  RF G    L++A F+Y G EL
Sbjct: 236 FSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGGMEL 290

Query: 292 VGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQS 351
             ++  E +NPR++ P A  +  +RI++ Y+ ++  +G  VP N  +L GS  GS    S
Sbjct: 291 FALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGS-GGSVTHAS 349

Query: 352 PFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKH 411
           P+++A       V+PHI NAVIL ++IS GNS +Y   R++  L++   APKF     + 
Sbjct: 350 PYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDRE 409

Query: 412 GVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKH 471
           G P  A+++ +VFG + ++  S+  ++VF+WL  I  +A   TW  I ISHIRF Q +K 
Sbjct: 410 GRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKL 469

Query: 472 RGISRDDLPYKAKF 485
           +  S D++ YK+ F
Sbjct: 470 QNKSLDEVGYKSPF 483

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  283 bits (725), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 162/454 (35%), Positives = 249/454 (54%), Gaps = 24/454 (5%)

Query: 31  HVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRHVSMIALG 88
           H  + ++  P + +   NL    ID      F P   GS     +KR+LK RH+ MIA+G
Sbjct: 39  HYEDDQVQ-PNKKAYKRNLFHRCIDS-----FKPPENGSFDPDSLKRSLKSRHLIMIAIG 92

Query: 89  GTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQR 148
           G+IGTGLF+     L   GP+  +I +++ GT        LGE+    PV  +F  +  R
Sbjct: 93  GSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGEITVRFPVVGAFADYGTR 152

Query: 149 FISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFP 208
           F+ P++      +Y   W     LE+      IQ+W  ++    W+AIF+V +V+ N+F 
Sbjct: 153 FLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPVVWVAIFYVTIVAINLFG 212

Query: 209 VKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNV 267
           V+ +GE EF  +SIKVI I GF+I  + ++ G GP    +G RYW  PG   +G      
Sbjct: 213 VRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYVGARYWHDPGALAHG------ 266

Query: 268 NKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFF 327
               F G  S  ++A+++  G+E+  + +GET +P K +P AI +VF+RI+ F++ SL  
Sbjct: 267 ----FKGVASVFVTASYSLGGSEMACLASGET-DP-KELPSAIKQVFWRIIFFFLVSLTL 320

Query: 328 IGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYV 387
           +G LVPY +  L G   GS +  SPF+IA       VLP I NAVIL +I+S GNS ++ 
Sbjct: 321 VGFLVPYTNQNLLG---GSSVNNSPFVIACNLYHIKVLPSIINAVILVSIMSVGNSCIFA 377

Query: 388 GSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNIT 447
            SR L  ++   L P+ F    + G P + ++  ++FG LA+L  S+   EVF+WL+ I 
Sbjct: 378 SSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSSSMSEVFNWLMAIA 437

Query: 448 AIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
            +A  + WL I++SHIRF   +K +  + D+L +
Sbjct: 438 GLATCVVWLSINVSHIRFRMAMKAQDKTLDELEF 471

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  284 bits (726), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 161/467 (34%), Positives = 260/467 (55%), Gaps = 19/467 (4%)

Query: 24  QSARSG-MHVSNS----KIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALK 78
           QS RS  + +S S    +  D  R ++   L    ++D +  +      + +  +K+A+K
Sbjct: 5   QSPRSDDVEISKSNLVHRFVDSFRRAESPELEENDLEDGTRSI------VTKTHLKKAMK 58

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP- 137
            RHV M+++G  IGTGL ++ +  L+ +GP   +I ++L+  + Y + Q+ GEMA   P 
Sbjct: 59  SRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYPT 118

Query: 138 VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIF 197
           +  SF  ++  FIS   G A  ++++  W   F LEL      ++YW D +  + +I IF
Sbjct: 119 LPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFIIIF 178

Query: 198 WVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPG 256
           +  L+  + F VK YGE EF   S KV+ + GF+I S+ + CG AG +G IG +YW  PG
Sbjct: 179 YAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHDPG 238

Query: 257 PWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFR 316
            + +G         RF G    L+SA F+Y G EL  ++  E +NPRK+ P A  +  +R
Sbjct: 239 SFADG-----PPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYR 293

Query: 317 ILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTT 376
           ILI Y+ ++  IG  VP+N  +L G+ + +  A SP+++A       V+PH  NAVIL +
Sbjct: 294 ILIIYLATMILIGFNVPHNSDELMGAGSAATHA-SPYVLAASLHSVKVVPHFINAVILIS 352

Query: 377 IISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDA 436
           +IS  NS +Y   R++  L++   APKF +   + G P   +++ A+FG + +++ S+  
Sbjct: 353 VISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKE 412

Query: 437 QEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           +EVF WL  I  ++   TW  I +SHIRF Q +K  G S D++ +KA
Sbjct: 413 EEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKA 459

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  285 bits (728), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 157/451 (34%), Positives = 257/451 (56%), Gaps = 9/451 (1%)

Query: 36  KIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGS-IGQAEVKRALKPRHVSMIALGGTIGTG 94
           +  D  + ++ +   ++ I++++S + D   S    +++K+++K RHV M++LG  IGTG
Sbjct: 53  RFTDSFKRAEGSTTKIKPINENTSDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTG 112

Query: 95  LFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPA 153
           L ++ +  L   GP   +I ++L+  + Y + Q+ GEMA   P + ++F  +S  FIS  
Sbjct: 113 LLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKP 172

Query: 154 VGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYG 213
            G A  ++Y F W     LEL      IQ+W D +  + +I IF+V L+  + F VK YG
Sbjct: 173 FGFATVWLYCFQWTTVLPLELITASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYG 232

Query: 214 EFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARF 272
           E EF     K++ I GF++ S+ + CG AG +G IG  YW KPG +     A + + ARF
Sbjct: 233 ETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARF 287

Query: 273 LGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLV 332
                 L++A F++ G EL  ++  E  NPRK+ P A  +  +RI++ Y+ ++  IG  V
Sbjct: 288 KNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNV 347

Query: 333 PYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRIL 392
           PYND +L G+  GS    SP+++A       ++PHI NAVIL +++S  NS++Y G R++
Sbjct: 348 PYNDDQLLGA-GGSATHASPYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLI 406

Query: 393 FGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGF 452
             L++   APKF     + G P  A+++  V G +A++  S+  + VF WL  I  ++  
Sbjct: 407 CSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSEL 466

Query: 453 ITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            TW  I +SH+RF Q +K +G S ++L YKA
Sbjct: 467 FTWTSIMLSHLRFRQAMKVQGRSLNELGYKA 497

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  284 bits (726), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 157/441 (35%), Positives = 243/441 (55%), Gaps = 23/441 (5%)

Query: 44  SKDNNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISG 101
            +  N+    ID      F P  +GS   + +KRALK RH+ MIA+G +IGTGLF+    
Sbjct: 52  ERKRNVVQRVIDS-----FKPPVDGSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGK 106

Query: 102 PLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYM 161
            L   GP+  +I + L GT        LGE+   +PV  +F  +S RF+ P+V      +
Sbjct: 107 ALATGGPLALIIGWTLAGTQMIGTIHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSI 166

Query: 162 YWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVAS 221
           Y   W     LE+      +++WT +V    W+A+F+ ++VS N+  V+ +GE EF  +S
Sbjct: 167 YVMQWFFVLPLEIIASCITMRFWTQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSS 226

Query: 222 IKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLI 280
           +KVI I GF+I  + ++ G GP    +G RYW  PGP  NG          F G  + ++
Sbjct: 227 VKVITICGFIILCIVLILGGGPTHQYVGSRYWHDPGPLANG----------FKGVAAVMV 276

Query: 281 SAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLE 340
           +A+++  G+E+  + +GET +P K +P AI ++F+RIL F++ SL  +G LVPY +  L 
Sbjct: 277 TASYSLGGSEMTCLASGET-DP-KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLL 334

Query: 341 GSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNL 400
           G   GS    SPF++A+      V+PHI N VIL +I+S GNS ++  SR L  ++   L
Sbjct: 335 G---GSSAENSPFVLALYLHHVKVVPHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGL 391

Query: 401 APKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISI 460
            P  F    + G P + +L  ++FG LA+L   +    VF WL+ I  +A  + WL I++
Sbjct: 392 IPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINV 451

Query: 461 SHIRFMQTLKHRGISRDDLPY 481
           SH+RF   +K +  S D+L +
Sbjct: 452 SHVRFRLAMKAQNKSLDELQF 472

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  281 bits (719), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/423 (37%), Positives = 248/423 (58%), Gaps = 16/423 (3%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           +  +K+ LK RH+ M+ L G  GTGLF+S  G L   GPVG LIA++ +G +      ++
Sbjct: 45  RTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAI 104

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFAL----ELSIVGQIIQYWT 185
            E+A+F+P T +    +++FI  +VG      + F W  T++     ELS    I++YWT
Sbjct: 105 AEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMKYWT 158

Query: 186 DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCM-VCGAGPE 244
           D  P   +I +F VL V+ N++ +++YGE E+    +K++ I   +I  L + + G   +
Sbjct: 159 DVSP-AVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQ 217

Query: 245 GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRK 304
             +GF YWR PGP+ N ++A ++ K  F+G+ +++ S  ++Y G + + I AGETKN R 
Sbjct: 218 ERLGFHYWRDPGPFANYLVAGHIGK--FVGFWAAISSVVYSYSGIQNIAILAGETKNSRY 275

Query: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPV 364
           A+      VF RI++ Y+ ++F + L+VPYND KL  +  G+    SPF+IA+      V
Sbjct: 276 AIFHGAKNVFLRIIVLYLVTVFVLTLIVPYND-KLIATGTGT-AKSSPFVIAMNRAGIKV 333

Query: 365 LPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVF 424
           LPHI NA+ILT+  SAGN  +  GSR LF L+  N AP+ F KT+K G+P++ V+  + F
Sbjct: 334 LPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSF 393

Query: 425 GFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
             LAY++ S  +  VF W   + +    + W+LIS +HI   + LK +G SR DLP   +
Sbjct: 394 LPLAYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTR 453

Query: 485 FMP 487
             P
Sbjct: 454 IAP 456

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  283 bits (723), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 173/522 (33%), Positives = 266/522 (50%), Gaps = 21/522 (4%)

Query: 27  RSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIA 86
           R  + +  +   D   +   N   ++  +D     +DP     Q  VKRALK RH+S++A
Sbjct: 8   RETVDIEETAKKDIKPYFASNVEAVDIDEDPDVSRYDP-----QTGVKRALKNRHISLLA 62

Query: 87  LGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFS 146
           LGG IG G  +     L   GP+  L+ F +IG +A+SV +S+GEM T  P    FT  +
Sbjct: 63  LGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEMITLYPSGGGFTTLA 122

Query: 147 QRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNM 206
           +RF S A+ A  GY Y   +    A E + +  I+Q+W   VPL  +I IFW     F +
Sbjct: 123 RRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQL 182

Query: 207 FPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAK 265
             V  +GE E+W+A +K++ ++ + I+S+  + G     P  GF YW  PG   +G    
Sbjct: 183 VGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHYWNSPGALSHG---- 238

Query: 266 NVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSL 325
                 F G     +  +  Y GTE V + A E+KNP KAVP A+ +  +RIL+ YIG  
Sbjct: 239 ------FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPLAVRQTLWRILVVYIGIA 292

Query: 326 FFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNV 385
            F G  VP++DP L  S     + +SP  IAI         H+ NA IL T ISA N ++
Sbjct: 293 VFYGATVPFDDPNLSASTK---VLKSPIAIAISRAGWAGGAHLVNAFILITCISAINGSL 349

Query: 386 YVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLN 445
           Y+GSR L  L+   LAPK  + T + GVP  A+ +    G ++ +NVS  A   + +++N
Sbjct: 350 YIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGAANAYSYIVN 409

Query: 446 ITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXX 505
           ++ +  FI W +IS +H+R  +    +G S ++LPY+A F P                  
Sbjct: 410 LSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTPVLSLAANIFLALIQG 469

Query: 506 XXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTL 547
              F P F+  +F  AYI + +  +++ I   ++++  FRT+
Sbjct: 470 WSYFVP-FDAGNFVDAYILLPVGILLY-IGICVFKSNHFRTV 509

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  284 bits (726), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/460 (34%), Positives = 247/460 (53%), Gaps = 20/460 (4%)

Query: 23  SQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHV 82
           S     G++ + + I    RF ++ +   E I++                + + L  RH+
Sbjct: 50  SSKDSPGINQTTNDITSSDRFRRNEDTEQEDINN--------------TNLSKDLSVRHL 95

Query: 83  SMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSF 142
             +A+GG IGTGL+++    L   GP   +I +++I T  ++V  SLGE++   PV   F
Sbjct: 96  LTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGF 155

Query: 143 TVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLV 202
            V+S RFI P+   A    Y   W +   LEL      I+YW D +  +AW+AIF+  + 
Sbjct: 156 NVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIA 215

Query: 203 SFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNG 261
             NM  VK +GE EF ++ IK+++IIGF I  + + CG GP G     +YW  PG +   
Sbjct: 216 LANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF--- 272

Query: 262 IIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFY 321
               + +  +F G  S  ++AAF+Y G E+  ++A E+KNPR+ +P+A  + F+ I   Y
Sbjct: 273 --VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASY 330

Query: 322 IGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAG 381
           +  L  IG LVP NDP+L    +    A SP +IAI N     LP + NA+IL  ++S  
Sbjct: 331 VTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVA 390

Query: 382 NSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFD 441
           NS VY  SR +  ++     PKF ++  K G P  A+L+T  FG L+++  S+   EVF 
Sbjct: 391 NSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFT 450

Query: 442 WLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           WL  ++ ++    W+ I++SHIRF Q +K +  S D+LP+
Sbjct: 451 WLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPF 490

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  284 bits (726), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 160/456 (35%), Positives = 245/456 (53%), Gaps = 13/456 (2%)

Query: 34  NSKIDDPLRFSKDNNLTLEAIDDD--SSRMFDPEGSIGQAEVK-----RALKPRHVSMIA 86
            SK D     S   +  +    +D  SS  F     I Q ++      + L  RH+  +A
Sbjct: 40  KSKTDSTFLLSSKGSPGINQTTNDVTSSDHFRGSEGIEQEDINNTNLSKDLSVRHLLTLA 99

Query: 87  LGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFS 146
           +GG IGTGL+++    L   GP   +I +++I T  ++V  SLGE++   PV   F V+S
Sbjct: 100 VGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYS 159

Query: 147 QRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNM 206
            RF+ P+   A    Y   W +   LEL      I+YW D +  +AW+AIF+  +   NM
Sbjct: 160 MRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANM 219

Query: 207 FPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAK 265
             VK +GE EF ++ IK+++IIGF I  + + CG GP G     +YW  PG +       
Sbjct: 220 LDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF-----VG 274

Query: 266 NVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSL 325
           + +  +F G  S  ++AAF+Y G E+  ++A E+KNPR+ +P+A  + F+ I   Y+  L
Sbjct: 275 HSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVAIL 334

Query: 326 FFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNV 385
             IG LVP NDP+L    +    A SP +IAI N     LP + NA+IL  ++S  NS V
Sbjct: 335 TLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAV 394

Query: 386 YVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLN 445
           Y  SR +  ++     PKF ++  K G P  A+L+T  FG L+++  S+   EVF WL  
Sbjct: 395 YACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSA 454

Query: 446 ITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           ++ ++    W+ I++SHIRF Q +K +  S D+LP+
Sbjct: 455 LSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPF 490

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  283 bits (724), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 162/474 (34%), Positives = 261/474 (55%), Gaps = 15/474 (3%)

Query: 20  LSQSQSARSGMHVSNSKIDD------PLRFSKDNNLTLEAIDD--DSSRMFDPEGSIGQA 71
           ++ S+S+ +G   +N  +++      PL  S D+ +  E I    D + +   E  I   
Sbjct: 15  ITGSKSSEAGNIDANFALEEKDSTLSPLA-SLDSKVPHEKIQTTTDFASVISHEDDINNV 73

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
            + + L  RH+  +A+GG+IG GLF++    L + GP   +I +++I T  ++V  +LGE
Sbjct: 74  NLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGE 133

Query: 132 MATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           MA   PV   F V+  RFI P+VG A    Y   W +   LEL      I+YW + +  +
Sbjct: 134 MAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSD 193

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-R 250
           AW+AIF+ ++   NM  VK +GE EF ++ IK++AIIGF I  + + CG GP G     +
Sbjct: 194 AWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGK 253

Query: 251 YWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAI 310
           YW  PG +    +  N +  +F G  S  ++AAF+Y G E+  ++A E+K+PR  +P+A 
Sbjct: 254 YWNHPGSF----VGHN-SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAA 308

Query: 311 NKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFN 370
            + F+ I   Y+  L  IG LVPY+DP+L    +    A SP +IAI N     LP + N
Sbjct: 309 KRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMN 368

Query: 371 AVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYL 430
           A+IL +IIS  NS VY  SR +  ++     P+  ++    G P  A++ T  FG L+++
Sbjct: 369 AIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFV 428

Query: 431 NVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
             S+   +VF WL  ++ ++    W+ I++SHIRF Q++  +  S D+LP+ ++
Sbjct: 429 AASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQ 482

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  283 bits (723), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 171/459 (37%), Positives = 255/459 (55%), Gaps = 23/459 (5%)

Query: 28  SGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRHVSMI 85
            G+    ++ID   +  K+ N+    ID      F P  +GS     +KR LK RH+ MI
Sbjct: 28  DGIMSKETEIDLDKKEDKNKNIVRRMIDS-----FKPPLDGSYHSDNLKRKLKSRHLIMI 82

Query: 86  ALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVF 145
           A+GG+IGTGLF+     L   GP+  +I + + G+        LGE+    PV  +F  +
Sbjct: 83  AIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVVGAFANY 142

Query: 146 SQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFN 205
           S R + P++      +Y   W     +EL      +Q+WT  V    W+AIF+V++VS N
Sbjct: 143 STRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVN 202

Query: 206 MFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIA 264
           +F VK +GE EF  + +KVI IIGF+I S+ ++CG GP+   IG  YW  PG   NG   
Sbjct: 203 LFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALANG--- 259

Query: 265 KNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGS 324
                  F G  S  ++A+++  G+E+V + + ET +P K +P AI +VF+RI+ F++ S
Sbjct: 260 -------FKGVASVFVTASYSLGGSEMVCLCSAET-DP-KELPHAIKQVFWRIVFFFLVS 310

Query: 325 LFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSN 384
           L  +G LVPY +  L G   GS +  SPF+IAI      VLP I NAVIL +I+S GNS 
Sbjct: 311 LTLVGFLVPYTNENLLG---GSSVNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNSC 367

Query: 385 VYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLL 444
           ++  SR L  ++   L P+ F    + G P + +++ ++FG LA+L  S     VFDWL+
Sbjct: 368 IFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLM 427

Query: 445 NITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            I  +A  + WL I+ISHIRF   +K +  S D+L +K+
Sbjct: 428 AIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKS 466

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  284 bits (727), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 148/421 (35%), Positives = 238/421 (56%), Gaps = 6/421 (1%)

Query: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124
           E ++   ++ + L  RH+  +A+GG IGTGLF++    L   GP   +I ++++ T  ++
Sbjct: 133 EETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFT 192

Query: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184
           V  SLGE+A   PV   F+V+  +F+ P+   A    Y   W +   LEL      I+YW
Sbjct: 193 VINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYW 252

Query: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE 244
             ++  +AW++IF+V +   NM  VK +GE EF ++ +K++AIIGF I  + + CG GP 
Sbjct: 253 NSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPS 312

Query: 245 GP-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPR 303
              IG +YW  PG +         + ++F G  S  ++AAF++ G E+  ++A E++NPR
Sbjct: 313 HEYIGGKYWHDPGAF-----VGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPR 367

Query: 304 KAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTP 363
           + +P+A  + F+ I   Y+  L  +G LVPYNDP+L    +    A SP +IAI N    
Sbjct: 368 ETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIH 427

Query: 364 VLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAV 423
            LP + NA+IL  I+S  NS+VY  SR +  +SK    PK F+K  + G P  A+     
Sbjct: 428 GLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLF 487

Query: 424 FGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           FG L+++  S+   EVF WL  ++ ++    W+ I++ HIRF Q +  + IS D+LP+ +
Sbjct: 488 FGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLS 547

Query: 484 K 484
           +
Sbjct: 548 Q 548

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/449 (35%), Positives = 248/449 (55%), Gaps = 11/449 (2%)

Query: 39  DPLRFSKDNNLTLEAIDDDSSRMFDPEGSIG-QAEVKRALKPRHVSMIALGGTIGTGLFI 97
           D  + ++DN  +   +D D  R  D   S+     +K+A+K RHV M+ LG  IGTGL +
Sbjct: 58  DSFKPAEDNKHS--EVDSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLV 115

Query: 98  SISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGA 156
           + +  L   GP   +I + L+  + Y + Q+ GEMA   P +  +F  ++  F+S   G 
Sbjct: 116 ANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGF 175

Query: 157 ANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFE 216
           A  +++   W     LEL     II+YWT+ V  + ++ IF+V L+  +   VK YGE E
Sbjct: 176 ATVWLFCIQWLTVLPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETE 235

Query: 217 FWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGW 275
           F     K++ I GF+I+S+ + CG AG +G IG +YW  PG +     A+     RF G 
Sbjct: 236 FVFNLCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAFAGTNAAE-----RFKGV 290

Query: 276 VSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYN 335
              L+S  F+Y GTEL  ++  E +NPRK+ P A  +  +RIL+ Y+ ++  IG  VP+N
Sbjct: 291 CYVLVSGYFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFN 350

Query: 336 DPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGL 395
           D +L G+  GS    SP+++A       V+PHI NAVIL  +IS  NS++Y   R+L  L
Sbjct: 351 DDQLMGA-GGSATHASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSL 409

Query: 396 SKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITW 455
           ++   APKF +   + G P  A+L  AVFG +A+   S+  ++VF WL  I  ++   TW
Sbjct: 410 AEQGYAPKFMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTW 469

Query: 456 LLISISHIRFMQTLKHRGISRDDLPYKAK 484
             I +SH+RF Q +K +G   +++ Y A 
Sbjct: 470 SSIMLSHVRFRQAMKLQGRDLNEVGYIAN 498

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  281 bits (718), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 179/571 (31%), Positives = 294/571 (51%), Gaps = 21/571 (3%)

Query: 19  NLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALK 78
            LSQ  S     ++SN +I +   FS  N++     D D     D E      ++ R LK
Sbjct: 6   ELSQQASISLSPYISN-RIKEQ-AFSSVNDVIG---DSDQGSYSDIENFKPPQKIVRGLK 60

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPV 138
            RH+ +IALG  IGTGLFI   G L   GP   LIA+++I    +S+   + EM   IP+
Sbjct: 61  TRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPL 120

Query: 139 TSSFTVFS--QRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAI 196
               +++S  + +++  +    G+  +++ A+    E++    ++QYWTDA     +I+I
Sbjct: 121 PGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWTDANS-AIFISI 179

Query: 197 FWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP--EGPIGFRYWRK 254
           F V+ +   M PVK +GE EFWV+SIK++ I+G +I  + +  G GP  +  +GF YW+ 
Sbjct: 180 FIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKN 239

Query: 255 PGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGT-ELVGITAGETKNPRKAVPRAINKV 313
           PG + N  +A+  N  RFL   +++I + F++    E V   + E   PR+ +P+A  + 
Sbjct: 240 PGAF-NPHLAEG-NTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQRF 297

Query: 314 FFRILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNCRTPVLPHIFNA 371
            +R+ IFYI     +G++V +N+ +L  +     S  A SPF+I I      +LPHI NA
Sbjct: 298 IYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHIINA 357

Query: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
            ILT+  S G   +Y  SR L+ ++    APK F+K  + G P+ +  + ++F FLAYLN
Sbjct: 358 CILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLN 417

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKF-MPXXX 490
            S  A  VF+WL NI  I+GF++W+ +S+++IRF + +    ++ D +P++  F +P   
Sbjct: 418 CSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRPFQVPLAY 476

Query: 491 XXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXX 550
                                ++NVSDFFA+Y+++     ++ +    Y+   FR     
Sbjct: 477 LTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQWTFRDFKEI 536

Query: 551 XXXXXXXXXXXXXWEEEE----PKNLWEKFW 577
                         E  +    P+N  EK W
Sbjct: 537 EVEILPKIDIADEEERNDVIPVPRNFMEKVW 567

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  281 bits (719), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 155/432 (35%), Positives = 244/432 (56%), Gaps = 8/432 (1%)

Query: 54  IDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLI 113
           ++D+ S + +         +K+A+K RHV M+ LG  +GTGL ++ +  L   GP   +I
Sbjct: 47  VEDEKSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVI 106

Query: 114 AFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFAL 172
            ++L+  + Y + Q+ GEMA   P +  SF  ++  FIS  VG A  +++   W     L
Sbjct: 107 GYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPL 166

Query: 173 ELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLI 232
           EL      IQYW D++  + WI IF+V L+  ++F VK YGE EF   + K++ I GF+I
Sbjct: 167 ELITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFII 226

Query: 233 YSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTEL 291
           +S+ +   GAG +G IG +YW+ PG +     A + +  RF      L++A F+Y GTEL
Sbjct: 227 FSIVVNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTEL 281

Query: 292 VGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQS 351
             ++  E  NPR++ P+A  +  +RILI Y+ ++  IG  VP+++ +L G+  GS    S
Sbjct: 282 YVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGA-GGSSTHAS 340

Query: 352 PFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKH 411
           P+++A       V+PHI NAVIL  + S GNS++Y   R+   L++   APK  +   + 
Sbjct: 341 PYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDRE 400

Query: 412 GVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKH 471
           G P IA+   AV G +A+   S+  ++VF WL  I A++   TW  I +SHIRF   +K 
Sbjct: 401 GRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKV 460

Query: 472 RGISRDDLPYKA 483
           +G   ++L YKA
Sbjct: 461 QGKDLNELGYKA 472

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  281 bits (719), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 150/441 (34%), Positives = 242/441 (54%), Gaps = 14/441 (3%)

Query: 47  NNLTLEAIDDDSSRMFDPEGSIGQA-EVKRALKPRHVSMIALGGTIGTGLFISISGPLWN 105
           N+   +   +D   +       G A ++K+++K RH+ MI+LG  IGTGL +     L  
Sbjct: 43  NSFRRKGESEDVKELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAK 102

Query: 106 AGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWF 164
           AGP G +I + +   + Y + Q+ GE+   +  +  ++T +S   + PA+G +  ++Y  
Sbjct: 103 AGPAGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCV 162

Query: 165 SWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKV 224
            W     L+L      ++YWT+A P + ++A+F+V+++  NMF  K Y E EF     KV
Sbjct: 163 QWMTVLPLQLVTAAMTVRYWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKV 221

Query: 225 IAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAA 283
           + I GF+I  + + CG AG  G IG +YW  PG +  G          F G       AA
Sbjct: 222 LMIAGFVILGIAINCGGAGTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAA 271

Query: 284 FTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSD 343
           F+Y G E++ +TA E +NPRK++P A  KV +RIL+ Y+ +   +  LVPYN  +L GS 
Sbjct: 272 FSYGGIEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSS 331

Query: 344 NGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPK 403
             S    SP +IA+ +    ++PHI NAVIL ++IS GNS++Y   R+L  LS+   APK
Sbjct: 332 GESASHASPLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPK 391

Query: 404 FFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHI 463
           F +   + G P I   IT +   +A++  S+  +++F WLL I+ ++    W  I +SH+
Sbjct: 392 FLNYVDRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHV 451

Query: 464 RFMQTLKHRGISRDDLPYKAK 484
           RF   +  +G+S   + YK++
Sbjct: 452 RFRDAMHAQGLSLGQIGYKSQ 472

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  281 bits (720), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 167/466 (35%), Positives = 255/466 (54%), Gaps = 22/466 (4%)

Query: 22  QSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRH 81
           +  S+R      + +  D + ++   ++ L  +D+   R +     +    +++ L  RH
Sbjct: 41  KQMSSRMNRITQSFRRQDAVEYA---DVDLSMMDEQQRRNY----VLANQPLQKTLSQRH 93

Query: 82  VSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSS 141
           + MIA+GGT+GTGLFI I   L ++GP   LI F+++G + + V QS  E+A   PV+ S
Sbjct: 94  LMMIAIGGTLGTGLFIGIGYSL-SSGPGSLLIGFLIVGLMMFCVVQSAAELACQYPVSGS 152

Query: 142 FTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLL 201
           + V   RF+ P++G      Y  +W I+F  EL      +QYW  +V    W+AIF+V +
Sbjct: 153 YAVHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAMTLQYWNKSVNPAVWVAIFYVFI 212

Query: 202 VSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE--GPIGFRYWRKPGPWG 259
           +S NMF V+ YGE EFW++  KV+AI+ F+I  + ++CG GP   G IG +YW  PG + 
Sbjct: 213 MSLNMFGVRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNSTGYIGTKYWHDPGSFA 272

Query: 260 NGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILI 319
                    K  F G  ++ +SAAF++ G ELV +TA E++   ++V RA    F+RI I
Sbjct: 273 ---------KPVFKGLCNTFVSAAFSFGGAELVVLTASESRKV-ESVSRAAKGTFWRIAI 322

Query: 320 FYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAI--LNCRTPVLPHIFNAVILTTI 377
           FYI ++  IG LVPY + +L G DN   I  SPF+IA+           H  N VIL  +
Sbjct: 323 FYITTVIVIGCLVPYTNEQLLGGDNDEDITASPFVIALSGQGSMGTKASHFMNTVILIAV 382

Query: 378 ISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQ 437
           +S  NS VY  SRI+  L      PK      + G P + + I  VFG L +L  S++  
Sbjct: 383 LSVCNSAVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICGVFGLLGFLVASDNEG 442

Query: 438 EVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           +VF WL  + +I+ F TW  I  S +RF   L+ +G S D++ +K+
Sbjct: 443 DVFTWLFALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHKS 488

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  281 bits (719), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 147/416 (35%), Positives = 235/416 (56%), Gaps = 6/416 (1%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           Q ++K+ +K RH++MI+LG  IGTGL ++    L   GP G +I ++   T+ Y V Q+ 
Sbjct: 73  QKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQAC 132

Query: 130 GEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAV 188
            E+  ++  +  ++  +    +      A  ++Y   WAI   LEL      I+YW D++
Sbjct: 133 CELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSI 192

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIG 248
             + ++AIF+  +V  + F  + Y E EF   S KV+ ++GF+I  + + CGA   G IG
Sbjct: 193 NPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKSGYIG 252

Query: 249 FRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPR 308
            +YW  PG +   +  K ++   F G  S  + +AF Y G+E + +TA E  NPRK+VP+
Sbjct: 253 GKYWHTPGAF---VGEKAID--HFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPK 307

Query: 309 AINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHI 368
           A  +  +R+LI ++  +  +G LVPY+ P L GS   +    SPF+IA  +    V+PHI
Sbjct: 308 ATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHI 367

Query: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428
            NAVIL ++IS GNS  Y   RIL  L++  + PK F+   + G P + +L  A+FG ++
Sbjct: 368 INAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLIS 427

Query: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           ++  S++ + VF WL  I +++   TW  IS+SHIRF   +K +G S  +L YKA 
Sbjct: 428 FVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKAN 483

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  281 bits (718), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 162/416 (38%), Positives = 237/416 (56%), Gaps = 13/416 (3%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
            A +KR LK RH+ MIA+GG IGTGLF+     L  AGP G LI + L GT+ Y +  ++
Sbjct: 73  NAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAV 188
           GE+A   P+   FT ++ RF+  + G A   +Y   W +   LE+      + YW T   
Sbjct: 133 GELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDK 192

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVC-GAGPEGPI 247
             + ++A+F+V++V+ N F VK YGE EF  + IKVI +IG++I  + +VC G    G I
Sbjct: 193 YRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYI 252

Query: 248 GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307
           G R W  PG + NG          F G  S  ++AAF++ G+ELVG+ A ET NPRK++P
Sbjct: 253 GGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLP 302

Query: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367
            A  +VF+RI +FYI +L  +GLLVPY   +L G  +    A SPF+I+I N     LP 
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVD-AAASPFVISIQNAGIKGLPS 361

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
           + N VIL  ++S GNS V+  SR +  L+     PK F    + G P + +++T VFG L
Sbjct: 362 VINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLL 421

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           +++  S    EVFDWLL ++ ++   TW  I + HIR  + L  +  +  +L + A
Sbjct: 422 SFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTA 477

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  282 bits (721), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 162/455 (35%), Positives = 255/455 (56%), Gaps = 9/455 (1%)

Query: 33  SNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIG 92
           S  K + P   S D+++     D +     +PE      E+K+ +KPRHV MI+LG  IG
Sbjct: 69  SFKKAEGPQPGSLDHDVLAGDSDIEGKPRTEPEKDDDARELKKTIKPRHVVMISLGTGIG 128

Query: 93  TGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFIS 151
           TG+ +     L N+GP G +I + ++G+  Y + Q+ GE+A  +  +T  F  +    I 
Sbjct: 129 TGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLID 188

Query: 152 PAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFP-VK 210
           PA G A  ++Y   W     LEL      I+YWT  V  + ++ IF+ L++  N+     
Sbjct: 189 PAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAA 248

Query: 211 WYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNK 269
            Y E EF+  S K++ + GF I  + ++CG AG +G IG R W  PG +      K V+ 
Sbjct: 249 GYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSFRGD---KPVD- 304

Query: 270 ARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIG 329
            RF G VS+L++AAF +  +E +G+TA E  NPRKA+P A  K+ +RI+  Y+GS+  +G
Sbjct: 305 -RFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVG 363

Query: 330 LLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGS 389
            LVPY+  +L GS +G+    SP+++AI      V+PH  NAVIL +++S GNS  Y  S
Sbjct: 364 FLVPYDSDQLLGS-SGAATKASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSS 422

Query: 390 RILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAI 449
           R L  LS+   AP F +   ++G P  A  ++A+ G +A+   S    +VF WLL I+ +
Sbjct: 423 RQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGL 482

Query: 450 AGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           +   TW  I +SH+RF + ++ +G S  ++ +K++
Sbjct: 483 SQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQ 517

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  280 bits (717), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 159/449 (35%), Positives = 254/449 (56%), Gaps = 13/449 (2%)

Query: 42  RFSKDNNLTLEAIDDDSSRMFDPEG---SIGQAEVKRALKPRHVSMIALGGTIGTGLFIS 98
           RF +  N    A +       D EG   +  + ++K+ +  RH+ MI+LG  IGTG+ + 
Sbjct: 45  RFQRLTNSFKRAGEHGRGGDVDAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVG 104

Query: 99  ISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAA 157
               L N GP G  I + ++G+  Y + Q+ GEMA ++  ++ +F  +    I PA+G +
Sbjct: 105 NGKALHNGGPAGLAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFS 164

Query: 158 NGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEF 217
             ++Y   W     LEL      I+YWT AV  + ++ IF+VL V  N+F  + Y E EF
Sbjct: 165 VAWVYCLQWLCVLPLELVTATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEF 224

Query: 218 WVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGP-WGNGIIAKNVNKARFLGW 275
           +  + KV+ I GF I  + + CG AG +G +G +YW  PG  +G   I        F G 
Sbjct: 225 FFNTCKVLMITGFFILGIIVNCGGAGNDGYLGGKYWHDPGALYGTKPIH------HFKGI 278

Query: 276 VSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYN 335
           ++++++AAF +  TE + +TA E  NPR+A+P A  K+ +R+L+ ++  +  +G LVPYN
Sbjct: 279 IATMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYN 338

Query: 336 DPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGL 395
             +L GS  GS    SP++IAI +    V+PH  NAVIL +++S GNS  Y  SR+L  L
Sbjct: 339 SDELMGS-GGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSL 397

Query: 396 SKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITW 455
           S+ + AP + +   + G P  A+L++ +FG +A++  S   + VF WLL I+ ++   TW
Sbjct: 398 SEQHYAPSWLNYIDREGRPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTW 457

Query: 456 LLISISHIRFMQTLKHRGISRDDLPYKAK 484
           + I +SHIRF + L  +G S  +L YK++
Sbjct: 458 ICICVSHIRFRKALVVQGKSLGELGYKSQ 486

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  279 bits (714), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 185/568 (32%), Positives = 295/568 (51%), Gaps = 28/568 (4%)

Query: 33  SNSKIDDPL------RFSKDNNLTLEAIDDDSSR--MFDPEGSIGQAEVKRALKPRHVSM 84
           SNS ++ P       R  +    ++ +  D+ S+  + D E    +  + R LK RHV +
Sbjct: 5   SNSTVEVPTLPYVTDRMKEKTQFSIHSTGDEVSQGSVLDIESQ--KPGIVRGLKSRHVQL 62

Query: 85  IALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTV 144
           IALG  IGTGLFI   G L   GP   LIA+ ++    +SV   + EM T IP+    T+
Sbjct: 63  IALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTL 122

Query: 145 FS--QRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLV 202
           +S  + +++  +    G+  +++ A+    E++    ++QYWTDA P   +I+IF VL V
Sbjct: 123 YSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLVQYWTDANP-AIFISIFLVLSV 181

Query: 203 SFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP--EGPIGFRYWRKPGPWGN 260
           +  M PVK +GE EFWV+SIK++ I+G +I  + +  G GP  E  +GF YW+KPG +  
Sbjct: 182 AITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKP 241

Query: 261 GIIAKNVNKARFLGWVSSLISAAFTYQGT-ELVGITAGETKNPRKAVPRAINKVFFRILI 319
            ++     K  FL + +++I + F++    E+V   A E   PR+ +PRA  +  +R+ +
Sbjct: 242 YLVEGGTGK--FLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLAL 299

Query: 320 FYIGSLFFIGLLVPYNDPKL--EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTI 377
           FY+  +  +G++V Y++ +L    +   S  A SPF+I I      VLPHI NA ILT+ 
Sbjct: 300 FYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSA 359

Query: 378 ISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQ 437
            S G   +Y  SR L  ++    AP+  +   K+GVP+    IT++F  LAYLN SN + 
Sbjct: 360 YSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSS 419

Query: 438 EVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFM-PXXXXXXXXX 496
            VF+WL NI  I+GF++W+L+SI++IRF   +    ++ D +P++  +  P         
Sbjct: 420 VVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPFRVPYQKPLAYLAMGFF 478

Query: 497 XXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXXX 556
                          +++ S+FFAAYI++  F +V  +  TIY  +              
Sbjct: 479 SILTLTNGFAVFIKGNWDTSNFFAAYITLG-FVLVLFVGSTIYYKEWRCRDIAEIEQDIL 537

Query: 557 XXXXXXXWEEEE-----PKNLWEKFWAV 579
                   EE E     P+N  EK W V
Sbjct: 538 PKITLAEAEEYEYDIPVPRNWLEKIWMV 565

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  281 bits (718), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 157/432 (36%), Positives = 243/432 (56%), Gaps = 8/432 (1%)

Query: 56  DDSSRMFDPEGSI-GQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIA 114
           DDS    D E +     E K+ +K RHV M++LG  IGTGL +S    L  AGP   +IA
Sbjct: 75  DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134

Query: 115 FMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALE 173
           + L+  + Y + Q+ GEMA   P +  SF  ++  FIS   G A  +++   W     LE
Sbjct: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194

Query: 174 LSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIY 233
           L      I+YW  ++  + ++ IF+V L+  + F V+ YGE EF   + K++ I GF+I+
Sbjct: 195 LITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIF 254

Query: 234 SLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELV 292
           ++ + CG AG +G IG +YW  PG +     A +   +RF G   +L++A F+Y G EL 
Sbjct: 255 AIVVNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELF 309

Query: 293 GITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSP 352
            ++  + KNPRK+ P A     +RI++ Y+ ++  IG +VP+N  +L G+  G+ +  SP
Sbjct: 310 VLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASP 369

Query: 353 FLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHG 412
           +++A       V+PHI NAVIL  +IS  NS++Y G R+L  L++   AP+F S   + G
Sbjct: 370 YVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRG 429

Query: 413 VPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHR 472
            P  A+L++A+ G + +   S   +EVF WL  I+ ++   TW  I  SHIRF + +K +
Sbjct: 430 RPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQ 489

Query: 473 GISRDDLPYKAK 484
             S D L YKA 
Sbjct: 490 NKSLDTLGYKAN 501

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  279 bits (714), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 159/450 (35%), Positives = 245/450 (54%), Gaps = 31/450 (6%)

Query: 39  DPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFIS 98
           D  R  +D +L  +A  +D +           A++K+ +K RH+ MI LG  IGTGL + 
Sbjct: 41  DSFRRGRDVDLMCKADAEDGT----------TAKMKKTIKTRHLLMITLGTGIGTGLLVG 90

Query: 99  ISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAA 157
               L  AGP G ++ +++   + Y + ++ GE+   +  +T ++T +S   + PA+G +
Sbjct: 91  NGSALAKAGPAGLILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFS 150

Query: 158 NGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEF 217
             ++Y   W   F L+L     IIQYWTD  P + ++AI + ++V  N+F  K Y E EF
Sbjct: 151 VSWVYCIQWMTVFPLQLVTAAMIIQYWTDINP-DIFVAIIYAVIVFINLFGAKGYAEAEF 209

Query: 218 WVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWV 276
           +    KV+ IIGF+I  + + CG AG  G IG +YW +P P+ NG          F G  
Sbjct: 210 FFNLCKVLMIIGFVILGVVINCGGAGTSGYIGDKYWHEPRPFMNG----------FKGLC 259

Query: 277 SSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYND 336
                AAF Y G E++ ++A E +NPRK++  A  KV +RI++ Y+ +   +  LVP + 
Sbjct: 260 FVFCYAAFAYGGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADH 319

Query: 337 PKL--EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFG 394
           P L  EGS        SP +IA+      ++PHI NAVIL  ++S GNS++Y   R+L  
Sbjct: 320 PSLASEGSR------ASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLS 373

Query: 395 LSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFIT 454
           L++   APK F+   + G P  A  +  VFG LA+L  S    +VF WLL I+ ++    
Sbjct: 374 LAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFI 433

Query: 455 WLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           W+ I ISHIRF   +K +G S  ++ YKA+
Sbjct: 434 WMSICISHIRFRDAMKAQGRSMGEVGYKAR 463

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  280 bits (715), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 151/414 (36%), Positives = 233/414 (56%), Gaps = 7/414 (1%)

Query: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132
           +KR++KPRHV+M+++   IGTGL ++    L   GP G +I +  +  +AY + Q+ GEM
Sbjct: 83  LKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEM 142

Query: 133 ATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           A   P +  +F  +S + IS   G A  ++Y   W     LEL      I+YW D++  +
Sbjct: 143 AVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINAD 202

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFR 250
            +IAIF+V ++  + F  + YGE EF     KV+ IIGF+I S+ + CG AG    IG +
Sbjct: 203 VFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAK 262

Query: 251 YWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAI 310
           YW  PG +  G  A      +F G    L++  F+Y GTEL  +T  E  NPR+A+    
Sbjct: 263 YWYDPGAFAVGSGA-----TKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSIT 317

Query: 311 NKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFN 370
            +  +RIL+ Y+ ++  IG LVP+   +L GS   S    SP+++A+      ++PHI N
Sbjct: 318 KQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIIN 377

Query: 371 AVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYL 430
           AVIL  +IS GNS +Y G RIL  L++   AP+F +   + G P +A++  +VFG LA++
Sbjct: 378 AVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFV 437

Query: 431 NVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
             S+  ++VF WL  I  ++   TW  I +SH+RF Q +++      +L YKA 
Sbjct: 438 AASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKAN 491

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  278 bits (712), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 243/448 (54%), Gaps = 12/448 (2%)

Query: 38  DDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFI 97
           D   R   D  + LE  D D+        +  Q  +K  +K RH++MI+LG  IGTGL +
Sbjct: 39  DSFKRAQVDTAVDLEGKDADNGL------NKTQQTLKHNIKTRHLTMISLGTGIGTGLLV 92

Query: 98  SISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGA 156
           +    L   GP G +I ++   T+ Y V Q+  E+   +  +  ++  +    +    G 
Sbjct: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152

Query: 157 ANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFE 216
           A   +Y   WA    LEL      ++YWT +V  + ++AIF+V L+  + F  + Y E E
Sbjct: 153 AVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAE 212

Query: 217 FWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWV 276
           F   S+KV+ + GF+I ++ +  GA  +G IG +YW  PG +G      +    RF G  
Sbjct: 213 FIFNSLKVLLMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFGG-----DRAIDRFKGIC 267

Query: 277 SSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYND 336
           S  + AAF Y G+E + +TA E  NPR++VP+A  +  +R+++ ++  +  IG LVP+N 
Sbjct: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNS 327

Query: 337 PKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLS 396
            +L  ++ GS    SPF+IA       V+PHI N +ILT++IS GNS +Y   RIL  L+
Sbjct: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387

Query: 397 KNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWL 456
           ++ + PK F+   + G P + ++  ++FG +A++  SN  + VF WL  I  ++   TW 
Sbjct: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447

Query: 457 LISISHIRFMQTLKHRGISRDDLPYKAK 484
            I++SH+RF + ++ +G S  +L Y+A 
Sbjct: 448 AIAVSHVRFRRAMRVQGRSLGELGYRAN 475

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  277 bits (709), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 174/531 (32%), Positives = 281/531 (52%), Gaps = 24/531 (4%)

Query: 22  QSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAE-VKRALKPR 80
           QS  +R    + N  + DP       N  +  +D  S  + D E      E + R+L PR
Sbjct: 6   QSFDSRDTGLLKNV-VKDPKSAPVVQNYEVTPLDSISDAVTDLEDHDKIRESLNRSLSPR 64

Query: 81  HVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTS 140
           H++MI++ G IGTGL++S +  L   GP    I + ++G + Y     LGEM+TF+P++ 
Sbjct: 65  HINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEMSTFMPISG 124

Query: 141 SFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDA---VPLEAWIAIF 197
           SF  ++++F   +   A    YWF+ A++ A +L+ +  ++ YW  +    P  A   +F
Sbjct: 125 SFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFPYWAASLLF 184

Query: 198 WVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWR-KP 255
           WV L+  N+  V+ YGE E+W+A +KVIAI+ F I ++ +  G  P+   IGF+YW  K 
Sbjct: 185 WVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYIGFKYWSYKE 244

Query: 256 GPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFF 315
            P+ NG          F G+V+  +S+AF+Y GTE + +TAGE +NP +  PR +  VF+
Sbjct: 245 APFVNG----------FKGFVTIFVSSAFSYGGTESITLTAGEARNPIRNTPRIVKTVFW 294

Query: 316 RILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILT 375
           RILIFY+ ++FFI + +PY+ P L        +  SPF I      T       NAVILT
Sbjct: 295 RILIFYVATMFFISMNIPYDYPNLSTKS----VMTSPFTIIFQMAGTKAAGSFMNAVILT 350

Query: 376 TIISAGNSNVYVGSRILFGLSKNNLA-PKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSN 434
           +I+SAGN  ++ GSR+L+ +       PK  +KT ++  P++AV++T   G L +     
Sbjct: 351 SIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGLCFGASFI 410

Query: 435 DAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXX 494
            A  ++ WL NI  ++  + WL I+++ IRF + L  +G ++ +L +K    P       
Sbjct: 411 GAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQFKNWTYPYGPYFLV 469

Query: 495 XXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFR 545
                         F P ++ SDFF+ Y+ +F+F   W I+    R +  +
Sbjct: 470 IFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWWIFKRDRFVK 519

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  280 bits (716), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 158/442 (35%), Positives = 244/442 (55%), Gaps = 11/442 (2%)

Query: 45  KDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLW 104
           +D+ L    ++ DS  +   E     A++K+ +KPRHV M++LG  IGTGL +    PL 
Sbjct: 125 RDDELDYATVNVDSQPV---EQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLA 181

Query: 105 NAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYW 163
            AGP   +I + ++GT  Y + Q+ GE+A  +  V  SF  F    + P    A  ++Y 
Sbjct: 182 QAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYC 241

Query: 164 FSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223
             W     LEL      I+YWT  V  + ++ IF+VL++  N F  K Y E EF+    K
Sbjct: 242 IQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCK 301

Query: 224 VIAIIGFLIYSLCMVCGA-GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISA 282
           V+ +IGF I ++C+  GA G +G IG +YW  PG +            RF G + + ++A
Sbjct: 302 VMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRG-----QTKIERFKGVMDTFVTA 356

Query: 283 AFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS 342
           AF +  TE + +TA E  NPRKA+P A  KV +RIL+ ++ S+  IG LVPYN  +L GS
Sbjct: 357 AFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGS 416

Query: 343 DNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAP 402
            +    + SP+++A       V+ H  NAVIL +++S  NS  Y  SR+L GL++   AP
Sbjct: 417 -SSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAP 475

Query: 403 KFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISH 462
           K+F    ++G P  ++L  A+   +A+   S    +VF WLL I+ ++   TW  I +SH
Sbjct: 476 KWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSH 535

Query: 463 IRFMQTLKHRGISRDDLPYKAK 484
           IRF + ++ +G S  +L ++A+
Sbjct: 536 IRFRRGMQVQGRSLGELGFRAQ 557

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  277 bits (708), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 177/535 (33%), Positives = 294/535 (54%), Gaps = 29/535 (5%)

Query: 20  LSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDD--SSRMFDPEGSIGQAEVKRAL 77
           +S S+S+ SG ++        L      N  +  +D    +   +DPE +I + +++RAL
Sbjct: 1   MSMSESSASG-YIPEEDYYKGLNTPPKKNEVVVELDPSLTTEEDYDPEANI-REDLQRAL 58

Query: 78  KPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP 137
           KPRH++MI++ G IGTGL++S +  L+  GP    + + ++G + Y     LGEM+T++P
Sbjct: 59  KPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMP 118

Query: 138 VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVPLEAWIA- 195
           ++ SF  ++++F S +   A  + YWF+ A++ A +++ +  ++ YW T+A     W A 
Sbjct: 119 ISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASGFPYWAAS 178

Query: 196 -IFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWR 253
            +FW L+V  N+  V++YGE E+W+A +KVIAII F I S+ +  G  P+   IGF+ W 
Sbjct: 179 LLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYIGFKNWN 238

Query: 254 K-PGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINK 312
               P+ +G          F G+ S  +SA+F Y GTE + +T GE  NP +  P+ +  
Sbjct: 239 HGEAPFVDG----------FKGFASLFVSASFAYGGTESITLTNGEAANPLRNTPKIVKT 288

Query: 313 VFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAV 372
           VF+RIL+FY+GS FFI + +PY+ P L+       +  SPF +      T       NAV
Sbjct: 289 VFWRILVFYVGSTFFIAMNIPYDYPGLDTKS----VVTSPFTLVFQMAGTKAAGSFMNAV 344

Query: 373 ILTTIISAGNSNVYVGSRILFGLSKNNLAP-KFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
           I+T++ISA N  ++ GSR+++ +      P K  S+T ++ VP+++VLIT+  G L +  
Sbjct: 345 IMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGLLCFGA 404

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXX 491
               A  V+ WL NI  ++  I WL I I+ IRF + L+ +G +  +L YK    P    
Sbjct: 405 SFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELRYKNWTYPYGPY 463

Query: 492 XXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLF---FIVWAIFQTIYRTKL 543
                            F P ++V++FF+ Y+ +F+F   FI+W +++     KL
Sbjct: 464 FLVIFVTFIILVQGWSAFDP-WDVTNFFSYYLDLFVFPFCFIIWWLYKRDRFVKL 517

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  280 bits (715), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 152/416 (36%), Positives = 239/416 (57%), Gaps = 9/416 (2%)

Query: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
           E+K+ +KPRHV MI+LG  IGTGL + +   L  AGP G +I F ++G+  Y + Q++GE
Sbjct: 157 ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGE 216

Query: 132 MA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPL 190
           +A  +  +   F  +    +  A   A  ++Y   W     LEL      I+YWT  V  
Sbjct: 217 LAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDP 276

Query: 191 EAWIAIFWVLLVSFNMFP-VKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIG 248
           + ++ IF++L++  N+      Y E EF   S K++ +IGF I  + ++CG AG +G IG
Sbjct: 277 DIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIG 336

Query: 249 FRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPR 308
            +YW  PG      +  + +  RF G +++L++AAF +  +E +G+TA E  NPRKA+P 
Sbjct: 337 AKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPS 391

Query: 309 AINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHI 368
           A  K+ +RIL  ++ S+  +G LVPYN  +L GS  GS +  SP+++AI      V+PH 
Sbjct: 392 AAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGS-TGSGVKASPYVLAISTHGVRVVPHF 450

Query: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428
            NAVIL +++S  NS  Y  SR+L  L++   APK +S   + G P + +   A+FG +A
Sbjct: 451 INAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIA 510

Query: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           +   S    EVF WLL I+ ++   TW+ I ISHIRF + +  +G S  +L ++++
Sbjct: 511 FCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQ 566

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  277 bits (709), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 159/469 (33%), Positives = 258/469 (55%), Gaps = 22/469 (4%)

Query: 21  SQSQSARSGM---HVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRAL 77
             S+ +R+G+    V + +  +  R  +DN+L     +D +  M           +K+++
Sbjct: 42  EHSEESRNGLVHRFVDSFRRAESQRLEEDNDL-----EDGTKSM------KSNNHLKKSM 90

Query: 78  KPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP 137
           K RHV M++LG  IGTGL ++ +  L  AGP   +I ++++  + Y + Q+ GEM    P
Sbjct: 91  KSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYP 150

Query: 138 -VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAI 196
            +  +F  ++  FIS + G A  +++   W     LEL      ++YW D +  + +I I
Sbjct: 151 TLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVI 210

Query: 197 FWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKP 255
           F+V L+  + F VK YGE EF   S K++ + GF+I S+ + CG AG +G IG +YWR P
Sbjct: 211 FYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDP 270

Query: 256 GPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFF 315
           G +  G  A      RF G    L+SA F++ G EL  ++  E  NPRK+ P A  +  +
Sbjct: 271 GSFAEGSGA-----TRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVY 325

Query: 316 RILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILT 375
           RILI Y+ ++  IG  VP+N+ +L GS  GS    SP+++A    +  V+PHI NAVIL 
Sbjct: 326 RILIIYLLTMILIGFNVPHNNDQLMGS-GGSATHASPYVLAASIHKVRVIPHIINAVILI 384

Query: 376 TIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSND 435
           ++IS  NS +Y   R++  L++   APKF +   + G P  A+++ ++ G + ++  S  
Sbjct: 385 SVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQ 444

Query: 436 AQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
            ++ F WL  I  ++   TW  I +SHIRF + +K +G S D++ YKA 
Sbjct: 445 EEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKAN 493

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  278 bits (711), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 162/472 (34%), Positives = 267/472 (56%), Gaps = 17/472 (3%)

Query: 20  LSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQ-----AEVK 74
           L Q ++    +H S+     P     D   + + +D+  +   D E  +G+     +++K
Sbjct: 63  LIQEKTQEETIHNSDGSSRSPFGKFVD---SFKRVDEKQTTS-DLESGLGEVPGENSDLK 118

Query: 75  RALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA- 133
           + +K RHV +I+LG  IGTGL +  +  L +AGP G +I + ++G+  Y + Q+ GE+A 
Sbjct: 119 QTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGELAV 178

Query: 134 TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAW 193
            +  + S+F ++    +  A G A  ++Y   W     LEL      I+YWT +V  + +
Sbjct: 179 CYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDIF 238

Query: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYW 252
           ++IF+VL++  N F  + Y E EF+  S KV+ + GF I  + + CG AG  G IG +YW
Sbjct: 239 VSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYIGAKYW 298

Query: 253 RKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINK 312
             PG + NG    N     F G +++  +AAF +  +E + +TA E  NPRKA+P+A   
Sbjct: 299 HSPGAF-NG----NRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAIPKAAKM 353

Query: 313 VFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAV 372
           + +RIL  ++ S+  IG LVPYN P L GS + +  A SP+++A+ +    V+PH  NAV
Sbjct: 354 MIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKA-SPYVVAVASHGVRVVPHFINAV 412

Query: 373 ILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNV 432
           IL +++S GNS  Y  SR+L  L++   APK F+   K G P +A++ + +F  +A+   
Sbjct: 413 ILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAFCAA 472

Query: 433 SNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           S   ++VF WLL I+ ++   TW+ I ISH+RF + LK +G S  ++ +K++
Sbjct: 473 SPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQ 524

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  276 bits (706), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 171/540 (31%), Positives = 286/540 (52%), Gaps = 27/540 (5%)

Query: 21  SQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSR-----MFDPEGSIGQAEVKR 75
           S S +   G   S+ K+       K+N +T    +DD  R     + D + S    +++R
Sbjct: 12  SSSTATPIGQGASDMKV-------KENFVTESIQEDDLERGSIDVLIDEKPS---HQMQR 61

Query: 76  ALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATF 135
            LK RH+ +IALG  IGTGLFI   G L   GP   LI+++++    +++   L EM   
Sbjct: 62  GLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVL 121

Query: 136 IPV--TSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAW 193
            P+   +S    ++ +++  +    G+  +++ A+    E++    +IQYWTDA     +
Sbjct: 122 TPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTDANS-AIF 180

Query: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP--IGFRY 251
           ++IF V+ ++    PVK +GE EFWV+ IK+I I G +I  + +  G GP     +GF Y
Sbjct: 181 VSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHY 240

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY-QGTELVGITAGETKNPRKAVPRAI 310
           W+ PG +   I   N  K  FL   +++I + F +    E +   + E   PR+ +PRA 
Sbjct: 241 WKHPGAFKPHISTGNTGK--FLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAA 298

Query: 311 NKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS--DNGSYIAQSPFLIAILNCRTPVLPHI 368
           N+  +R+++FYIG    +G+ V Y++  L  +     S  A SPF+I I      VLPHI
Sbjct: 299 NRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHI 358

Query: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428
            NA ILT   SAG + +Y  SR+L  ++    APK F++  ++GVP+ ++++ + F FLA
Sbjct: 359 INAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLA 418

Query: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPX 488
           YLN SN A +VF WL NI+ I+GFI+W+ +SI+++RF + + +  ++ D + ++  F   
Sbjct: 419 YLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKPFQRI 477

Query: 489 XXXXXXXXXXXXXXXXXXXXFAP-HFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTL 547
                               F   +++VSDFFA YI++    +++ +    Y+   FR +
Sbjct: 478 FAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKEWRFRDM 537

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  275 bits (704), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 178/538 (33%), Positives = 277/538 (51%), Gaps = 39/538 (7%)

Query: 19  NLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALK 78
           ++S     +       + ++D    S D  L    + +D +++            K+ LK
Sbjct: 2   SISSQDKEKVKATAYEADVEDCDIRSTDETLKQGVLHNDRTKL------------KQGLK 49

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPV 138
            RH+ M+ L G  GTGLF+S  G L   GPVG LIA++ +G +      ++ E+A+F+P 
Sbjct: 50  ERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPA 109

Query: 139 TSSFTVFSQRFISPAVGAANGYMYWFSWAITFAL----ELSIVGQIIQYWTDAVPLEAWI 194
           T +    +++FI  +VG      + F W  T++     ELS    I++YWTD  P   +I
Sbjct: 110 TGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMRYWTDISP-AVFI 162

Query: 195 AIFWVLLVSFNMFPVKWYGEFEF---WVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRY 251
            IF VL V  N++ +++YGE E+   W+  I +  +I  +   +  + G   +  +GF Y
Sbjct: 163 TIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILI--ISGLVIDLGGVKGQERLGFHY 220

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311
           WR PGP+   I+  ++ K  F+G+ S+L S  ++Y G + + I AGETKN R A+     
Sbjct: 221 WRDPGPFAEYIVGGSIGK--FVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAK 278

Query: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNA 371
            VF RI++ Y+ ++F + L+VPYND  L  S  G+    SPF+IA+      VLPHI NA
Sbjct: 279 NVFLRIIVLYLVTVFVLTLIVPYNDA-LIASGTGT-AKSSPFVIAMNRAGIKVLPHIVNA 336

Query: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
           ++LT+  SAGN  +  GSR LF L+  N APK F KT+K G+P++ V+  + F  LAY++
Sbjct: 337 LVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMS 396

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXX 491
            S  +  VF W   + +    + W+LIS +HI   + LK +G SR DLPY     P    
Sbjct: 397 CSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAW 456

Query: 492 XXXXXXXXXXXXXXXXXF-APHFNVSDFFAAYISVFL---FFIVWAIFQTIYRTKLFR 545
                            F   HF++  FF  Y  + L    F  W +F+   +T+  R
Sbjct: 457 FSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFK---KTRYLR 511

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  276 bits (707), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 155/452 (34%), Positives = 244/452 (53%), Gaps = 21/452 (4%)

Query: 34  NSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGT 93
           +S I+D +  +  +++T E I+                 + + L  RH+  +A+GG IG 
Sbjct: 54  DSPIEDNIDITSQSSVTKEDINK---------------SLNKDLSIRHLLTLAVGGAIGV 98

Query: 94  GLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPA 153
           GLF++    L + GP   +I +++I T  ++V  SLGE+A   PV   F V+  RF+ P+
Sbjct: 99  GLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPS 158

Query: 154 VGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYG 213
              A    Y   W +   LEL      I+YW   +  +AW+AIF+ ++   NM  VK +G
Sbjct: 159 FAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFG 218

Query: 214 EFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARF 272
           E EF ++ +K++AIIGF I  + + CG GP+G     +YW  PG +       + +  +F
Sbjct: 219 ETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGHTSGTKF 273

Query: 273 LGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLV 332
            G  S  ++AAF+Y G E+  ++A E+K+PRK +P+A  + F+ I   Y+  L  +G LV
Sbjct: 274 KGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLV 333

Query: 333 PYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRIL 392
           PY+DP+L    +    A SP +IAI N     L  + NA+IL +IIS  NS VY  SR +
Sbjct: 334 PYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCM 393

Query: 393 FGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGF 452
             ++     PK   K  K G P  A L+T  FG L+++  S+   EVF WL  ++ ++  
Sbjct: 394 VSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTI 453

Query: 453 ITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
             W+ I+ISHIRF Q +  +  S D++PY ++
Sbjct: 454 FCWMAINISHIRFRQAMIKQNRSLDEMPYLSQ 485

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  275 bits (704), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 169/517 (32%), Positives = 261/517 (50%), Gaps = 24/517 (4%)

Query: 33  SNSKIDDPLRFSKDNNLTLEAID---DDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGG 89
           +N +  D       + L ++A+D   +     FDP        VKRALK RH+S++ALGG
Sbjct: 11  ANVEKTDKGDAKSPSALIIKAVDISEEPDVSKFDP-----NTGVKRALKNRHISLLALGG 65

Query: 90  TIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRF 149
            IG G  +     L   GP+  L+ F +IG +A++V +S+GE+ T  P    FT  ++RF
Sbjct: 66  VIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEIITLYPSGGGFTTLARRF 125

Query: 150 ISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPV 209
              A+ A  GY Y   +    A E + +  I+Q+W   VPL  +I IFW     F +  V
Sbjct: 126 HGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLIGV 185

Query: 210 KWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGNGIIAKNVN 268
             +GE E+W++  K++ ++ + I+S+  + G   + P  GF YW  PG   +G       
Sbjct: 186 SLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGFHYWNSPGSLSHG------- 238

Query: 269 KARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFI 328
              F G     +  +  Y GTE V + A E+KNP KAVP A+ +  +R+LI YIG   F 
Sbjct: 239 ---FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVRQTLWRVLIVYIGIAVFY 295

Query: 329 GLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVG 388
           G  VP++DP L  +   + + +SP  IAI         H+ NA IL T ISA N ++Y+G
Sbjct: 296 GATVPFDDPNLSAT---TKVLKSPISIAISRAGWAGGAHLVNAFILVTCISAINGSLYIG 352

Query: 389 SRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITA 448
           SR L  L+   LAPK  + T + GVP  A+ +    G ++ +NVS  A + + +++N++ 
Sbjct: 353 SRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGASDAYSYIVNLSG 412

Query: 449 IAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXX 508
           +  FI W +IS +H+R  +    +G S ++LPYKA   P                     
Sbjct: 413 VGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFSLIANVFLALIQGWTS 472

Query: 509 FAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFR 545
           F P F+  +F  AYI +    IV  +   +++   FR
Sbjct: 473 FVP-FDAGNFVDAYI-LLPVAIVLYVAICVFKNHHFR 507

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  277 bits (708), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 159/427 (37%), Positives = 241/427 (56%), Gaps = 6/427 (1%)

Query: 56  DDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAF 115
           D++      E   G  ++ + L  RH+  +A+GG IGTGLF++    L + GP   +I +
Sbjct: 79  DEAGSGVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDW 138

Query: 116 MLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELS 175
           ++I T  ++V  SLGE+A   PV   F V+  RFI P+ G A    Y   W +   LEL 
Sbjct: 139 VIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELV 198

Query: 176 IVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSL 235
                I+YW D +  +AW+AIF+  +   NM  VK +GE EF ++ IK++AI+GF I  +
Sbjct: 199 AASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGI 258

Query: 236 CMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGI 294
            + CG GP+G     +YW  PG +         +  +F G  S  ++AAF+Y G EL  +
Sbjct: 259 VLSCGGGPKGGYIGGKYWHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAV 313

Query: 295 TAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFL 354
           +A E+ NPR+ +P+A  + F+ I + Y+  L  IG LVPYN+PKL    +    A SP +
Sbjct: 314 SAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLV 373

Query: 355 IAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVP 414
           IAI N     LP + NA+IL  I+S  NS VY  SR +  +++    P+F  +  + G P
Sbjct: 374 IAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRP 433

Query: 415 FIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGI 474
             A L+T  FG L+++  S+  +EVF WL  ++ ++    W+ I++SHIRF Q + H+GI
Sbjct: 434 LNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGI 493

Query: 475 SRDDLPY 481
           S D+LPY
Sbjct: 494 SLDELPY 500

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  275 bits (703), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 184/522 (35%), Positives = 291/522 (55%), Gaps = 28/522 (5%)

Query: 26  ARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMF--DPEGSIGQAEVKRALKPRHVS 83
           ++S    +NS  +  +   + ++L  E      + ++  DPE +I + ++ RALKPRH++
Sbjct: 2   SKSISSATNSSEEISISKKQQDHLIYETTSYGVNEVYTIDPEANI-REDLTRALKPRHIN 60

Query: 84  MIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFT 143
           MI++ G IGTGL++S S  L   GP    I + LIG + Y     L EM+T++P++ SF 
Sbjct: 61  MISIAGIIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAEMSTYMPISGSFC 120

Query: 144 VFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVPLEAWIA--IFWVL 200
            ++++F S +   A  + YWF+ A++ A +L+ +  ++ YW TD+     W A  IFW  
Sbjct: 121 TYAKKFGSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHFPYWAASLIFWFF 180

Query: 201 LVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWR-KPGPW 258
           ++S N+  V++YGE E+W+A +KVIAII F I S+ +  G  P+   IGF+ W     P+
Sbjct: 181 VLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYIGFKNWTVGEAPF 240

Query: 259 GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRIL 318
            +G          F G+ S  +SA+F Y GTE + +T+GE+ NP +  P+ +  VF+RIL
Sbjct: 241 VDG----------FKGFASLFVSASFAYGGTESITLTSGESDNPLRNTPKIVKTVFWRIL 290

Query: 319 IFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTII 378
            FYIG+ FFI + VPYN P   G  +GS +  SPF I      T       NAVI+T++I
Sbjct: 291 FFYIGTTFFIAMNVPYNYP---GLSSGS-VVTSPFTIVFKMAGTAGAGSFMNAVIMTSVI 346

Query: 379 SAGNSNVYVGSRILFGLSKNNLAPK-FFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQ 437
           SA N  ++ GSRI++ +      PK   S+T ++ VP++AVLIT   G L +      A 
Sbjct: 347 SACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVGGLCFGASFIGAG 406

Query: 438 EVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXX 497
            ++ WL NI  ++  + WL I+I+ IRF Q L+ +  +  +L +K    P          
Sbjct: 407 TLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQNKTH-ELKFKNWTYPFGPYFLVVAV 465

Query: 498 XXXXXXXXXXXFAPHFNVSDFFAAYISVFLF---FIVWAIFQ 536
                      FAP +NVS+FF+ YI +F+F   FI+W +++
Sbjct: 466 TFIILVQGWSSFAP-WNVSNFFSVYIELFVFPFCFIIWWLYK 506

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  275 bits (704), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/445 (35%), Positives = 244/445 (54%), Gaps = 10/445 (2%)

Query: 44  SKDNNLTLE---AIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISIS 100
           SKD+   +    AID DS    +     G+  + + L  RH+  +A+GG+IGTGLF++  
Sbjct: 47  SKDSGYKISTGSAIDSDSLHGNNVAFEYGE-NLNKDLDIRHLLTLAIGGSIGTGLFVNSG 105

Query: 101 GPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGY 160
             L   GP   +I +++I +  ++V  +LGE+A   P+   F V+  RF+ P+   A   
Sbjct: 106 TSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFAFAVNL 165

Query: 161 MYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVA 220
            Y   W ++  LEL      I+YW   +  +AW+ IF+V +   NM  VK++ E EF ++
Sbjct: 166 NYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFFSEAEFVMS 225

Query: 221 SIKVIAIIGFLIYSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSL 279
            IK++AI+GF I  + + V G    G IG +YW  PG +       +   +RF G  S  
Sbjct: 226 IIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAFHG-----DSAGSRFKGLCSVF 280

Query: 280 ISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL 339
           + AAF+Y G E+  ++A E+KNPRK +P+A  + F+ I   YI  L  IG+LVPYND +L
Sbjct: 281 VIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVPYNDKRL 340

Query: 340 EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNN 399
               +    + SP +IAI N     LP + NA+IL  ++S  NS VYV SR++  ++  N
Sbjct: 341 LSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVSMALTN 400

Query: 400 LAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLIS 459
             PK FSK  K G P  ++  T   G L+++  S+  +EVF WL  I  ++    W+ I+
Sbjct: 401 TLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFCWIGIN 460

Query: 460 ISHIRFMQTLKHRGISRDDLPYKAK 484
           ++HIRF   LK +  S D+L Y ++
Sbjct: 461 LAHIRFRAALKFQNRSLDELAYISQ 485

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  274 bits (701), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 170/504 (33%), Positives = 271/504 (53%), Gaps = 19/504 (3%)

Query: 50  TLEAIDDDSSRMFDPEGSI---GQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNA 106
           T EA   +     +PE  +    +  +K+ LK RH+ M+ L G  GTGLF+S  G L  A
Sbjct: 24  TYEADSVEPQNANEPEEGVLYNDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKA 83

Query: 107 GPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSW 166
           GP G  +A++++G +      ++ E+A+F+P T +    +++FI  +VG      + F W
Sbjct: 84  GPAGMFLAYVVVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG------FTFGW 137

Query: 167 AITFAL----ELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASI 222
             T++     ELS    +++YWTD  P   WI IF +L V  N++ +++YGE E++   +
Sbjct: 138 ISTYSSLMPGELSATAVVMRYWTDINP-AVWITIFGILFVLTNIYTIRFYGEVEYFFGWM 196

Query: 223 KVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISA 282
           K+I II  ++  L +  G   +  +GF YWR+PGP+   I+   + K  F+G+ ++L S 
Sbjct: 197 KIILIIILIVTGLVIDLGGAKQERLGFHYWREPGPFAEYIVKGEIGK--FVGFWAALSSV 254

Query: 283 AFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS 342
            ++Y G + + I AGETKN R A+      VF RI++ Y+ ++  + L+VPYND KL  +
Sbjct: 255 VYSYSGIQNIAILAGETKNSRHAIFHGARNVFLRIIVLYLIAVLVLTLIVPYND-KLIAT 313

Query: 343 DNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAP 402
             G+    SP++IAI      +LPHI NA+ILT+  SAGN  +  GSR LF L+  N AP
Sbjct: 314 GTGT-AKSSPYVIAIQRANIKILPHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAP 372

Query: 403 KFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISH 462
           K F  T K G+P++ +   + F  L+Y++VS+ +  VF W   + +    + W+LIS +H
Sbjct: 373 KIFLTTNKRGIPYVGIAFISAFLPLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANH 432

Query: 463 IRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXF-APHFNVSDFFAA 521
           I   + LK +G SR DLP+     P                     F   HF++  FF  
Sbjct: 433 IHMDRALKAQGYSRSDLPHSTCLGPFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTR 492

Query: 522 YISVFLFFIVWAIFQTIYRTKLFR 545
           Y  + L  I++  ++   +TK  R
Sbjct: 493 YFIIPLAIILFTFWKLFKKTKYLR 516

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  275 bits (703), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/439 (35%), Positives = 249/439 (56%), Gaps = 16/439 (3%)

Query: 50  TLEAIDDDSSRMFDPEGSIGQAEV-KRALKPRHVSMIALGGTIGTGLFISISGPLWNAGP 108
           ++E++ +D        G  G+ EV +++++PRHV MI++   IGTGL +     +  AG 
Sbjct: 20  SVESVAEDVEA---GAGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGI 76

Query: 109 VGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWA 167
            G+LI + +IG +     QS+GE+    P ++  F  + +RFI P++G +  +++   W 
Sbjct: 77  GGTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWM 136

Query: 168 ITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAI 227
           I   LEL      I+YW  ++    ++++F+ L+   N F    Y E EF   S+KV+ I
Sbjct: 137 IVLPLELVTGSMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVI 196

Query: 228 IGFLIYSLCMVCGA-GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY 286
           IGF+I  + +  G  G  G IGFRY   PG +      KN N  +      +L++AAF+ 
Sbjct: 197 IGFIILGVLIDTGCVGTSGTIGFRYLIDPGMFN-----KNYNIIK--ATAGTLVNAAFSC 249

Query: 287 QGTELVGITAGETK--NPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDN 344
            G E + ++A E    N  K++ RA N+V  RI +FY+ S+  +GLLVP+N P L GS +
Sbjct: 250 GGVEFLALSAAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGS 309

Query: 345 GSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKF 404
            + I  SP++ A+      V+PHI NAVIL  +IS  NS +Y  SR L  L++ N APK+
Sbjct: 310 -NMIHSSPYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKY 368

Query: 405 FSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIR 464
           F+K  KHG P   + I+A+FG ++++    D + +F WLL+I+ ++   TW  I I+HIR
Sbjct: 369 FTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIR 428

Query: 465 FMQTLKHRGISRDDLPYKA 483
           F   +K RG S + L YK+
Sbjct: 429 FRDAIKSRGQSLETLGYKS 447

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  275 bits (702), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 177/526 (33%), Positives = 282/526 (53%), Gaps = 33/526 (6%)

Query: 20  LSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKP 79
           +S S S R  + V + K +    +   ++L ++ +  D    FDPE +I + ++ RAL P
Sbjct: 1   MSSSISDREAVKVDSGKQE---IYEVSSSLDIDELRSD----FDPEQNI-REDLTRALSP 52

Query: 80  RHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVT 139
           RH++MI++ G IGTGL++S +  L N GP    + + +IG + Y     LGEM+TF+P++
Sbjct: 53  RHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPIS 112

Query: 140 SSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDA---VPLEAWIAI 196
            SF  ++++F S +   A  + YWF+ A++ A +L+ +  ++ YW  A    P      I
Sbjct: 113 GSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLI 172

Query: 197 FWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYW-RK 254
           FW  ++  N+  V+ YGE E+W+A +KVIAI+ F I S+ +  G  P+   IGF+ W   
Sbjct: 173 FWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHG 232

Query: 255 PGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVF 314
             P+ NG          F G+ S  +SA F Y GTE + +T GE  NP +  P+ +  VF
Sbjct: 233 EAPFVNG----------FKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVF 282

Query: 315 FRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVIL 374
           +RILIFY+ S FFIG+ +PY+ P L        +  SPF +      T       NAVIL
Sbjct: 283 WRILIFYVLSTFFIGMNIPYDYPGLSTKS----VMTSPFTLVFQMAGTRGAGSFMNAVIL 338

Query: 375 TTIISAGNSNVYVGSRILFGLSKNNLAP-KFFSKTTKHGVPFIAVLITAVFGFLAYLNVS 433
           T++ISA N  ++ GSRI++ ++ +   P K   +T ++  P++AVLIT   G L      
Sbjct: 339 TSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASF 398

Query: 434 NDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXX 493
             A  ++ WL NI  ++  I WL I I+ IRF + L+ +G   D L +K    P      
Sbjct: 399 IGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFL 457

Query: 494 XXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLF---FIVWAIFQ 536
                          F P ++V+DFF+ Y+ +F+F   +I+W +++
Sbjct: 458 VIFTVFIILIQGWQAFDP-WSVTDFFSVYLELFVFPFVYIIWWLWK 502

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  276 bits (706), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 149/430 (34%), Positives = 243/430 (56%), Gaps = 8/430 (1%)

Query: 56  DDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAF 115
           DD+         I ++ +K+++K RHV M+ LG  IGTGL ++ +  L  +GP   ++A+
Sbjct: 84  DDNDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAY 143

Query: 116 MLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALEL 174
            L+  + Y + Q+ GEMA   P +  +F  +   F+S   G A  +++   W     LEL
Sbjct: 144 GLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLEL 203

Query: 175 SIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYS 234
                 I+YW D +  + ++ IF+V L+  + F V+ YGE EF   S K++ I GF+I+S
Sbjct: 204 ITSSLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFS 263

Query: 235 LCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVG 293
           + + CG AG +G IG +YW  PG +       + N  RF G    L++A F+Y GTEL  
Sbjct: 264 IVVNCGGAGHDGYIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYV 318

Query: 294 ITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPF 353
           ++  E +NPRK+ P+A  +  +RI++ Y+ ++  IG  VP+++ +L GS +GS    SP+
Sbjct: 319 LSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGS-HGSATHASPY 377

Query: 354 LIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGV 413
           ++A       ++PH  NAVIL ++IS  NS++Y   R+L  L++   APKF +   + G 
Sbjct: 378 VLAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGR 437

Query: 414 PFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRG 473
           P  A+   ++FG + +   SN  ++VF WL  I  ++   TW  I +SH+RF Q +K +G
Sbjct: 438 PLTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQG 497

Query: 474 ISRDDLPYKA 483
              ++L YKA
Sbjct: 498 RDLNELGYKA 507

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  275 bits (703), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 171/461 (37%), Positives = 253/461 (54%), Gaps = 32/461 (6%)

Query: 33  SNSKIDDPLRF---------SKDNNLTLEAIDDDSSRMFDP--EGSIGQAEVKRALKPRH 81
            N  IDD             +++ N+    ID      F P   GS   + +KR+LK RH
Sbjct: 30  DNKNIDDKYEHAESLTDYTKTENRNIFQRVIDS-----FKPPANGSFHTSNLKRSLKSRH 84

Query: 82  VSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSS 141
           + MIA+GG+IGTGLFI     L N GP+  ++ + + G+        LGE+    PV  +
Sbjct: 85  LIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTIHGLGEITVRFPVVGA 144

Query: 142 FTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLL 201
           F  +  RF+ P++      +Y   W     LE+      +QYW D +    ++AIF+  +
Sbjct: 145 FANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWNDTIDPVVFVAIFYCAI 204

Query: 202 VSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYWRKPGPWGN 260
           VS N+F V+ +GE EF  ++IKVI + GF+I  + ++CG GP    IG +YW  PG   N
Sbjct: 205 VSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICGGGPTHEFIGAKYWHDPGCLAN 264

Query: 261 GIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIF 320
           G          F G++S LI+A+++  GTE+  + +GET +P K +P AI +VF+RIL F
Sbjct: 265 G----------FRGFLSVLITASYSLGGTEMTCLASGET-DP-KELPSAIKQVFWRILFF 312

Query: 321 YIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISA 380
           ++ SL  +G LVPY +  L G   GS +  SPF+IAI      VLP I NAVIL +I+S 
Sbjct: 313 FLVSLTLVGFLVPYTNENLLG---GSSVDNSPFVIAIKLHNIKVLPSIVNAVILISILSV 369

Query: 381 GNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVF 440
           GNS ++  SR L  ++   L P +F    + G P   ++I ++FG LA+L  S+   EVF
Sbjct: 370 GNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFLVKSSSVSEVF 429

Query: 441 DWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
           DWL+ I  +A  I WL I+I HIRF   +K +  + D+L +
Sbjct: 430 DWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEF 470

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score =  275 bits (703), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 167/469 (35%), Positives = 253/469 (53%), Gaps = 31/469 (6%)

Query: 24  QSARSGMHVSNSKIDDPLRFSKDNNLTLEAID-----DDSSRMFDPEGSIGQAEVKRALK 78
           Q +R  +H      D    F +      E +D     ++  R ++    +     +++L 
Sbjct: 36  QKSRRQIH------DIAHSFQRQEAPNSEGVDLSLLSEEQRRNYE----LANQPYEKSLS 85

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPV 138
            RH+ MI++GGT+GTGLFI +   L  +GP   LI F+++G + + V QS  EMA   PV
Sbjct: 86  QRHLMMISIGGTLGTGLFIGLGFSL-ASGPGSLLIGFLIVGLMMFCVVQSAAEMACQYPV 144

Query: 139 TSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFW 198
           + SF+    RF+ P++G      Y  +W I+F  EL      ++YW+ +V    W+AIF+
Sbjct: 145 SGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPSELIGCAITLRYWS-SVNGAVWVAIFY 203

Query: 199 VLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE--GPIGFRYWRKPG 256
           V ++  N+F V+ YGE EFW++  KV+AI+ F+I  + ++CG GP   G IG +YW  PG
Sbjct: 204 VFIMQLNLFGVRGYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPHSSGYIGTKYWHNPG 263

Query: 257 PWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFR 316
            +          K  F G  ++ ISAAF++ G ELV +TA E+K   ++V RA    F+R
Sbjct: 264 SFA---------KPVFKGLCNTFISAAFSFGGAELVVLTASESKKV-ESVSRAAKGTFWR 313

Query: 317 ILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAI--LNCRTPVLPHIFNAVIL 374
           I IFYI ++  IG LVPY D +L G D G  I  SPF+IA+         + H  NAVIL
Sbjct: 314 IAIFYITTVVVIGCLVPYTDDRLLGGDTGEDITASPFVIALSGQGSMGTKVSHFMNAVIL 373

Query: 375 TTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSN 434
             ++S  NS VY  SR++  L      P+      K G P + + I  VFG L +L   +
Sbjct: 374 IAVLSVCNSCVYASSRVIQALGACGQLPRACGYIDKKGRPLVGIAICGVFGLLGFLVACD 433

Query: 435 DAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
              +VF WL  + +I+ F TW  I +S +RF   L+ +G S D++ +K+
Sbjct: 434 KQDDVFTWLFALCSISSFFTWFCICVSQVRFRLALRAQGRSTDEIAHKS 482

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  274 bits (700), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 282/499 (56%), Gaps = 29/499 (5%)

Query: 45  KDNNLTLEAIDDD--SSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGP 102
           K+N++  E +D    +   +DPE +I + ++ RALKPR V+MI++ G IGTGL++S S  
Sbjct: 22  KENHVVCE-LDPSFTTDENYDPEANI-REDLTRALKPRVVNMISIAGIIGTGLYLSTSKS 79

Query: 103 LWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMY 162
           L   GP    + + ++G + Y    +LGEM+T++P++ SF V++++F S +   A  + Y
Sbjct: 80  LHTGGPASLFMNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNY 139

Query: 163 WFSWAITFALELSIVGQIIQYWTDA---VPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWV 219
           WF+ A++ A +L+ +  ++ YW  +    P  A   IFW ++V  N+  V++YGE E+W+
Sbjct: 140 WFNDAVSVASDLTALQLVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWL 199

Query: 220 ASIKVIAIIGFLIYSLCMVCGAGPEGP-IGFRYW-RKPGPWGNGIIAKNVNKARFLGWVS 277
           A +K+IAII F I S+ +  G  P+   IGF+ W R   P+ +GI           G+ S
Sbjct: 200 AMLKIIAIIIFFILSIVVNVGKNPQHEYIGFKNWTRGEAPFVDGI----------KGFAS 249

Query: 278 SLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDP 337
             +SA+F Y GTE + +T GE +NP +  P+ +  VF+RILIFY+GS FFI + +PY+ P
Sbjct: 250 LFVSASFAYGGTESITLTNGEAENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYDYP 309

Query: 338 KLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSK 397
            L+       I  SPF +      T       NAVI+T++ISA N  ++ GSRI++ +  
Sbjct: 310 GLDSKS----IVTSPFTLVFQMAGTKGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGL 365

Query: 398 NNLAP-KFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWL 456
               P +  S+T ++ VP+++VLITA  G L +      A  ++ WL NI  ++  I WL
Sbjct: 366 EGFLPARIVSRTNRNKVPYVSVLITAAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWL 425

Query: 457 LISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXXXXXXXXXXXXXXFAPHFNVS 516
            I I+ IRF + L+ +G +  +L YK    P                     FAP +NVS
Sbjct: 426 CIGITSIRFRKGLEKQGKTH-ELIYKNWTYPYGPYFVIIFVSFIILIQGWSAFAP-WNVS 483

Query: 517 DFFAAYISVFLF---FIVW 532
           +FF+ Y+ +F+F   FI+W
Sbjct: 484 NFFSYYLELFVFPVCFIIW 502

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  275 bits (703), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 159/469 (33%), Positives = 258/469 (55%), Gaps = 22/469 (4%)

Query: 21  SQSQSARSGM---HVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRAL 77
             S+ +RSG+    V + +  +  R   DN+L      +D +R            +K+++
Sbjct: 42  EHSEESRSGLVHRFVDSFRRAESQRLEDDNDL------EDGTRSMRSNN-----HLKKSM 90

Query: 78  KPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP 137
           K RHV M++LG  IGTGL ++ +  L  AGP   +I ++L+  + Y + Q+ GEM    P
Sbjct: 91  KSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYP 150

Query: 138 -VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAI 196
            +  +F  ++  F+S + G A  +++   W     LEL      I+YW D +  + +IAI
Sbjct: 151 TLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAI 210

Query: 197 FWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKP 255
           F+V L+  + F VK YGE EF   S K++ I GF+I S+ + CG AG +G IG  YWR P
Sbjct: 211 FYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNP 270

Query: 256 GPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFF 315
           G + +G  A      RF G    L++A F++ G EL  ++  E  NPRK+ P A  +  +
Sbjct: 271 GSFADGSSA-----TRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIY 325

Query: 316 RILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILT 375
           RILI Y+ ++  IG  VP+++ +L GS + +  A SP+++A       V+PHI NAVIL 
Sbjct: 326 RILIIYLLTMILIGFNVPHDNDQLMGSGSSATHA-SPYVLAASIHGVKVIPHIINAVILI 384

Query: 376 TIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSND 435
           ++IS  NS +Y   R++  L++   APKF +   + G P  A+++ +  G + ++  S+ 
Sbjct: 385 SVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQ 444

Query: 436 AQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
            ++ F WL  I  ++   TW  I +SHIRF + +K +G S D++ YK+ 
Sbjct: 445 EEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSN 493

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  276 bits (705), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 151/460 (32%), Positives = 253/460 (55%), Gaps = 16/460 (3%)

Query: 36  KIDDPLRFSKDNNLTLEAIDDD---------SSRMFDPEGSIGQAEVKRALKPRHVSMIA 86
           K  D  R ++D+  T E ++++         S ++   +     A ++++++PRHV M++
Sbjct: 73  KFVDSFRRAEDDEETAEDLENELVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVLMMS 132

Query: 87  LGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVF 145
           LG  IGTGL +     L  AGP   +I + ++G+  Y + Q+ GEMA  +  +  +F  +
Sbjct: 133 LGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNAY 192

Query: 146 SQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFN 205
               +   +     ++Y   W     LEL      I YWT  V  + ++ IF+VL+   N
Sbjct: 193 PSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLITLIN 252

Query: 206 MFPVKWYGEFEFWVASIKVIAIIGFLIYSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIA 264
            F  K Y E EF+  S KV+ + GF I ++ +   GAG +G IG +YW  PG +      
Sbjct: 253 TFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD--- 309

Query: 265 KNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGS 324
           K+++  RF   +S+  +AAF +  +E + I A E  NPR+A+P A   + +RIL  ++ S
Sbjct: 310 KSID--RFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 367

Query: 325 LFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSN 384
           +  +G LVPY+  +L GS   +    SP++IA+ +    V+PH  NAVIL +++S  NS 
Sbjct: 368 ITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVANSA 427

Query: 385 VYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLL 444
            Y   RIL+ L++   APK+F    + G P  A+L+T +FG +A+ + S+  ++VF WLL
Sbjct: 428 YYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLL 487

Query: 445 NITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           +I  ++   TW  I +SHIRF + +K +G S D++ +K++
Sbjct: 488 SIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQ 527

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  273 bits (699), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 176/486 (36%), Positives = 261/486 (53%), Gaps = 30/486 (6%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           +  + R+L PRHV+MIA+ G IGTGL++     L   GP   LI + +IG + Y+   SL
Sbjct: 44  REHLNRSLSPRHVNMIAIAGVIGTGLYLGTGRALHLGGPASLLINYSIIGLIVYATLLSL 103

Query: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAV 188
           GEM+T++P++ SF  F+++F S +   A    YWF+ A++ A +L+ +  ++ YW T   
Sbjct: 104 GEMSTYMPISGSFCSFAKKFGSESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKTSES 163

Query: 189 PLEAWIA--IFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP 246
               WIA  IFWV L+  N+  VK YGE E+W+A +KVIAII F I S+    G   +  
Sbjct: 164 GFPYWIASLIFWVFLLFLNVIHVKIYGEAEYWLAMLKVIAIIIFFILSIVANVGHNEQHE 223

Query: 247 -IGFRYW-RKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRK 304
            IGFR W R   P+ NG          F G+ +  +SA+F Y GTE + +T+GETKNP +
Sbjct: 224 YIGFRNWTRGDAPFVNG----------FRGFATLFVSASFAYGGTESITLTSGETKNPVR 273

Query: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPV 364
             P+ I  VF+RILIFYI ++FFIG+ VPY+ P L        +  SPF I      +  
Sbjct: 274 NTPKVIKTVFWRILIFYIFTVFFIGMNVPYDYPNLSEKS----VMTSPFTIVFQMVGSKA 329

Query: 365 LPHIFNAVILTTIISAGNSNVYVGSRILFGLS-KNNLAPKFFSKTTKHGVPFIAVLITAV 423
                NAVILT+++SA N  ++ GSRILF L  +    PK  ++T  + VP++AVL+T  
Sbjct: 330 AGSFMNAVILTSVVSACNHALFAGSRILFNLGLEGYFFPKLVTRTNWYQVPYVAVLVTWA 389

Query: 424 FGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            G L + +    A  ++ WL N+  ++  I WL I +  IRF      RG+SR    ++ 
Sbjct: 390 VGGLCFGSSFIGAGTLWIWLQNLVGVSNQIAWLSIGVISIRF-----RRGLSRQGKTHEL 444

Query: 484 KFM----PXXXXXXXXXXXXXXXXXXXXXFAPHFNVSDFFAAYISVFLFFIVWAIFQTIY 539
           KF+    P                      +P  +V+ FF+ Y+ +F+F   W ++    
Sbjct: 445 KFVNWTYPYGPYFVIISVSFIILVQGWSSSSP-MDVTSFFSYYVELFIFLACWLVWWAFK 503

Query: 540 RTKLFR 545
           R    R
Sbjct: 504 RDGFVR 509

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  273 bits (699), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 156/443 (35%), Positives = 252/443 (56%), Gaps = 13/443 (2%)

Query: 46  DNNLTLEAIDDDSSRMFDPE-GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLW 104
           D+   +E    +SS + D E  S    ++K+ +K RHV +++LG  IGTGL ++ +  L 
Sbjct: 43  DSFKRVEGEVRNSSDLEDGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLH 102

Query: 105 NAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYW 163
             GP G LI +  +  ++Y + Q+ GEMA   P +  +F  +S  FIS   G A  +++ 
Sbjct: 103 FGGPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFC 162

Query: 164 FSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223
             W     LEL     +++YWT  +  + ++ IF++ ++  +    + YGE EF   S K
Sbjct: 163 IQWTTILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCK 222

Query: 224 VIAIIGFLIYSLCMVCGA-GPEGPIGFRYWRKPGPW--GNGIIAKNVNKARFLGWVSSLI 280
           V+ + GF+I  + + CGA G +G IG +YW +PG +  G+GI        RF G    L+
Sbjct: 223 VLMVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAGSGI-------DRFKGIAYVLV 275

Query: 281 SAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLE 340
           +A F+Y G EL  ++  E  NPRKA+P A  K  +RILI Y+ ++  IG LVP++  KL 
Sbjct: 276 TAYFSYGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLL 335

Query: 341 GSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNL 400
           GS + S +  SP+++A+      ++PHI NAVIL ++IS GNS +Y G R+L  L++   
Sbjct: 336 GSGS-SGVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGY 394

Query: 401 APKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISI 460
           APK      + G P +A++I +VFG +A++  S   +++F WL  I+ ++   TW  I +
Sbjct: 395 APKILDYVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICL 454

Query: 461 SHIRFMQTLKHRGISRDDLPYKA 483
           SH RF + +K +G S + L Y++
Sbjct: 455 SHFRFRRAMKLQGRSLETLGYRS 477

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  274 bits (700), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 159/469 (33%), Positives = 255/469 (54%), Gaps = 22/469 (4%)

Query: 21  SQSQSARSGM---HVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRAL 77
             S+ +R+G+    V + K  +      DN+L      +D +R            +K+++
Sbjct: 42  EHSEESRNGLVHRFVDSFKRAESQHLEDDNDL------EDGTRSMKSNN-----RLKKSM 90

Query: 78  KPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP 137
           K RHV M++LG  IGTGL ++ +  L  AGP   +I ++++  + Y + Q+ GEM    P
Sbjct: 91  KSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYP 150

Query: 138 -VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAI 196
            +  +F  ++  FIS + G A  +++   W     LEL      I+YW D +  + +I I
Sbjct: 151 TLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVI 210

Query: 197 FWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKP 255
           F+V L+  + F VK YGE EF  +S K++ I GF+I S+ + CG AG +G IG +YWR P
Sbjct: 211 FYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDP 270

Query: 256 GPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFF 315
           G +  G  A      RF G    L++A F++ G EL  ++  E  NPRK+ P A  +  +
Sbjct: 271 GSFAEGNGA-----TRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVY 325

Query: 316 RILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILT 375
           RILI Y+ ++  IG  VP+N+ +L GS + +  A SP+++A    +  V+PHI NAVIL 
Sbjct: 326 RILIIYLLTMILIGFNVPHNNDQLMGSGSAATHA-SPYVLAASIHKVRVVPHIINAVILI 384

Query: 376 TIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSND 435
           ++IS  NS +Y   R++  L++   APKF     + G P  A+ +  + G + ++  S  
Sbjct: 385 SVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQ 444

Query: 436 AQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
            ++ F WL  I  ++   TW  I +SHIRF + +K +G S D++ YKA 
Sbjct: 445 EEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKAN 493

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  274 bits (701), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 160/436 (36%), Positives = 245/436 (56%), Gaps = 12/436 (2%)

Query: 55  DDDSSRMF--DPEGSIGQAE--VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVG 110
           DD  + M   +PE  +   E  +K+ +KPRHV MI+LG  IGTGL +     L  AGP G
Sbjct: 88  DDKINEMTTAEPEAEMASVEDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAG 147

Query: 111 SLIAFMLIGTLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAIT 169
            +  + ++GT  Y + QS GEMA  +  +   F  +    + P           F+    
Sbjct: 148 LVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDC 207

Query: 170 FALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIG 229
            +  +       +YWT  V  + ++ IF+VL++  N+F  + Y E EF+    KV+ + G
Sbjct: 208 LSFGIGYCFDDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAG 267

Query: 230 FLIYSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQG 288
           F I  + + V GAG +G +G  YWR PG +      K ++   F G V++L++AAF + G
Sbjct: 268 FFILGIIINVGGAGNDGYLGNIYWRNPGAFRGD---KGID--HFKGVVATLVTAAFAFGG 322

Query: 289 TELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYI 348
           TE + +TA E  NPRKA+P A  KV +RI++ Y+ S+  IG LVP+  P+L GS + +  
Sbjct: 323 TEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAA-T 381

Query: 349 AQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKT 408
           A SP++IA+ +    V+PH  NAVIL +++S GNS  Y  SR+L  LSK   APK+F   
Sbjct: 382 AASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYV 441

Query: 409 TKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQT 468
            + G P  A++++A+FG +A+   S    EVF WLL I+ ++   TW+ I +SHIRF   
Sbjct: 442 DREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAA 501

Query: 469 LKHRGISRDDLPYKAK 484
           +K +G S  ++ +KA+
Sbjct: 502 MKAQGRSMGEVGFKAQ 517

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  273 bits (697), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 152/434 (35%), Positives = 247/434 (56%), Gaps = 12/434 (2%)

Query: 56  DDSSRMFDPE----GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGS 111
           +D+SR  D E     S    ++++ ++ RHV M++LG  IGTGL ++ +  L   GP G 
Sbjct: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101

Query: 112 LIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITF 170
           LI ++L+  ++Y +  + GEMA   P +  +F  +S  FIS   G A  +++   W   F
Sbjct: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVF 161

Query: 171 ALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGF 230
            LEL     +I+YW  +V    ++ IF++ ++  + F  + YGE EF     KV+ I+GF
Sbjct: 162 PLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGF 221

Query: 231 LIYSLCMVCGA-GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGT 289
           +I  + +  GA G  G IG RYWR PG + +G     ++K +   +V  L++A F++ G 
Sbjct: 222 VIVGILINVGAIGDTGYIGDRYWRNPGSFVSG---TPLDKLKGTAYV--LVTAYFSFGGM 276

Query: 290 ELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIA 349
           EL  ++  E  NP+ A+P A  K  +RIL+ Y+ ++  IG LVP++  +L GS +   + 
Sbjct: 277 ELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSND-VH 335

Query: 350 QSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTT 409
            SP+++AI      VLPHI NAVIL ++IS GNS +Y   R+L  L++   APK      
Sbjct: 336 PSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYID 395

Query: 410 KHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTL 469
           + G P I++++ A+FG +A+   S++ +++F WL  I  ++   TW  I +SH RF Q +
Sbjct: 396 REGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAM 455

Query: 470 KHRGISRDDLPYKA 483
           K +G S + L Y+A
Sbjct: 456 KLQGRSLETLGYRA 469

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  272 bits (696), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 177/568 (31%), Positives = 286/568 (50%), Gaps = 24/568 (4%)

Query: 32  VSNSKIDDPLRFSKDN------NLTLEAIDDDSSR--MFDPEGSIGQAEVKRALKPRHVS 83
           +SN ++ D    S+D+      +  + A++ D  R  + D +      EV R LK RHV 
Sbjct: 15  MSNFEMTDASLTSRDHSTNQKKDAIITAVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQ 74

Query: 84  MIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVT--SS 141
            IALGG IGTGLFI     L + GP   LI++ ++    +++   + EM   IP++  SS
Sbjct: 75  FIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESS 134

Query: 142 FTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLL 201
               +  +++       G+  +++ ++    E++    +I+YWTDA     ++ IF +L 
Sbjct: 135 MASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTDA-NAAIFVTIFMILA 193

Query: 202 VSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP--EGPIGFRYWRKPGPWG 259
              ++ PVK +GE EF V+ IK++ I+G ++  + +  G GP     +GF YW  PG + 
Sbjct: 194 TLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAF- 252

Query: 260 NGIIAKNVNKARFLGWVSSLISAAFTYQGT-ELVGITAGETKNPRKAVPRAINKVFFRIL 318
           N  + K    A FL    ++I + F +    E+    + E   PRK +PRA  +  +R+ 
Sbjct: 253 NSYLVKGSTGA-FLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLA 311

Query: 319 IFYIGSLFFIGLLVPYNDPKLEG--SDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTT 376
           +FY+     IG++V Y++  L    S   +  A SPF+I I      +LPHI NA ILT+
Sbjct: 312 VFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTS 371

Query: 377 IISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDA 436
             S   S +Y  SR+L  L+    APKFFSK  K+GVP+ +V  T++FG LAYLN S  +
Sbjct: 372 AYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSS 431

Query: 437 QEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPXXXXXXXXX 496
             VF+WL NI  I+GF+ W+ +SI+++RF +   +  I+ D +PY+ +            
Sbjct: 432 LVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYRRRGQRALAYASAIF 490

Query: 497 XXXXXXXXXXXXF-APHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLXXXXXXXX 555
                       F A ++NVSDFF  Y+++    +++      Y+   FR +        
Sbjct: 491 FALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWTFRDMDVVGREIM 550

Query: 556 XXXXXXXXWEEEE----PKNLWEKFWAV 579
                    E+EE    PKN  E+ W +
Sbjct: 551 PKIDQADQEEKEEYLPPPKNWVERVWRI 578

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  273 bits (697), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 150/429 (34%), Positives = 239/429 (55%), Gaps = 7/429 (1%)

Query: 57  DSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFM 116
           + S M   E  I  + + + L  RH+  +A+GG IGTGLF++    L   GP   +I ++
Sbjct: 74  NDSNMLSKE-DIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWV 132

Query: 117 LIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSI 176
           ++ T  ++V  SLGE+A   PV   F+V+  RFI P++  +    Y   W +   LEL  
Sbjct: 133 IVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVA 192

Query: 177 VGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLC 236
               I+YW D +  +AW++IF+ ++   NM  VK +GE EF ++ IK++AIIGF I  + 
Sbjct: 193 ASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIV 252

Query: 237 MVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGIT 295
           + CG GP G     +YW  PG +       +   ++F G  S  ++AAF+Y G E++ ++
Sbjct: 253 LSCGGGPVGGYIGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVS 307

Query: 296 AGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLI 355
           A E+ +PRK +P A  + F+ I   Y+  L  IG LVPY+DP+L    +   +A SP +I
Sbjct: 308 AAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVI 367

Query: 356 AILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPF 415
           AI N     LP + NA+IL  ++S  NS VY  SR +  ++     PK   +  K G P 
Sbjct: 368 AIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPI 427

Query: 416 IAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGIS 475
            A L+T  FG ++++  S+   EVF WL  ++ ++    W+ I+ISHIRF + +  +G S
Sbjct: 428 NATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRS 487

Query: 476 RDDLPYKAK 484
            +++PY ++
Sbjct: 488 LEEMPYLSQ 496

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  273 bits (697), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 153/418 (36%), Positives = 244/418 (58%), Gaps = 10/418 (2%)

Query: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129
           + ++K+ +  RHV M++LG  IGTG+ +     L N GP G +I + ++G+  Y + Q+ 
Sbjct: 87  ETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAA 146

Query: 130 GEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAV 188
           GE+A ++  ++ +F  +    I  A G +  ++Y   W     LEL      I+YWT +V
Sbjct: 147 GELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSV 206

Query: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPI 247
             + ++AIF+VL++  NMF  + Y E EF+    KV+ IIGF I  + + CG AG +G I
Sbjct: 207 NPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYI 266

Query: 248 GFRYWRKPGP-WGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAV 306
           G RYW  PG  +G   I        F G +S++++AAF +  TE + +TA E  NPR+A+
Sbjct: 267 GGRYWNNPGAFYGTKPIH------HFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAI 320

Query: 307 PRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLP 366
           P A  KV +RIL+ ++  +  IG LVP+N P+L GS + +  A SP++IA+ +    V+P
Sbjct: 321 PSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHA-SPYVIAVASHGVRVVP 379

Query: 367 HIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGF 426
           H  NAVIL +++S GNS  Y  SR+L  L+  + AP +     + G P  A+L++ VFG 
Sbjct: 380 HFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGL 439

Query: 427 LAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           ++++  S   + VF WLL I+ ++   TW+ I +SHIRF + L  +G    +L YK++
Sbjct: 440 ISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQ 497

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  272 bits (695), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 149/423 (35%), Positives = 233/423 (55%), Gaps = 6/423 (1%)

Query: 63  DPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLA 122
           D +  I  + + + L  RH+  +A+GG IGTGLF++    L   GP   +I + ++ T  
Sbjct: 76  DIKEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTAL 135

Query: 123 YSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQ 182
           ++V  SLGE+A   PV   F V+  RF+ P+   +    Y   W +   LEL      I+
Sbjct: 136 FTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIR 195

Query: 183 YWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242
           YW D +  +AW+AIF+ L++  N+  VK +GE EF ++ +K++AIIGF I  + + CG G
Sbjct: 196 YWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGG 255

Query: 243 PEGPIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKN 301
           P+G     +YW  PG +       +    +F G  S  ++AAF+Y G E++ ++A E++N
Sbjct: 256 PKGGYIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQN 310

Query: 302 PRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCR 361
           PRK +P A  + F+ I   YI  L  +G LV YND +L    +   +A SP +IAI N  
Sbjct: 311 PRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGG 370

Query: 362 TPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLIT 421
              LP + NA+IL  I+S  NS VY  SR +  ++     PK  S   K G P  A+  T
Sbjct: 371 IKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTT 430

Query: 422 AVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481
             FG L+++  S+  +EVF WL  ++ ++    W+ I+I+HIRF Q +  +  S D++PY
Sbjct: 431 LFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPY 490

Query: 482 KAK 484
            ++
Sbjct: 491 LSQ 493

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  271 bits (693), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 181/471 (38%), Positives = 265/471 (56%), Gaps = 23/471 (4%)

Query: 17  HSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSI--GQAEVK 74
           +S +SQS ++R G     ++ +   RF KD+    E +D D S     + +I    A +K
Sbjct: 26  NSYVSQSDTSRVG----GTRWE---RF-KDSFREAETVDLDPSLTPAEKMAILTANAPLK 77

Query: 75  RALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMAT 134
           R LK RH+ MI +GG IGTGLF+     L  AGP G LI + L GT+ Y +  ++GE+A 
Sbjct: 78  RTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAV 137

Query: 135 FIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW-TDAVPLEAW 193
             PV   +T ++ RF+  + G A   +Y   W IT  LE+      + YW T A   +A+
Sbjct: 138 TFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAF 197

Query: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVC-GAGPEGPIGFRYW 252
           +A+F+V++V  N+F VK YGE EF  + IKVIA+IGF+I  + +VC G    G IG R W
Sbjct: 198 VALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLW 257

Query: 253 RKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINK 312
             PG + NG          F G  S  ++AAF++ G+ELVG+ A ET NPRK++P A  +
Sbjct: 258 HNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQ 307

Query: 313 VFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAV 372
           VF+RI +FYI +L  +GLLVPY   +L G  +    A SPF+I+I N     LP + N V
Sbjct: 308 VFWRITLFYILALLMVGLLVPYTSDRLIGQSSVD-AAASPFVISIQNAGIKGLPSVINVV 366

Query: 373 ILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNV 432
           IL  ++S GN  V+  SR +  L+     PK F    + G P + +++T VFG L+++  
Sbjct: 367 ILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAA 426

Query: 433 SNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           S    EVFDWLL ++ ++   TW  I + HIR  + L  +  +  +L + A
Sbjct: 427 SPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTA 477

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  271 bits (692), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 150/414 (36%), Positives = 233/414 (56%), Gaps = 15/414 (3%)

Query: 74  KRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA 133
           ++ L  RH+SMIA+GGT+GTGLFI +   L  +GP   LI ++L+GT  + V QS  E+A
Sbjct: 71  QKVLHQRHLSMIAIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLVGTSMFCVIQSAAELA 129

Query: 134 TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAW 193
              PV+ S+     RF+  ++G      Y  +W + F  EL      I YW  ++    W
Sbjct: 130 CQFPVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYWNSSINPAVW 189

Query: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE--GPIGFRY 251
           ++IF V ++  N+F V+ + E EF ++ IKV+AII F+I  + ++ G GP+  G IG +Y
Sbjct: 190 VSIFLVFVLWINLFGVRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPGGYIGTKY 249

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311
           W  PGP+          K  F     + ++AAF++ GTE+V +T  E+KN   ++ RA  
Sbjct: 250 WHDPGPFA---------KPVFKNLCQTFVAAAFSFGGTEMVLLTGTESKNV-SSIARAAK 299

Query: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRT--PVLPHIF 369
             F+RI IFY+ ++  IG LVPYNDP+L  + +   I+ SPF+IA+ N  +    + H  
Sbjct: 300 GTFYRIAIFYVTTVVVIGCLVPYNDPRLLSASSSEDISASPFVIALSNTGSMGAKVSHFM 359

Query: 370 NAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAY 429
           NAVIL  ++S  NS VY  SR++  L      PK F    + G P + + ++A FG L +
Sbjct: 360 NAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSATFGLLGF 419

Query: 430 LNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           L  +    EVF WL  + ++A F+TW  I ++ +R+   ++ R  S D + YK+
Sbjct: 420 LVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKS 473

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score =  271 bits (692), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 167/471 (35%), Positives = 262/471 (55%), Gaps = 21/471 (4%)

Query: 23  SQSARSGMHVSNSKIDDPLRFSKDN--NLTLEA-IDDDSSRMFDPEG---SIGQAEVKRA 76
           + S ++G   S+S+    L   +D+   + L+A ID+D S+    E     + +  +K+A
Sbjct: 15  TDSVKTGSEFSSSEKGTFLYRFRDSFKRVDLDATIDEDDSKYTAEEKVQLRLAKQPLKKA 74

Query: 77  LKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFI 136
           L  RH++MIA+GGT+GTGLFI +   L  +GP   LI F+L+G   + V QS  E++   
Sbjct: 75  LMQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPGCLLIGFILVGLSMFCVVQSAAELSCQY 133

Query: 137 PVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAI 196
           PV+ S+     RFI  ++G      Y  +W I+F  EL     +IQYW D+V    WIAI
Sbjct: 134 PVSGSYATHVTRFIDESIGFTVSTNYALAWLISFPSELMGSAMVIQYWNDSVDPAVWIAI 193

Query: 197 FWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP--EGPIGFRYWRK 254
           F++ ++  N+F V+ + E EFW++ IK++AII F+I  + ++CG GP   G IG +YW  
Sbjct: 194 FYLFVMFLNLFGVEGFAETEFWLSIIKILAIIIFIIIGIVLICGGGPGSSGYIGTKYWHN 253

Query: 255 PGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVF 314
           PG + + +         F    ++ +SAAF++ G ELV +TA E+K    A+ RA    F
Sbjct: 254 PGSFAHPV---------FKSLCNTFVSAAFSFGGAELVLLTAAESKKI-SAISRAAKGTF 303

Query: 315 FRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRT--PVLPHIFNAV 372
           +RI +FYI ++  IG LVPY D +L G+ +   +  SPF+IA+ N  +    + +  N +
Sbjct: 304 WRIAVFYITTVVIIGCLVPYTDERLLGASSDEDVTASPFVIALTNAGSMGSSVANFMNVI 363

Query: 373 ILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNV 432
           IL  +IS  NS VY  SR++  L      P+      K G P + ++I  +FG LA+L  
Sbjct: 364 ILVAVISVCNSCVYASSRVIQALGSAGQLPRICGYIDKKGRPLVGIVICGIFGLLAFLID 423

Query: 433 SNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            ++   VF WL  + +I+ F TW  I  S +R+   LK +  S D++ YK+
Sbjct: 424 CSEEGTVFTWLFALCSISSFFTWFCICFSQVRYRIALKKQNRSNDEIAYKS 474

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  271 bits (692), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 158/451 (35%), Positives = 244/451 (54%), Gaps = 14/451 (3%)

Query: 35  SKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTG 94
           +K  D  R ++D +   +  D   S   D +       +K+A+K RHV M+ LG  IGTG
Sbjct: 46  TKFVDSFRRAEDKHADSDLEDGSKSITSDDD------HMKKAMKSRHVIMMTLGTGIGTG 99

Query: 95  LFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPA 153
           L ++    L  AGP   ++ + L+  + Y + Q+ GEMA   P + +SF  ++  F+S  
Sbjct: 100 LLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKP 159

Query: 154 VGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYG 213
            G A  +++   W     LEL      I+YW D +  + +I IF+V L+  + F VK YG
Sbjct: 160 FGFATVWLFCIQWLTVLPLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYG 219

Query: 214 EFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARF 272
           E EF   S K++ I GF+I S+ + CG AG +G IG +YW  PG +     A     ARF
Sbjct: 220 ETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAF-----ASESPAARF 274

Query: 273 LGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLV 332
            G    L++  F+Y GTEL  ++  E KNPRK+ P A  +  +RILI Y+ ++  IG  V
Sbjct: 275 KGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNV 334

Query: 333 PYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRIL 392
           P++  +L G+  GS    SP+++A       V+PH  NAVIL +++S  NS +Y   R++
Sbjct: 335 PHDSDQLMGA-GGSATHASPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLM 393

Query: 393 FGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGF 452
             L++   APK+F+   + G P  A+ I  +FG + ++  S   ++ F WL  I  ++  
Sbjct: 394 RSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSEL 453

Query: 453 ITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            TW  I ISHIRF   +K +G S ++L Y+A
Sbjct: 454 FTWSSIFISHIRFRMAMKVQGKSLEELGYRA 484

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  271 bits (693), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 159/438 (36%), Positives = 244/438 (55%), Gaps = 12/438 (2%)

Query: 50  TLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPV 109
           T E +  +      P+ S     +K+ +KPRHV MI+L   IGTG+ +     L N GP 
Sbjct: 64  THERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPA 123

Query: 110 GSLIAFMLIGTLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAI 168
             LI + ++ T+ Y V QS  E+A  +  ++  F  +    +  A   +  ++Y   W  
Sbjct: 124 SLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLC 183

Query: 169 TFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAII 228
              LEL      I+YW D++  +A++ IF+V+L+  N      Y E EF+  + KV+ +I
Sbjct: 184 ILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLI 243

Query: 229 GFLIYSLCMVCG-AGPEGPIGFRYWRKPGPW--GNGIIAKNVNKARFLGWVSSLISAAFT 285
           GF I  + + CG AG +G +G  YW  PG +   NGI        RF G V+ L++AAF 
Sbjct: 244 GFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRGNNGI-------NRFKGLVAVLVNAAFA 296

Query: 286 YQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNG 345
           Y G E   +TA E +NP+K++  A  K+ +RI+  Y+ +   +G LVPYN P+L GS + 
Sbjct: 297 YGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSA 356

Query: 346 SYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFF 405
           +  A SPF+IAI +    V+PHI NAVIL +++S  NS +Y  SRIL  LS+   APK F
Sbjct: 357 ATHA-SPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLF 415

Query: 406 SKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRF 465
           +   + G P   +L++ VFG L ++  S   + VF WLL I+ ++   TW  IS+SH+RF
Sbjct: 416 NYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRF 475

Query: 466 MQTLKHRGISRDDLPYKA 483
            +++  +G S D+L Y++
Sbjct: 476 RRSMIVQGRSLDELGYQS 493

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  271 bits (693), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 150/432 (34%), Positives = 235/432 (54%), Gaps = 6/432 (1%)

Query: 54  IDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLI 113
           I+   S  F          + + L  RH+  +A+GG+IG GLF++    L + GP   +I
Sbjct: 73  IETTPSEQFSIAKEDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVI 132

Query: 114 AFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALE 173
            +++I T  ++V  +LGE+A   PV   F V+  RF+ P+V  A    Y   W +   LE
Sbjct: 133 DWVIISTCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLE 192

Query: 174 LSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIY 233
           L      I+YW D +  +AW+AIF+ ++   NM  VK +GE EF ++ +K++AIIGF I 
Sbjct: 193 LVAASITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTIL 252

Query: 234 SLCMVCGAGPEGPIGF-RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELV 292
            + + CG GP+G      YW  PG +       +    +F G  S  ++AAF+Y G EL 
Sbjct: 253 GIVLACGGGPQGGFLGGHYWHDPGSF-----VGDKPGTQFKGLCSVFVTAAFSYSGIELT 307

Query: 293 GITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSP 352
            ++A E+K+PRK +P+A  + F+ +   Y+  L  IG LVP++DP+L    +    A SP
Sbjct: 308 AVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASP 367

Query: 353 FLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHG 412
            +I+I N     L  + NA+IL +I+S  NS VY  SR +  ++     PK  S+  K G
Sbjct: 368 LVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRG 427

Query: 413 VPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHR 472
            P  A+L T  FG L+++  S+   EVF WL  ++ ++    W+ I+ SHIRF   +K +
Sbjct: 428 RPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQ 487

Query: 473 GISRDDLPYKAK 484
             + D+LPY ++
Sbjct: 488 NKTLDELPYLSQ 499

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 150/452 (33%), Positives = 250/452 (55%), Gaps = 17/452 (3%)

Query: 40  PLRFSKDNNLT--LEAIDDDSSRMFDPEGSIG--QAEVKRALKPRHVSMIALGGTIGTGL 95
           P   SKD  ++   E I +DS+     +G  G    ++K+++KP HV MI +   IGTGL
Sbjct: 33  PKLMSKDTLISDSSEDITNDSTTGKTEKGHTGSENEKLKQSIKPYHVFMITMATGIGTGL 92

Query: 96  FISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAV 154
            +     + +AG  G+L+ + +IG++     QS+GE+    P +   F  + +RF+ P+ 
Sbjct: 93  LVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQSVGELVVAFPSLAGGFNSYGKRFVDPSF 152

Query: 155 GAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGE 214
           G    +++   W I   LEL      I+YW +++    ++AIF+ L++  + F  + Y +
Sbjct: 153 GFTVAWLFCLQWQIVLPLELVTASMTIKYWNNSLNPSIFVAIFYSLILGISFFGARGYAD 212

Query: 215 FEFWVASIKVIAIIGFLIYSLCMVCGA-GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFL 273
            EF     KV+ I GF+I  + +  GA G  G IG +Y + PG +          +  F 
Sbjct: 213 AEFLFNLSKVLMITGFIILGIIISFGAAGTSGYIGIKYLKTPGAFNT--------RNTFK 264

Query: 274 GWVSSLISAAFTYQGTELVGITAGETK--NPRKAVPRAINKVFFRILIFYIGSLFFIGLL 331
              S+L++A F+  G E + ++A E    N  K++ RA  +V  R+ +FYI S+F IGLL
Sbjct: 265 SICSTLVNACFSCGGVEFLALSAAEQARGNISKSIKRACGQVLVRMCVFYILSIFVIGLL 324

Query: 332 VPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRI 391
           VPYN P+L GS +   I  SP++IA+ +    V+PH+ NAVIL  ++S  NS +Y  SR 
Sbjct: 325 VPYNSPELMGSSS-EIIHSSPYVIAVASHGVKVVPHLINAVILIAVVSVANSAMYSSSRT 383

Query: 392 LFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAG 451
           L  L++   AP +F+K    G PF  ++++ VFG L+++    D + VF WLL+I+ ++ 
Sbjct: 384 LHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSFIAEYKDQESVFVWLLSISGLST 443

Query: 452 FITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
             TW +I ++H+RF   +K +  S ++L ++A
Sbjct: 444 IFTWTMICVAHLRFRAAMKDQNHSLEELGHRA 475

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  270 bits (691), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 149/431 (34%), Positives = 243/431 (56%), Gaps = 9/431 (2%)

Query: 54  IDDDSSRMFDPEGSIGQAE-VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSL 112
           ++ +   + D   SI   + +K+A+K RHV M++LG  IGTGL ++ +  L+ AGP   +
Sbjct: 57  VNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLV 116

Query: 113 IAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFA 171
           I + ++  + Y V Q+ GEMA   P +   F  ++  F+S   G A  +++   W     
Sbjct: 117 IGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLP 176

Query: 172 LELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFL 231
           LEL      I+YW D +  + ++ I +V L+  + F V+ YGE EF   S K++ I GF+
Sbjct: 177 LELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFV 236

Query: 232 IYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTE 290
           I S+ + CG AG +G IG +YWR PG +     A +   +RF G    L++A F+Y G E
Sbjct: 237 ILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVE 291

Query: 291 LVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQ 350
           L  ++  E +NPR++ P A  +  +RILI Y+ ++  IG  VP+N  +L G+  GS    
Sbjct: 292 LFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGA-GGSATHA 350

Query: 351 SPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTK 410
           SP+++A+      V+PHI NAVIL ++ S  NS +Y   R+L  L++   APK+F+   +
Sbjct: 351 SPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDR 410

Query: 411 HGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLK 470
            G P  A+++ ++FG +A+   S+  + +F WL  I  ++   TW  I +SH+RF   +K
Sbjct: 411 EGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMK 470

Query: 471 HRGISRDDLPY 481
            +G S ++L Y
Sbjct: 471 AQGKSLNELGY 481

>KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  270 bits (689), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 160/476 (33%), Positives = 258/476 (54%), Gaps = 31/476 (6%)

Query: 27  RSGMHVSNSKIDDPLRFSKDNNL------TLEAIDDDSSRMFDPE--GSIGQAE------ 72
           +    + N  +   +   KD +L      + + +D D ++ FD E   S+ + +      
Sbjct: 6   KENSSLRNDSVSTSISSIKDTSLLRNFKNSFKRVDQDQNK-FDDEKYNSVDEGQKRLVDQ 64

Query: 73  -VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131
            +++ L+ RH++MIA+GGT+GTGLFI +   L  +GP   LI ++++G   + V QS  E
Sbjct: 65  PLRKTLQQRHLTMIAIGGTLGTGLFIGLGESL-ASGPGSLLIGYIIVGIAVFCVVQSAAE 123

Query: 132 MATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191
           ++   PV+ S+     RF++ + G      Y  +W + F  EL     +I+YW D+V   
Sbjct: 124 LSCQYPVSGSYATLVTRFMNESFGFTVATNYCLAWLVCFPSELVGSAMVIRYWNDSVNSC 183

Query: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE--GPIGF 249
            WIAIFWV ++  N+F V+ Y E EFW++ IK+IAII F+I  + ++CG GP   G IG 
Sbjct: 184 VWIAIFWVFVMCLNLFGVEGYAETEFWLSIIKIIAIIIFIIIGIVLICGGGPNSTGYIGT 243

Query: 250 RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRA 309
           +YW  PG + + +         F    ++ +SAA+++ G E+V +T+ E++    ++ RA
Sbjct: 244 KYWHDPGSFAHPV---------FKSLCNTFVSAAYSFGGCEIVVLTSAESRKI-SSIARA 293

Query: 310 INKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRT--PVLPH 367
               F+RI IFY+ ++  IG LVPY D KL  + +   +  SPF+IA+ NC      + H
Sbjct: 294 AKGTFWRITIFYLVTIVIIGCLVPYTDNKLISATSSEDVTASPFVIALSNCGAMGTRVSH 353

Query: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427
             N VIL + IS  NS VY  SRI+  L   N  P       + G P + + I  +FG L
Sbjct: 354 FMNTVILVSTISVSNSCVYASSRIIQALGAMNQLPSICGYIDRRGRPLVGIAICGLFGLL 413

Query: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            +L  + +   +F WL ++T++A F+TW  I    +RF   LK +G S D++ YK+
Sbjct: 414 GFLVAAENEAAIFTWLYSLTSVAYFVTWFSICWCQVRFRMALKRQGRSNDEIAYKS 469

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  270 bits (691), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 145/468 (30%), Positives = 252/468 (53%), Gaps = 14/468 (2%)

Query: 20  LSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPE-GSIGQAEVKRALK 78
           +++ Q   S   V   K  +  +   +    L +         + E  S  +  + +++K
Sbjct: 36  ITEKQDEESEQQVKPQKTGNKSKLQNECKKILSSFKRQLPPSQNSELESQEKNNLTKSIK 95

Query: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIP 137
            RH+ MI+LG  IGTGL +     L  AGP G ++ + +   + Y + Q+ GE+   +  
Sbjct: 96  SRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQAAGELGLCYAG 155

Query: 138 VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIF 197
           +T ++T +    + P++G A   +Y   W     L+L      ++YWT +V  + ++A+ 
Sbjct: 156 LTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-SVNSDIFVAVV 214

Query: 198 WVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPG 256
           ++ ++  N+F  + Y E EF     K++ +IGF+I ++ + CG AG    IG  YW  PG
Sbjct: 215 FIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKYIGTEYWHNPG 274

Query: 257 PWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFR 316
           P+ +G          F G  +    AAF+Y G E++ ++A E +NP K++P A  KV +R
Sbjct: 275 PFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYR 324

Query: 317 ILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTT 376
           IL+ Y+ +   +  LVPYN  +L GSD+ S    SPF+IA+ +    V+PH  NAVIL +
Sbjct: 325 ILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVPHFINAVILIS 384

Query: 377 IISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDA 436
           +IS  NS++Y G R+L  L++  + PK  +   + G P +  L++  FG + ++  S+  
Sbjct: 385 VISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIGFVATSDAE 444

Query: 437 QEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           +EVF WLL I++++    W+ +S+SHIRF   +  +G S +++ YKA+
Sbjct: 445 EEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQ 492

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  270 bits (689), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 157/466 (33%), Positives = 256/466 (54%), Gaps = 16/466 (3%)

Query: 21  SQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPR 80
             S+ +R+G+     +  D  R ++   L      +D +R   P  S     +K+++K R
Sbjct: 42  EHSEESRNGLV---HRFVDSFRRAESQCLEENNDLEDGTR---PMKS--NNHLKKSMKSR 93

Query: 81  HVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVT 139
           HV M++LG  IGTGL ++ +  L  AGP   +I ++L+  + Y + Q+ GEM   +  + 
Sbjct: 94  HVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLP 153

Query: 140 SSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWV 199
            +F  ++  FIS + G A  +++   W     LEL      I+YW D++  + +I IF+V
Sbjct: 154 GNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDSINADVFIVIFYV 213

Query: 200 LLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPW 258
            L+  + F VK YGE EF   S K++ + GF+I S+ + CG AG +G IG +YWR PG +
Sbjct: 214 FLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSF 273

Query: 259 GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRIL 318
            +G      N  RF G    L++A F++ G EL  ++  E  N RK+ P A  +  +RIL
Sbjct: 274 ADG-----SNATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRIL 328

Query: 319 IFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTII 378
           I Y+ ++  IG  VP+N+ +L GS + +  A SP+++A    +  V+PHI NAVIL ++I
Sbjct: 329 IIYLLTMILIGFNVPHNNDQLMGSGSAATHA-SPYVLAASIHKVRVIPHIINAVILISVI 387

Query: 379 SAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQE 438
           S  NS +Y   R++  L++   AP+F +   + G P  A+ + A+ G + ++  S   ++
Sbjct: 388 SVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQ 447

Query: 439 VFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
            F WL  I  ++   TW  I +SHIRF + +K +G S  +L YKA 
Sbjct: 448 AFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKAN 493

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  270 bits (689), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 161/415 (38%), Positives = 239/415 (57%), Gaps = 17/415 (4%)

Query: 74  KRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA 133
           K++L  RH++MIA+GGT+GTGLFI +   L  +GP   LI F+++GT  + V QS  E++
Sbjct: 91  KKSLHQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPASLLIGFLIVGTSMFCVVQSAAELS 149

Query: 134 TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAW 193
              PV+ S+     RF+  ++G      Y  +W I+F  EL  +   I YW D++    W
Sbjct: 150 CQYPVSGSYATHVSRFLDESLGFTVSTNYALAWLISFPSELIGISMTISYWNDSINPCVW 209

Query: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE--GPIGFRY 251
           IAIF+V ++  N+F VK + E EFW++ IKVIAII F+I  + ++CG GPE  G IG +Y
Sbjct: 210 IAIFYVFIMILNLFGVKGFAETEFWLSLIKVIAIIIFIIVGIVLICGGGPESSGYIGTKY 269

Query: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311
           W  PG +   +         F G  ++ +SAAF++ G+ELV +TA E+KN   A+ RA  
Sbjct: 270 WHDPGSFAPPV---------FKGLCNTFVSAAFSFGGSELVLLTAAESKNI-SAISRAAK 319

Query: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPV---LPHI 368
             F+RI +FYI ++  IG LVPYND +L G  +   ++ SPF++A L   T +   L + 
Sbjct: 320 GTFWRIAVFYIATVVIIGCLVPYNDRRLLGGASDEDVSASPFVLA-LGSSTDLGRKLSNF 378

Query: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428
            N VIL  ++S  NS VY  SR++  L  +   P       K G P + + I  VFG L 
Sbjct: 379 MNFVILIAVVSVANSCVYASSRVIQALGSSGQLPSICGYIDKSGRPLVGIAICGVFGLLG 438

Query: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           +L  S++ + VF WL  + +I+ F TW  I  S +RF   LK +  S DD+ +K+
Sbjct: 439 FLVASSNERTVFTWLFALCSISSFFTWFCICFSQVRFRLALKKQNRSTDDIAFKS 493

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  269 bits (687), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 163/472 (34%), Positives = 255/472 (54%), Gaps = 18/472 (3%)

Query: 18  SNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTL-EAID-DDSSRMFDPEGSIGQAEVKR 75
             LS S S   G + S  + D    F + + L + +A++ +D +     +  +     K+
Sbjct: 14  DTLSVSASKEHGAYSSAVR-DWRDSFKRQDLLEMPDALEYNDLTEREKTQLKLASQPYKK 72

Query: 76  ALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATF 135
            L  RH++MI++GGT+GTGLFI +   L  +GP   LI ++L+G   + V QS  E+A  
Sbjct: 73  VLSQRHLTMISIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLVGASMFCVIQSASELACQ 131

Query: 136 IPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIA 195
            PVT S++    RF+  +VG   G  Y  +W + F  EL      I YW   +    W+A
Sbjct: 132 FPVTGSYSSHVTRFVDESVGFTVGTNYTLAWLVLFPSELIGCSLTISYWNSTINPAVWVA 191

Query: 196 IFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE--GPIGFRYWR 253
           IF V ++  N+F V+ + E EF ++ IKV+AI+ F+I  + ++ G G +  G IG RYW 
Sbjct: 192 IFLVFVLWINLFGVRLFAETEFVLSIIKVLAIVIFIIIGIVLIAGGGQDSGGYIGTRYWH 251

Query: 254 KPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKV 313
            PGP+          K  F    ++ +SAAF+Y G+E+V +T  E+KN   ++ RA    
Sbjct: 252 DPGPFA---------KPVFKNLCNTFVSAAFSYGGSEMVLLTGTESKNI-SSIARAAKGT 301

Query: 314 FFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRT--PVLPHIFNA 371
           F+RI IFYI ++  IG LVPYNDP+L  + +   I+ SPF+IA+ N  +    + +  NA
Sbjct: 302 FYRIAIFYITTVVVIGCLVPYNDPRLLNASSSEDISASPFVIALGNTGSMGSKVSNFMNA 361

Query: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431
           +IL +++S  NS VY  SR++  L      P         G P + + IT  FG L +L 
Sbjct: 362 IILVSVVSVCNSTVYASSRLIQALGAAGHLPGICGYMDMKGRPLVGIAITGAFGLLGFLV 421

Query: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
            +N   EVF WL  + +IA F+TW  I ++ +RF   +K R  S++ + Y++
Sbjct: 422 ATNKQSEVFTWLFALCSIASFVTWFCICLAQVRFRLAMKARKRSKEHIAYRS 473

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  270 bits (689), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 156/451 (34%), Positives = 249/451 (55%), Gaps = 14/451 (3%)

Query: 36  KIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGL 95
           K  D +  +   N  LE    + S+   PE     A +KR +KPRHV M++L   IGTGL
Sbjct: 71  KRADHINTNIHGNAELEL---NPSQSLLPEKG---ASLKRDIKPRHVVMMSLATGIGTGL 124

Query: 96  FISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAV 154
            +     L   GP G  I + ++G+  YS+ Q+ GE+A   P +T +F  +    + PA+
Sbjct: 125 LVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAM 184

Query: 155 GAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGE 214
             A   +Y   W   F LE+      I+YW  ++    W  IF+V+++  NM     Y E
Sbjct: 185 CFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIFYVMIIGINMCGSAGYAE 244

Query: 215 FEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFL 273
            +F+  + K++   GF I  + + CG AG    IG +YW  PG + NG    +   +RF 
Sbjct: 245 ADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAF-NG----DTGISRFK 299

Query: 274 GWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVP 333
             VS+L++AAF +  +E V +TA E  NPRKA+P A  +V +RI+  Y+ S+  +G LVP
Sbjct: 300 AIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLASIILVGFLVP 359

Query: 334 YNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILF 393
           YN P+L GS + S +  SP++IA+ +    V+P   NAVIL +++S GN + Y  SRIL 
Sbjct: 360 YNSPELMGSGS-SSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVGNFSFYSSSRILL 418

Query: 394 GLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFI 453
            LS+   APKFF    + G P  A+++ A+ G + +++ S+  + VF WL+ ++ ++   
Sbjct: 419 CLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLMAVSGLSQLF 478

Query: 454 TWLLISISHIRFMQTLKHRGISRDDLPYKAK 484
           TW  I ISH+RF + ++ +  S  +L ++++
Sbjct: 479 TWTNICISHVRFRKAMQVQNRSIGELGFRSQ 509

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  270 bits (690), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 159/455 (34%), Positives = 247/455 (54%), Gaps = 18/455 (3%)

Query: 34  NSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAE---VKRALKPRHVSMIALGGT 90
           NS   DP   +   N  + A++DD   + D   SI  +E    K  +K RHV M+ L   
Sbjct: 118 NSNEVDP---NNKKNENIYALNDD---LEDGTTSIAASEDMPKKGGMKARHVIMMTLATG 171

Query: 91  IGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRF 149
           IGTGL ++ +  L  +GP G ++ + ++  + Y V Q+ GEMA   P +   F  +   F
Sbjct: 172 IGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLF 231

Query: 150 ISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPV 209
           IS   G A  +++  +W     LEL      ++YWT ++  + ++ IF++ L+  +   +
Sbjct: 232 ISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGL 291

Query: 210 KWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVN 268
           + Y E EF+  S K++ I GF+I+S+ + CG AG +G IG +YW  PGP+     A +  
Sbjct: 292 RLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPF-----ASDNG 346

Query: 269 KARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFI 328
            ARF      LI+A F+Y GTEL  ++  E +NPRKAVP A     +R+ I Y+ ++  I
Sbjct: 347 AARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILI 406

Query: 329 GLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVG 388
           G  VPYN P L G+ N      SP+++A       ++PH  NAVIL ++IS  NS ++ G
Sbjct: 407 GFNVPYNSPDLMGNANSK--DASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAG 464

Query: 389 SRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITA 448
            R+L  L++   APKF +   + G P +A+ + ++FG +A+   S    EVF WL  I  
Sbjct: 465 PRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAG 524

Query: 449 IAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483
           ++    W  I +SHIRF   +K+ G S D++ YKA
Sbjct: 525 LSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKA 559

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  267 bits (682), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 145/434 (33%), Positives = 238/434 (54%), Gaps = 13/434 (2%)

Query: 55  DDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIA 114
           D   +     EGS   A +++++KPRHV MI++   IGTGL +     +  AG  G+LI 
Sbjct: 8   DCSDAEKLSSEGS-EPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIG 66

Query: 115 FMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALE 173
           +++IG +     QS+GE+    P +   F  + ++FI P++G    +++   W +   LE
Sbjct: 67  YLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLE 126

Query: 174 LSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIY 233
           L      I+YW   +    +++ F++L+   N F    Y E EF    +KV+ +  F++ 
Sbjct: 127 LVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVL 186

Query: 234 SLCMVCGA-GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELV 292
            + ++ G  G  GPIGF+Y + PG       A N N   F     +L++AAF+  G E +
Sbjct: 187 GIVIITGGLGNSGPIGFQYLKTPG-------AFNTNYNVFKATAGTLVNAAFSCGGVEFL 239

Query: 293 GITAGETK--NPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQ 350
            ++A E    N  K++ RA  +V  R+ +FY+ S+  +GLLVPY+ P L GS + +    
Sbjct: 240 ALSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDT-THT 298

Query: 351 SPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTK 410
           SP++ AI      ++PHI NAVIL  ++S  NS +Y  SR L  L++ N AP++F+   K
Sbjct: 299 SPYVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNK 358

Query: 411 HGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLK 470
           HG P   ++++A+ G ++++    D + VF WLL+I+ ++   TW  I I+HIRF   LK
Sbjct: 359 HGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALK 418

Query: 471 HRGISRDDLPYKAK 484
            +G S D L Y++ 
Sbjct: 419 LQGQSLDTLGYRSN 432

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,605,893
Number of extensions: 2153240
Number of successful extensions: 8490
Number of sequences better than 10.0: 393
Number of HSP's gapped: 7279
Number of HSP's successfully gapped: 416
Length of query: 581
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 466
Effective length of database: 40,294,809
Effective search space: 18777380994
Effective search space used: 18777380994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)