Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C02277g1.80ON46546522360.0
Ecym_10841.80ON49548413810.0
SAKL0C02574g1.80ON47344713460.0
Kwal_33.133861.80ON46943713231e-180
KLTH0F02332g1.80ON46945212411e-168
AFR671W1.80ON48844111641e-156
TDEL0C062101.80ON47946411101e-148
Suva_5.31.80ON48346710961e-145
YEL064C (AVT2)1.80ON48046410691e-141
Skud_5.251.80ON48345510381e-137
Smik_5.231.80ON48346210081e-132
ZYRO0F16720g1.80ON49241310031e-131
NCAS0J018401.80ON4454219951e-131
NDAI0I001301.80ON4444269251e-120
KNAG0C007801.80ON5134828761e-112
KAFR0L019107.420ON4453432014e-16
Kwal_27.107027.420ON4674171999e-16
ZYRO0B04026g7.420ON4363311901e-14
Kpol_1045.207.420ON4664571901e-14
TBLA0F01390singletonON4282921891e-14
CAGL0H04587g7.420ON4453341837e-14
KNAG0B021907.420ON4613571802e-13
Suva_5.2407.420ON4484401783e-13
KLTH0C06006g7.420ON4453031774e-13
YER119C (AVT6)7.420ON4484361694e-12
NDAI0E040107.420ON4713551686e-12
Kpol_505.52.177ON6874401688e-12
TPHA0K006707.420ON4644311651e-11
SAKL0F13134g7.420ON5103371633e-11
CAGL0G03619g7.420ON4602941614e-11
Smik_5.2647.420ON4483091596e-11
Skud_5.2607.420ON4483211597e-11
Skud_2.197.420ON4594511562e-10
TDEL0C028207.420ON4543391562e-10
Ecym_71337.420ON4573431534e-10
Smik_2.317.420ON4594531509e-10
Suva_2.287.420ON4593121509e-10
YBL089W (AVT5)7.420ON4594261501e-09
KLLA0E06931g7.420ON4563521472e-09
AGL285C7.420ON4402891445e-09
KLLA0C13277g2.177ON7214721367e-08
TDEL0F013202.177ON7152091358e-08
Kwal_26.84012.177ON7204751312e-07
CAGL0M06611g2.295ON4851401284e-07
TBLA0F014007.420ON4534321277e-07
AER380C2.177ON7164841279e-07
TPHA0C034602.295ON4731191232e-06
KLTH0D09042g2.177ON7184881223e-06
NCAS0G026302.177ON7052071214e-06
TDEL0G022502.295ON4671351204e-06
Kpol_1003.442.295ON4702391152e-05
NCAS0E024407.420ON4953141142e-05
ZYRO0B09548g2.177ON7184291152e-05
TBLA0C030305.252ON5234241143e-05
NCAS0B062102.295ON4811351124e-05
KNAG0A053802.295ON4741341116e-05
KNAG0H023305.252ON6433891091e-04
Kwal_23.28395.252ON6144431091e-04
NCAS0F023105.252ON6681921081e-04
Suva_9.1122.295ON4911271072e-04
KLLA0E13795g5.252ON5732991062e-04
ZYRO0A02112g2.295ON4671321053e-04
NDAI0B035102.295ON4961261053e-04
KLLA0E08559g2.295ON460901044e-04
Smik_9.972.295ON4901051035e-04
KLTH0G10604g2.295ON4681261026e-04
CAGL0G06622g2.177ON7332071028e-04
Kwal_27.114852.295ON4711421010.001
YIL088C (AVT7)2.295ON4901241010.001
KAFR0J013202.295ON4791221000.001
SAKL0E10362g2.177ON7334451000.001
Skud_9.862.295ON490124960.003
KLTH0G07502g5.252ON601190970.003
TPHA0B025305.252ON596143970.003
Ecym_82495.252ON627307950.005
SAKL0E07392g2.295ON472105950.005
Kpol_1029.62.177ON767427930.010
NDAI0C037905.252ON721186900.022
ADL205C2.295ON46890880.028
Smik_11.905.252ON680187890.029
NDAI0F026602.177ON710209870.044
TDEL0E037405.252ON613175870.044
CAGL0E06468g5.252ON681143860.057
TBLA0B072102.295ON497105830.11
YKL146W (AVT3)5.252ON692175830.16
ACR051C5.252ON678159820.20
Kpol_1032.885.252ON575146810.24
TBLA0F03230singletonON561221800.34
KNAG0I019702.177ON736432800.35
Smik_14.2242.177ON715208800.36
YNL101W (AVT4)2.177ON713207790.38
Skud_11.815.252ON712186790.42
KAFR0D020002.177ON714424751.2
TPHA0F017002.177ON444205741.8
Suva_11.795.252ON719186741.9
KNAG0C033807.420ON545112731.9
KAFR0H036605.252ON646187732.5
Ecym_54082.177ON715106732.6
ZYRO0A10538g5.252ON608152722.6
Skud_14.2292.177ON713207723.2
Suva_14.2382.177ON716207713.7
SAKL0G11462g5.252ON616166714.3
Skud_3.281.39ON35544705.0
Ecym_33352.295ON474114679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C02277g
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   865   0.0  
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   536   0.0  
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   523   0.0  
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   514   e-180
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   482   e-168
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   452   e-156
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   432   e-148
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   426   e-145
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   416   e-141
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   404   e-137
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   392   e-132
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   390   e-131
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   387   e-131
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   360   e-120
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   342   e-112
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    82   4e-16
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    81   9e-16
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    78   1e-14
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    78   1e-14
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    77   1e-14
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    75   7e-14
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    74   2e-13
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    73   3e-13
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    73   4e-13
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    70   4e-12
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     69   6e-12
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    69   8e-12
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    68   1e-11
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    67   3e-11
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    67   4e-11
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    66   6e-11
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    66   7e-11
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    65   2e-10
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    65   2e-10
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    64   4e-10
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    62   9e-10
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    62   9e-10
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    62   1e-09
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    61   2e-09
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    60   5e-09
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    57   7e-08
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    57   8e-08
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    55   2e-07
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    54   4e-07
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    54   7e-07
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    54   9e-07
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    52   2e-06
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    52   3e-06
NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177     51   4e-06
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    51   4e-06
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    49   2e-05
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     49   2e-05
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    49   2e-05
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    49   3e-05
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    48   4e-05
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    47   6e-05
KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.2...    47   1e-04
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    47   1e-04
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    46   1e-04
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    46   2e-04
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    45   2e-04
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    45   3e-04
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     45   3e-04
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    45   4e-04
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    44   5e-04
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    44   6e-04
CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {...    44   8e-04
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    44   0.001
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    44   0.001
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    43   0.001
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    43   0.001
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    42   0.003
KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} simila...    42   0.003
TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.2...    42   0.003
Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar t...    41   0.005
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    41   0.005
Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON} (11352.....    40   0.010
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    39   0.022
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    39   0.028
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    39   0.029
NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {O...    38   0.044
TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.2...    38   0.044
CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} simila...    38   0.057
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    37   0.11 
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    37   0.16 
ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON} S...    36   0.20 
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    36   0.24 
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               35   0.34 
KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {O...    35   0.35 
Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101...    35   0.36 
YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuo...    35   0.38 
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    35   0.42 
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    33   1.2  
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    33   1.8  
Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W...    33   1.9  
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    33   1.9  
KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.2...    33   2.5  
Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}...    33   2.6  
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    32   2.6  
Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101...    32   3.2  
Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101...    32   3.7  
SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} simila...    32   4.3  
Skud_3.28 Chr3 (49532..50599) [1068 bp, 355 aa] {ON} YCL034W (REAL)    32   5.0  
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    30   9.8  

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/465 (93%), Positives = 433/465 (93%)

Query: 1   MQIAADKKYAKLALSDKQSKNEPNPFELELTSFDDTAKTADSAVDQNIFNVNEEDPLTDD 60
           MQIAADKKYAKLALSDKQSKNEPNPFELELTSFDDTAKTADSAVDQNIFNVNEEDPLTDD
Sbjct: 1   MQIAADKKYAKLALSDKQSKNEPNPFELELTSFDDTAKTADSAVDQNIFNVNEEDPLTDD 60

Query: 61  IYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLI 120
           IYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLI
Sbjct: 61  IYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLI 120

Query: 121 VINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFP 180
           VINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFA            DSIPHVLSAFFP
Sbjct: 121 VINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFP 180

Query: 181 SHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGE 240
           SHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSM                    SGE
Sbjct: 181 SHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMLALLGLIAIVIIIVVKAPLVSGE 240

Query: 241 YKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSC 300
           YKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSC
Sbjct: 241 YKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSC 300

Query: 301 IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIR 360
           IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIR
Sbjct: 301 IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIR 360

Query: 361 DIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYIL 420
           DIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYIL
Sbjct: 361 DIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYIL 420

Query: 421 PPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEAFA 465
           PPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEAFA
Sbjct: 421 PPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEAFA 465

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/484 (57%), Positives = 337/484 (69%), Gaps = 21/484 (4%)

Query: 1   MQIAADKKYAKL--------ALSDKQSKNE-PNP----FELELTSFDD-------TAKTA 40
           M+  + + Y KL        A + K +++  P P     + EL++F D       +    
Sbjct: 1   MKGTSKQPYKKLDSSEPEPAACTSKSTRHSSPIPVSSDLQFELSTFHDYELLPTTSGARN 60

Query: 41  DSAVDQNI-FNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGI 99
           +  V  N+  N+  EDP    +   N  KSN YMAFMNMANSILG+GVIGQPFA+KNCG+
Sbjct: 61  NKNVQNNVELNLQFEDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNCGL 120

Query: 100 IGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAXXX 159
           IGG+   +L++I+VDWTIRLIVINLKLTGK+TYQ SVE AMG  G LLIL  NGLFA   
Sbjct: 121 IGGVCLIVLLTIIVDWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAFGG 180

Query: 160 XXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXX 219
                    DSIPHVL AFFPSH++LF RNV+I++VTLFIS+PLSLNR+ISKLSK SM  
Sbjct: 181 CVGFCIIIGDSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNISKLSKASMLA 240

Query: 220 XXXXXXXXXXXXXXXXXXSGEYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFS 279
                               EYKG F   + FITPR+FQGIS+ISFALVCHHNTSFIFFS
Sbjct: 241 LVSLLLIVALVIIRAPKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFS 300

Query: 280 LRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLL 339
           L+NPSLKRF  LTH+S I+S +VCL   Y GFL FKDKT GNILNNFPS+DN INFAR  
Sbjct: 301 LKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFC 360

Query: 340 LGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIALSTS 399
            GFNMLTTFPLEIFVLRDV+RD++Y+   D E + LTTK H ++TS LV I M I+L+T 
Sbjct: 361 FGFNMLTTFPLEIFVLRDVVRDLLYFQSADSESIILTTKEHFIVTSVLVFISMSISLTTC 420

Query: 400 NLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQT 459
           NLGALLE++G+T+ASL AYILPP T L +TGK K+LKE+ PY  CI+FG  +M VS+ QT
Sbjct: 421 NLGALLELVGSTTASLTAYILPPATTLALTGKTKTLKERTPYYACIMFGFSIMIVSSTQT 480

Query: 460 ILEA 463
           IL A
Sbjct: 481 ILSA 484

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/447 (60%), Positives = 329/447 (73%), Gaps = 10/447 (2%)

Query: 27  ELELTSFDD---TAKTADSAVDQNI------FNVNEEDPLTDDIYLSNEAKSNRYMAFMN 77
           + EL+SFD     A  + SA D++          + EDPL   I   N+ KSN YMAFMN
Sbjct: 16  QFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMN 75

Query: 78  MANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVE 137
           MANSILG+G+IGQPFA+ NCG+ GG+ A +L+++LVDWTIRLIV+NLKLTGK+TYQ SVE
Sbjct: 76  MANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVE 135

Query: 138 TAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTL 197
            AMG+ G LLIL +NGLFA            D+IPHVL AFFP+HT LFHRN II  VTL
Sbjct: 136 FAMGRRGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHTALFHRNAIIFFVTL 195

Query: 198 FISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHLHQLFITPRIF 257
           F+S+PLSLNRDISKLSK SM                       YKG+    +LFITPRIF
Sbjct: 196 FVSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKGSLTASKLFITPRIF 255

Query: 258 QGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDK 317
           QGISVISFALVCHHNTSFI+FSL+NPSLKRFN+LTH+S ++S +VC    YSGFL FKDK
Sbjct: 256 QGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDK 315

Query: 318 TVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDP-EPVKLT 376
           T GNILNNFPSDDNVIN AR   GFNMLTTFPLEIFVLRDV+RD+ +++  +   P +L+
Sbjct: 316 TKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELS 375

Query: 377 TKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLK 436
           TK H  +TS LV + M ++L+T NLGAL E+IGAT+AS+MAYILPPLTNL++TG+ K+L+
Sbjct: 376 TKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLR 435

Query: 437 EKLPYCGCIVFGVILMFVSTAQTILEA 463
           +KLPY GCIVFG  +M +S+ QTIL A
Sbjct: 436 QKLPYYGCIVFGFAVMVISSTQTILAA 462

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  514 bits (1323), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 321/437 (73%), Gaps = 8/437 (1%)

Query: 27  ELELTSFD-DTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGS 85
             +L+SFD ++ + ++  +D        ED  T      N +KSN +MAFMNMANSILG+
Sbjct: 26  SFQLSSFDRNSQRNSERLID------GSEDESTTAFLRENRSKSNIFMAFMNMANSILGA 79

Query: 86  GVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGG 145
           GVIGQPFA+KNCG++GG+FA IL+S+LVDWTIRLIV+N+K+TGK+TYQ SVE AMG+ G 
Sbjct: 80  GVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGK 139

Query: 146 LLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSL 205
           LLIL+SNGLFA            D+IPHVL AFFP H +LFHRN+II LVT FISFPLSL
Sbjct: 140 LLILLSNGLFAFGGCVGFCIIIGDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSL 199

Query: 206 NRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHLHQLFITPRIFQGISVISF 265
           NR+ISKLSK SM                       YKG+F+  +LF TPRIFQGISVISF
Sbjct: 200 NRNISKLSKASMLALVSMVFIVVIVLVKGPMIDDAYKGSFNTTELFFTPRIFQGISVISF 259

Query: 266 ALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNN 325
           ALVCHHNTSFI+FSL+ PSLKRF++LTH S  ++ I C    Y+GFL FKD+T GNILNN
Sbjct: 260 ALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNN 319

Query: 326 FPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYN-KDDPEPVKLTTKMHALIT 384
           FP  DNV+N AR   GFNMLTTFPLEIFVLRDVIRD +++N KD  +  +L+ K+H ++T
Sbjct: 320 FPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHVILT 379

Query: 385 SGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGC 444
           + LV+  M I+L+T NLGAL E+ GAT+ASLMAYILPP  NL++ GK+ +++EKLP+  C
Sbjct: 380 TILVMTTMLISLTTCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYAC 439

Query: 445 IVFGVILMFVSTAQTIL 461
           I+FG  +M VS++QTI+
Sbjct: 440 IIFGFTIMVVSSSQTII 456

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  482 bits (1241), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 243/452 (53%), Positives = 313/452 (69%), Gaps = 8/452 (1%)

Query: 14  LSDKQSKNEPNPF--ELELTSFDDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKSNR 71
           +  + S ++  P     EL+SFD + +     V     +V+ ED  T        +KSN 
Sbjct: 11  IQGRGSHDQRGPLGDNFELSSFDRSTE-----VRPERLSVDSEDRFTSTFLHEQRSKSNI 65

Query: 72  YMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKST 131
            MAFMNMANSILG+G+IGQPFA+KNCG++GG+ A +L+S+LVDWTIRLIV+NL+++GK+T
Sbjct: 66  LMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVLLSLLVDWTIRLIVVNLRISGKTT 125

Query: 132 YQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVI 191
           YQ SVE AMG+ G LLIL+SNGLFA            D+IPHVL AFF  H +LFHRN++
Sbjct: 126 YQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIGDTIPHVLRAFFSGHDNLFHRNIV 185

Query: 192 ITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHLHQLF 251
           I +VT  ISFPLSLNRDISKLSK SM                       YKG+F+   L 
Sbjct: 186 IVVVTCLISFPLSLNRDISKLSKASMLALASMVVIVVIVVIKGPGTDSAYKGSFNSSNLL 245

Query: 252 ITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGF 311
           ITPRIFQG+SVISFALVCHHNTSFI+FSL+ PSLKRF++LTH S  ++ I C    ++GF
Sbjct: 246 ITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGF 305

Query: 312 LNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKD-DP 370
           L FKDKT GNILNNFP +DN +N AR   GFNMLTTFPLEIFVLRDVI+D++++N +   
Sbjct: 306 LVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEPKS 365

Query: 371 EPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITG 430
           +P  L+ K+H +I++ LV   M I+L+T NLGAL E+IGAT+ASLMAYILPP  NL + G
Sbjct: 366 QPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVG 425

Query: 431 KKKSLKEKLPYCGCIVFGVILMFVSTAQTILE 462
                ++++P+  CI FG  +M +S+ QTI+ 
Sbjct: 426 GNLKWRDRIPHYVCIGFGFAIMLISSTQTIIS 457

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  452 bits (1164), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 299/441 (67%), Gaps = 7/441 (1%)

Query: 24  NPFELELTSFDDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSIL 83
           N   +EL  +   + T  S  D       EED +   I   ++ K             + 
Sbjct: 43  NGDRIELIDYPTKSSTLSSGFDL------EEDSVLGAIVQESKGKVQYVYGLHEHGEQVS 96

Query: 84  GSGVI-GQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQ 142
              V  G    +KNCG++GGL  T+L++++VDWTIRLI+INLKLTGK+TYQ +VE AMG+
Sbjct: 97  LELVWSGSRLRLKNCGLLGGLVLTMLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGR 156

Query: 143 WGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFP 202
            G   +L +NG+FA            DSIPHVL AFFP++ + F+RN+IIT+VT+F+S+P
Sbjct: 157 PGKYAVLFANGMFAFGGCVGFCIIIGDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYP 216

Query: 203 LSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHLHQLFITPRIFQGISV 262
           LSLNR+ISKLSK SM                      +Y+G+F L +LF+ PR+FQGISV
Sbjct: 217 LSLNRNISKLSKASMLALVSLLLIVVIIVVRGPTVGNDYRGSFDLEELFVKPRLFQGISV 276

Query: 263 ISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNI 322
           ISFALVC HNTSFI+FSLR PSL+RFN LTH+S  +S +VCL   YSGFL FK KT GNI
Sbjct: 277 ISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNI 336

Query: 323 LNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHAL 382
           LNNFPS DN INFAR   GFNMLTTFPLEIFVLRDVIRD+I       EP++L+TK H +
Sbjct: 337 LNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKGEPLRLSTKRHFI 396

Query: 383 ITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYC 442
           IT+ LVL  M I+L+T NLGALLE++G+T+ASL AYILPP+TNL++TG++++ KEKLP+ 
Sbjct: 397 ITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHY 456

Query: 443 GCIVFGVILMFVSTAQTILEA 463
            CI+FG  +M +S+ Q I+ A
Sbjct: 457 ACILFGFSIMVISSTQAIITA 477

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  432 bits (1110), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 234/464 (50%), Positives = 304/464 (65%), Gaps = 13/464 (2%)

Query: 9   YAKLALSDKQSKNEPNPFELELTSFDDTAKTADSAV--DQNIFNVNEEDPLTDD-----I 61
           Y++L   ++QS+  P   E EL  FD     +D     D N    +  +   D+     +
Sbjct: 7   YSRL---EEQSERIPLELEFELVDFDAKPGASDETEENDSNEAKASSSNSAIDESMVINL 63

Query: 62  YLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIV 121
              N+ KS    AFMNMANSILG+GV+GQPFA++NCGIIGG+ A I++ +LVDWT+RLIV
Sbjct: 64  LRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLRLIV 123

Query: 122 INLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPS 181
           INL L GK TYQ +VE A+G+ G +L+L+SNGLFA            D+IPH L + F S
Sbjct: 124 INLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSIFHS 183

Query: 182 HTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEY 241
               F RNV+IT+VTLFIS+PLSL R+I+ LSK S                         
Sbjct: 184 SNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQGPRVDMSL 243

Query: 242 KG-TFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSC 300
           KG  + L  +FI+  IF+GISVISFALVCHHNTSFIFFS++N SL++F +LTH+S  +S 
Sbjct: 244 KGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISM 303

Query: 301 IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIR 360
           I C+   YSG+  F+DKT GNILNNFP DD VIN ARL  GFNMLTTFPLEIFVLRDVI 
Sbjct: 304 IFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIA 363

Query: 361 DIIYYNK--DDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAY 418
             +Y  K  D+ E   L+T+   +IT+  V+  M I+L+T NLGAL E+IGAT+AS MAY
Sbjct: 364 AFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAY 423

Query: 419 ILPPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILE 462
           ILPP TNLV++ +  + ++K+P+  CI FG ++M VS+ QTI+E
Sbjct: 424 ILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIE 467

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  426 bits (1096), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 233/467 (49%), Positives = 304/467 (65%), Gaps = 11/467 (2%)

Query: 8   KYAKLALSDKQSKNEPNPFELE-LTSFDDTAKTADSAVDQNIFNV--NEEDPLTDDIYLS 64
           +Y+KL   + +++ E   F L  +T  D    +        I+ +  + +D L +++   
Sbjct: 6   EYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRE 65

Query: 65  NEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINL 124
           N+ KS+  MAFMN+ANSILG+G+I QPFA+KN GIIGGL + I +  +VDWT+RLIVINL
Sbjct: 66  NDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINL 125

Query: 125 KLTGKSTYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTD 184
            L GK TYQ +VE  MG+ G LLIL +NGLFA            D+IPHVL A F  +  
Sbjct: 126 TLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDG 185

Query: 185 LFH----RNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGE 240
             H    RNVII +VT+FISFPLSL R+I  LSK S                       +
Sbjct: 186 EVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYD 245

Query: 241 YKG-TFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILS 299
           ++G T  L  +FI   IF+ +SVISFALVCHHNTSFIFFS+RN S+ +F +LTH+S+++S
Sbjct: 246 WRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVIS 305

Query: 300 CIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVI 359
            I C    YSGF  FK+KT GN+LN+FP  D  IN ARL  GFNMLTTFP+EIFVLRDV+
Sbjct: 306 VICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVV 365

Query: 360 RDIIYYN---KDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLM 416
            ++++     K+  E  +L+ K H +ITS LV I M I+L+T NLGAL E+IGAT+AS M
Sbjct: 366 GNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTM 425

Query: 417 AYILPPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEA 463
           AYILPP TNL++T KKK+ K KLPY  CI FG ++M VS+ QTIL+A
Sbjct: 426 AYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDA 472

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  416 bits (1069), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 229/464 (49%), Positives = 303/464 (65%), Gaps = 8/464 (1%)

Query: 8   KYAKLALSDKQSKNEPNPFELELTSFDDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEA 67
           +Y+KL   + +++ E   F    T+ +D+   +      NI   + +D L +D+   N+ 
Sbjct: 6   EYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVLRENDK 65

Query: 68  KSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLT 127
           KS+  MAFMN+ANSILG+G+I QPFA+KN GI+GGL + + +  +VDWT+RLIVINL L 
Sbjct: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125

Query: 128 GKSTYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFH 187
           GK TYQ +VE  MG+ G LLIL +NGLFA            D+IPHVL A F  +    H
Sbjct: 126 GKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQNDGNVH 185

Query: 188 ----RNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKG 243
               RNVII +VT FISFPLS+ R+I  LSK S                       ++KG
Sbjct: 186 FWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKG 245

Query: 244 -TFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIV 302
            +  L   F+   IF+ +SVISFALVCHHNTSFIFFS+RN S+ +F +LTH+S+I+S I 
Sbjct: 246 HSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVIC 305

Query: 303 CLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDI 362
           C    YSGF  FK+KT GN+LN+FP  D  IN ARL  GFNMLTTFP+EIFVLRDV+ ++
Sbjct: 306 CALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNL 365

Query: 363 IYYN---KDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYI 419
           ++     K+  E  +L+ K H +ITS LV I M I+L+T NLGAL E+IGAT+AS MAYI
Sbjct: 366 LHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYI 425

Query: 420 LPPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEA 463
           LPP TNL++T KKKS KE+LP+  CI FG ++M +S+ QTI++A
Sbjct: 426 LPPYTNLLLTSKKKSWKERLPFYLCICFGFMIMIISSTQTIIDA 469

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  404 bits (1038), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 231/455 (50%), Positives = 290/455 (63%), Gaps = 18/455 (3%)

Query: 27  ELELTSF----------DDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKSNRYMAFM 76
           E ELT F          DD ++  DS         + +DPL + +   N+ KS+  MAFM
Sbjct: 18  EFELTDFPLLGITDNDSDDGSQGKDSPNFVYPITSDTDDPLVNSVLRENDKKSSMRMAFM 77

Query: 77  NMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASV 136
           N+ANSILG+G+I QP A+KN GI+GGL A I +  +VDWT+RLIVINL L GK TYQ +V
Sbjct: 78  NLANSILGAGIITQPVAIKNAGILGGLIAYIALGFIVDWTLRLIVINLTLAGKRTYQGTV 137

Query: 137 ETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFH----RNVII 192
           E  MG+ G LLIL +NGLFA            D+IPHVL A F  +    H    RNVII
Sbjct: 138 EHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDGEVHFWLRRNVII 197

Query: 193 TLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKG-TFHLHQLF 251
            LVT+FISFPLSL R+I  LSK S                       ++KG +       
Sbjct: 198 VLVTIFISFPLSLKRNIEGLSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKWPDFL 257

Query: 252 ITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGF 311
           +   IF+ +SVISFALVCHHNTSFIFFS+RN S+ +F +LTH+S+I+S I C    +SGF
Sbjct: 258 VKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGFSGF 317

Query: 312 LNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYN---KD 368
             FK+KT GN+LNNFP  D  IN ARL  GFNMLTTFP+EIFVLRDV+ + ++     K 
Sbjct: 318 AAFKEKTKGNVLNNFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNSLHECHLIKS 377

Query: 369 DPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVI 428
             E  +L+ K H +ITS LV I M I+L+T NLGAL E+IG+T+AS MAYILPP TNL++
Sbjct: 378 YDEHTQLSDKQHTIITSLLVFITMSISLTTCNLGALFELIGSTTASTMAYILPPYTNLLL 437

Query: 429 TGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEA 463
           T KKK+ K KLPY  CI FG ++M VS+ QTIL+A
Sbjct: 438 TSKKKNWKAKLPYYLCICFGFMIMIVSSTQTILDA 472

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  392 bits (1008), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/462 (50%), Positives = 296/462 (64%), Gaps = 18/462 (3%)

Query: 20  KNEPNPFELELTSF----------DDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKS 69
           +N+    E ELT F          DD ++  DS         + +D L + + L N+ KS
Sbjct: 11  ENKELRTEFELTDFPLPGITDNNSDDRSQGKDSLKAIYPIASDTDDTLVNKVLLENDKKS 70

Query: 70  NRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGK 129
           +  MAFMN+ANSILG+G+I QPFA+KN GI+GGL + I +  +VDWT+RLIVINL L GK
Sbjct: 71  SMRMAFMNLANSILGAGIITQPFAIKNAGILGGLISYIALGFIVDWTLRLIVINLTLAGK 130

Query: 130 STYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFH-- 187
            TYQ +VE  MG+ G LLIL +NGLFA            D+IPHVL A F       H  
Sbjct: 131 RTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQKDGDIHFW 190

Query: 188 --RNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKG-T 244
             RNVII +VT+FISFPLSL R+I  LSK S                       ++KG +
Sbjct: 191 LRRNVIIIIVTIFISFPLSLKRNIEALSKASFLAVISMIIIVVTVVIRGPMLPYDWKGHS 250

Query: 245 FHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCL 304
             L   F+   IF+ +SVISFALVCHHNTSFIFFS+RN S+ +F +LTH+S+I+S I C 
Sbjct: 251 LQLRDFFVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCG 310

Query: 305 TTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIY 364
              YSGF  FK+KT GNILN+FP  D  IN ARL  GFNMLTTFP+EIFVLRDV+ ++++
Sbjct: 311 LMGYSGFAAFKEKTKGNILNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLH 370

Query: 365 YN---KDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILP 421
                K+  E  +L+ K H +ITS LV I M I+L+T NLGAL E+IGAT+AS MAYILP
Sbjct: 371 ECKIIKNYDEHTQLSGKQHIVITSLLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430

Query: 422 PLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEA 463
           P TNL++T KKKS   KLP+  CI FG ++M +S+ QTIL+A
Sbjct: 431 PYTNLLLTSKKKSWSAKLPFYLCICFGFMIMIISSTQTILDA 472

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  390 bits (1003), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 201/413 (48%), Positives = 271/413 (65%), Gaps = 2/413 (0%)

Query: 50  NVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILM 109
           N + +D   +D+   N  KS    AFMNMANSILG+GVIGQP A+KN GI+G + A +++
Sbjct: 70  NYDNDDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNSGIVGAIIAYLVL 129

Query: 110 SILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXD 169
            +LVDWT+RLIVINL L GK TYQ +V  AMG+ G + +L +NGLFA            D
Sbjct: 130 FVLVDWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAFGGCIGFCIIIGD 189

Query: 170 SIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXX 229
           ++PHV  AF   ++    R +IIT+VT+ IS+PL+L R+I+ LSK S             
Sbjct: 190 TLPHVFRAFIHQNSVFLSRRLIITIVTICISYPLALQRNIAALSKASFLALISMVIIVFT 249

Query: 230 XXXXXXXXSGEYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFN 289
                     + +       + +TPRIF+GISVISFALVCHHNTSFI+FS++N SL++FN
Sbjct: 250 VIIRGPEIHAK-RDPLTWEDILVTPRIFRGISVISFALVCHHNTSFIYFSIKNRSLRKFN 308

Query: 290 QLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFP 349
           +LTH+S  +S + C+   +SGF  F   T GN+LNNF +DD  +N ARL  GFNMLTTFP
Sbjct: 309 RLTHISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIARLCFGFNMLTTFP 368

Query: 350 LEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIG 409
           LEIFVLRDVI   I  ++ + +P  L+   H +IT+ LV   M I+L T NLGA+ E+IG
Sbjct: 369 LEIFVLRDVIASFIGGHQPNGDPNVLSKSNHFIITTILVFGTMSISLLTCNLGAIFELIG 428

Query: 410 ATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILE 462
           AT+AS+MAYILPP  NL++T   K+ ++KLP+  CI FG  +M +S+ QTIL+
Sbjct: 429 ATTASMMAYILPPWVNLLLT-SDKTFRQKLPHFACIAFGFSIMLISSIQTILD 480

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  387 bits (995), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 209/421 (49%), Positives = 273/421 (64%), Gaps = 11/421 (2%)

Query: 52  NEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
           +  + L  ++   NE KSN YMAFMNMANSILG+G+I QP A+KN GI+G +   IL+  
Sbjct: 16  DTSEELAKELIEENEKKSNVYMAFMNMANSILGAGIITQPLAVKNAGILGSIICYILLGF 75

Query: 112 LVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSI 171
           +VDWT+RL+VIN+ L+ K TYQ +VE  MG+ G  LIL  NGLFA            D+I
Sbjct: 76  IVDWTLRLLVINITLSSKQTYQDTVEHVMGKKGKFLILGCNGLFALGGCIGFSIIIGDTI 135

Query: 172 PHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXX 231
           PHVL  FF  +++   RN++I L TLFIS+PLSL R+I+ LSK S               
Sbjct: 136 PHVLRIFF--NSEKITRNMVIFLTTLFISYPLSLLRNIAALSKASFLALVSMVVIVFTVV 193

Query: 232 XXXXXXSGEYKGTFHLHQ-LFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQ 290
                   E KG    H  LF +P +F+ +S+ISFALVCHHNTSFIF S+RN SL +F +
Sbjct: 194 IRGPALPSELKGEPLSHSSLFFSPSLFKSLSIISFALVCHHNTSFIFHSIRNKSLTKFTK 253

Query: 291 LTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPL 350
           LTH+S+ +S   C+   YSGF  F DKT GNILNNFP+ DN+IN AR+  GFNMLTTFPL
Sbjct: 254 LTHISVFISVAFCMLMGYSGFFIFTDKTKGNILNNFPAKDNIINIARICFGFNMLTTFPL 313

Query: 351 EIFVLRDVIRDIIYY------NKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGAL 404
           EIFVLRDV+  I+         +++P    L+ K H  IT+GLV + M I+L T NLGAL
Sbjct: 314 EIFVLRDVVAVILLECHLVPSEENNPLLPYLSRKWHFCITTGLVFLSMGISLMTCNLGAL 373

Query: 405 LEIIGATSASLMAYILPPLTNLVITGKKKSLK--EKLPYCGCIVFGVILMFVSTAQTILE 462
            E+IG+T+AS+MAYILPP  NL++  ++  L    KLP+  CI FG  +M +S+ +TIL+
Sbjct: 374 FELIGSTTASVMAYILPPYVNLLLRQQRNELSFTTKLPHYFCIFFGFTVMIISSTETILD 433

Query: 463 A 463
           A
Sbjct: 434 A 434

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  360 bits (925), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 199/426 (46%), Positives = 266/426 (62%), Gaps = 11/426 (2%)

Query: 49  FNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATIL 108
           F + + + L  +I   N  KSN YMAF+NMANSILG+G+I QP A+KN G+   +   I+
Sbjct: 12  FQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIM 71

Query: 109 MSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXX 168
           +  +VDWT+RL++ N+ L+ K TY  +VE  MG+ G  LIL  NGLFA            
Sbjct: 72  LGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALGGCIGFCIIIG 131

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D+IPHVL  F  SH     RN +I   TLFIS+PLSL RDIS LS TS            
Sbjct: 132 DTIPHVLRIFIHSH--FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALISMTVIVM 189

Query: 229 XXXXXXXXXSGEYKGTFHLHQLFI-TPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKR 287
                      E KG+      ++ +P +F+ +S++SFALVCHHNTSFIF S+RN SL +
Sbjct: 190 TVVVFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTK 249

Query: 288 FNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTT 347
           F +LTH+S+ +S I C+   Y+GF  F  KT GNILNNFP +   IN AR+  GFNMLTT
Sbjct: 250 FTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTT 309

Query: 348 FPLEIFVLRDVIRDIIYYN------KDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNL 401
            PLE+FVLRDVI  I+  N      ++ P    LT K H ++T+ +V + M ++L T NL
Sbjct: 310 LPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNL 369

Query: 402 GALLEIIGATSASLMAYILPPLTNLVITGKKKSL--KEKLPYCGCIVFGVILMFVSTAQT 459
           GAL E++GAT+AS+MAYILPP  NL++  +K+ L  K K+P+  CI+FG  +M VS+ QT
Sbjct: 370 GALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQT 429

Query: 460 ILEAFA 465
           I+EA A
Sbjct: 430 IVEALA 435

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  342 bits (876), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/482 (42%), Positives = 270/482 (56%), Gaps = 56/482 (11%)

Query: 30  LTSFDDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIG 89
           +TS  D     D      +  +  E+PL   I  +NE KS  +MAFMNMANSILG+G+I 
Sbjct: 1   MTSAQDEGLLRDPPPSYELHEL--ENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIIS 58

Query: 90  QPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLIL 149
           QPFA++  G++G     I +  LVDWT+RLIV NL +TG  TYQ SV  A+G+ G L IL
Sbjct: 59  QPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAIL 118

Query: 150 VSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDI 209
           ++NGLFA            D+IPHVL    P       RN +I +VTL IS PLSL++ I
Sbjct: 119 LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPP--QYIERNWVIIVVTLLISLPLSLSKKI 176

Query: 210 SKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHL--HQLFITPRIFQGISVISFAL 267
            +L + S                       E K    L   Q +    IF+ +S++SFAL
Sbjct: 177 KQLERASFLALVSMAVIVVTVAVRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFAL 236

Query: 268 VCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFP 327
           VCHHNTSFIF SLRN S+ +FN+LTH S  +S  VC+   Y+GF  FK+KT GN+LNNF 
Sbjct: 237 VCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFS 296

Query: 328 SDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDII------YYNK-------------- 367
            DD  IN ARL  GFNMLTTFPLEIFVLR+V+ DI       +Y                
Sbjct: 297 GDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQ 356

Query: 368 ------------------------DDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGA 403
                                    DPEP   + + H  +T  LVL  M +AL T NLGA
Sbjct: 357 QPPPPEPHGSSPARGPAGPHPGLPPDPEP---SEQPHTAVTVVLVLATMGVALVTCNLGA 413

Query: 404 LLEIIGATSASLMAYILPPLTNLVITGKK---KSLKEKLPYCGCIVFGVILMFVSTAQTI 460
           LLE+IG+T+ +L AYILPPLT++++T ++    + +E+L +C C+VFG  +M VST QT+
Sbjct: 414 LLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVSTTQTL 473

Query: 461 LE 462
           L+
Sbjct: 474 LD 475

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 82/343 (23%), Positives = 143/343 (41%), Gaps = 56/343 (16%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D +P + + F  SH  L +R+  I+L+ LFI  PL   R ++ L   SM           
Sbjct: 104 DLMPQIFAVFTTSHI-LLNRDFHISLIMLFIVSPLCFLRKLNSLRYASMIAISAVAYLCV 162

Query: 229 XXXXXXXXXS---GEYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSL----R 281
                    +    + KG   +      P     + +  FA  CHHN    FFS+     
Sbjct: 163 LVVAHFIFQTEDVHDLKGVVSIGLPKHEPSPLTTLPIFVFAYTCHHN----FFSVINEQS 218

Query: 282 NPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLG 341
           N +     ++  +++IL+ ++ +   +SG+L F D  VGNI+  +P   +     RL + 
Sbjct: 219 NIAFTHIKKIPIIAMILAYLLYILIGFSGYLTFGDNIVGNIITLYPRTASS-TIGRLAIV 277

Query: 342 FNMLTTFPLEIFVLRDVIRDIIYYNKD--------------------------------- 368
           F ++  FPL+    R  I  I +Y ++                                 
Sbjct: 278 FLVMLAFPLQCHPCRASIHHIWHYIQEKNSNEIATQPINVPPDEEDTLLAVELIEEDSPK 337

Query: 369 DPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVI 428
            PE + L  K   +IT  ++L    +A+S ++L  +L I+GAT ++ +++ILP +    +
Sbjct: 338 QPEEIPLRGKRFNIITVCILLFSYTLAISVNSLAKVLAIVGATGSTSISFILPGIFGFKL 397

Query: 429 TGKK-KSLKEKLP-------YCGCI--VFGVILMFVSTAQTIL 461
            G +  +    LP       Y G    ++G+ +M  S A T+L
Sbjct: 398 IGSEFSATSSPLPKSARFFRYLGLFLSIWGLFVMIASLAATLL 440

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 91/417 (21%), Positives = 161/417 (38%), Gaps = 41/417 (9%)

Query: 59  DDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIR 118
             IY  N   S+     + + ++  G+G++  P+A K  G++ G F  I+       T  
Sbjct: 16  SSIYNPNAMSSSVGSGVLTLLHTACGAGILAMPYAFKPFGLVLG-FCMIVFCGACSATGL 74

Query: 119 LIVINLKLTGKSTYQASVETAMGQWGGLLIL--VSNGLFAXXXXXXXXXXXXDSIPHVLS 176
           ++   +    K    +    +   +  L ++  ++  +              D +P +  
Sbjct: 75  MLQARVSKYAKERNASFFALSQITYPQLSVVFDLAIAVKCFGVGVSYLVVVGDLMPRIF- 133

Query: 177 AFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXX 236
           A F SH+ L +RN  ITLV   I  PL   R +  L   SM                   
Sbjct: 134 ATFTSHSLLLNRNFHITLVMALIVSPLCFMRRLDSLRYASMIAVSSVAYLCVLVVVHFLF 193

Query: 237 XS---GEYKGTFHLHQLFIT-PRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLT 292
            S    E KG   + +   +   +     +  FA  CHHN   I   LR+ SLK   ++ 
Sbjct: 194 PSEELRELKGYVSIQKPAGSFSALLSCFPIFVFAYTCHHNMFSIINELRDNSLKGIYKVC 253

Query: 293 HVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEI 352
            +S+ LS  + L    SG+  F D   GNI+  +P         R+ +   ++  FPL+ 
Sbjct: 254 AISVALSMTLYLLIGGSGYATFGDNVPGNIITLYP-QSTTTTIGRVAIALLVMLAFPLQC 312

Query: 353 FVLRDVIRDIIYY--------------------------------NKDDPEPVKLTTKMH 380
              R  I  II Y                                +   P+ V L  K  
Sbjct: 313 HPARASIDHIIQYFSKASDNPLQNSEASHLISSPRVSEDVMAEEDSPQQPQVVPLEGKRF 372

Query: 381 ALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKE 437
             IT+G+++    +A+S ++L  +L ++GAT ++ +++ILP +    + G + +  +
Sbjct: 373 IAITAGILIFSFLLAISVTSLARVLAVVGATGSTSISFILPGIFGYQLIGSEHTTGQ 429

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 138/331 (41%), Gaps = 41/331 (12%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D IP + + F  S+  L  RN  IT+V LF+  PL   + ++ L K S+           
Sbjct: 104 DLIPQIFTTF-TSNKILLERNFHITMVMLFLVSPLCFMKRLTSLRKASLVALSSVAYLCC 162

Query: 229 XXXXXXXXXSGE---YKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSL 285
                    S E    KG   +      P     + +  FA  CHHN   ++   ++ S 
Sbjct: 163 LVVVHFIWPSNEIDQRKGKVSIGFPRNEPTPLTTLPIFVFAYTCHHNAFSVYNEQKDTST 222

Query: 286 KRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNML 345
           ++ N++    + ++ ++      +G+L F D   GNI+  +P   +     R+ +   ++
Sbjct: 223 RQLNKIGRYGMSIAFVLYTIIGGAGYLTFGDHIAGNIITLYPPSLST-TIGRVAIVLLVM 281

Query: 346 TTFPLEIFVLRDVIRDIIY--------------------------YNKDDPEPVKLTTKM 379
             FPL+    R  I +I+Y                               P    L  K 
Sbjct: 282 LAFPLQCHPARSSINNILYSFQSVEKNLQGQTENSNLISEEESVESQAHGPPVPPLQGKR 341

Query: 380 HALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKL 439
             +IT  +++    +A+S ++L  LL I+G+T ++ +++ILP +    + G + +  E+L
Sbjct: 342 FTVITLVILIASYLLAISVTSLARLLAIVGSTGSTSISFILPGIFGYWLIGSEYT-PEEL 400

Query: 440 P-------YCGCI--VFGVILMFVSTAQTIL 461
           P       + G +  ++G I+M  S A +IL
Sbjct: 401 PRNLKFAKFAGLLLAIWGFIVMIASLAASIL 431

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 98/457 (21%), Positives = 177/457 (38%), Gaps = 88/457 (19%)

Query: 76  MNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQAS 135
           + + ++  G+G++  P+A K  G+I G    I+  I         +I L L  + +    
Sbjct: 10  LTLLHTACGAGILAMPYAFKPYGLITGFIMIIICGICA-------MIGLLLQSRVSSYVP 62

Query: 136 VETA----MGQWG----GLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFH 187
           V  A    + Q       ++  ++  +              D +P VLS F  +H  L +
Sbjct: 63  VRNASFFTLTQITNPNLSIVFDLAIAIKCFGVGVSYMIVVGDVLPQVLSTF-TNHEWLLN 121

Query: 188 RNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGE---YKG- 243
           RNV ITLV LFI  PL   ++++ L   SM                    + E   +KG 
Sbjct: 122 RNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCALVLIHFIMPNDETHNFKGD 181

Query: 244 -TFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIV 302
            ++ L +  + P     + +  FA  CHHN   +     +P+     ++  +S+IL+  +
Sbjct: 182 VSWGLPKNGLNP--LTTLPIYVFAYTCHHNMFSVINEQMDPTYNSVKKIAIISMILAGFL 239

Query: 303 CLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDI 362
            +    +G+L F D   GNI+  +P + +     R+ + F +   FPL+    R  I  I
Sbjct: 240 YILIGGAGYLTFGDHITGNIITLYPQNIST-TIGRIAIIFLVTLAFPLQCHPARASINHI 298

Query: 363 IYY-----------------------NKDDPEP--------------------------- 372
           I+Y                       N+  P P                           
Sbjct: 299 IHYFKPAQDNKNSNPAGFSETTTLMDNQSPPPPAILQQITQDPLTIPTEELIEEEYPEQD 358

Query: 373 -----VKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLV 427
                + L      +IT G+++    +A+S ++L  +L I+GAT ++ +++ILP L    
Sbjct: 359 HPFETIPLEQSQFTIITIGILVSAYFLAISVTSLARVLAIVGATGSTSISFILPGLFGYQ 418

Query: 428 ITGKK---------KSLKEKLPYCGCIVFGVILMFVS 455
           + G +         K+   K+     + +G  +MF S
Sbjct: 419 LIGSEYKNFNEMPIKTKATKIASAVLVTWGTFIMFAS 455

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 125/292 (42%), Gaps = 45/292 (15%)

Query: 187 HRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXS---GEYKG 243
           +R   IT V LFI  PLS  R I+ L  TS+                    S    E +G
Sbjct: 113 YRMNTITFVWLFIILPLSYLRKINALRYTSLLAVTSVFYLCILVTYHYCKPSEEISELRG 172

Query: 244 TFHL---HQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSC 300
           T  L       I+P  F+ + +  FA  CHHN   +    ++   KR   +  +++ ++C
Sbjct: 173 TVSLFLPKSSGISP--FKTLPIFVFAYTCHHNMFAVINEQKHTDFKRLKFIPLIAISIAC 230

Query: 301 IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIR 360
           I+ L     G+  F      NI+  +P++  +    +  +   +   +PL+    R  I 
Sbjct: 231 ILYLIVGCLGYATFGANITSNIVAKYPTNSVLTVLGQTAMLTVVTLAYPLQCQPARASIL 290

Query: 361 DIIYY---------------------------NKDDPEPVKLTTK----MHALITSGLVL 389
           +I+Y                            NK   EP ++ ++    +H+++TS ++ 
Sbjct: 291 NILYALFPKLKNNKSDVEEASMNDGYQVDLEENKQQSEPERIISEPSIILHSIVTSLILF 350

Query: 390 IIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVIT------GKKKSL 435
              CIA+S ++L  +L I+GAT ++ +++ILP L  +V+       GK K+L
Sbjct: 351 GSWCIAVSVNSLAQVLAIVGATGSTFISFILPGLFAVVLIPKDNDFGKGKTL 402

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 134/334 (40%), Gaps = 49/334 (14%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D +P + S    S   L  RNV ITLV LFI  PL   R ++ L   SM           
Sbjct: 103 DLMPKIWSRV-SSSGLLLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLCI 161

Query: 229 XXXXXXXXXSGEY---KGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSL 285
                    + E    KG   +      P     + +  FA  CHHN   +    +N   
Sbjct: 162 LVIVHFAHQTTELRELKGEVSVGLPHGEPTPLTTLPIFVFAYTCHHNMFSVINEQKNTGF 221

Query: 286 KRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNML 345
                +  VS++++ ++ +    +G+L F D   GNI+  +P D       R+ +   ++
Sbjct: 222 TYVRYIAIVSILVAFVLYVVIGSTGYLTFGDNITGNIIALYP-DTLSTTIGRIAIVLLVM 280

Query: 346 TTFPLEIFVLRDVIRDIIYYNKD--------------------------------DPEPV 373
             FPL+    R+ I ++I Y +D                                D E  
Sbjct: 281 LAFPLQCHPARESINNMIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRANDKEEE 340

Query: 374 KLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKK- 432
            + TK   +IT+ ++     +A+S ++L  +L I+GAT ++ +++ILP      + G + 
Sbjct: 341 CMDTKRFMIITACILFCSYLLAISVTSLARVLAIVGATGSTTISFILPGYFGWSLIGTEY 400

Query: 433 KSLKEKLP---------YCGCI--VFGVILMFVS 455
            S   +LP         Y G +  ++G+I+M  S
Sbjct: 401 TSNGNQLPLRKSTVIFKYIGLVMTIWGIIIMITS 434

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/357 (23%), Positives = 146/357 (40%), Gaps = 72/357 (20%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D +P + S +  S+  L +R+  IT+V +FI  PL   + ++ L   SM           
Sbjct: 104 DLLPQIWSVW-TSNKLLLNRDFHITMVMIFIVAPLCFMKKLNSLRYASMIAISAVAYLCV 162

Query: 229 XXXXXXXXXS------GEYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRN 282
                            + KG   +      P I   + +  FA  CHHN     FS+ N
Sbjct: 163 LVIYHFIFQDPNDTHFQDLKGRISIGLPRDEPPILTTLPIFVFAYTCHHN----MFSVIN 218

Query: 283 PSL-KRFNQLTHV---SLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
             + ++FN +T +   S+ L+ ++ +   YSG+L F DK VGNI+  +P++ +     R+
Sbjct: 219 EQVDQKFNVITKIAKYSMSLAFLLYIVIGYSGYLTFGDKIVGNIVTLYPNNASS-TIGRI 277

Query: 339 LLGFNMLTTFPLEIFVLRDVIRDIIYY--------------------------------- 365
            +   +  TFPL+    R  I  II++                                 
Sbjct: 278 AIAILVTLTFPLQCHPARASIHHIIHFFQARSAENGNGSAMVLNQMEGVSPELETTPLTD 337

Query: 366 -----------NKDDPEPVK---LTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGAT 411
                       +  PE ++   L  K    IT  ++     +A+S ++L  +L I+GAT
Sbjct: 338 AANCAEVDTAIEEGSPEELQVMPLEGKRFIFITCTILFCSYLLAVSVTSLAKVLAIVGAT 397

Query: 412 SASLMAYILPPLTNLVITGKKKSLKEKLP-------YCG-CI-VFGVILMFVSTAQT 459
            ++ +++ILP +    + G +     +LP       Y G C+ V+G+++M  S   T
Sbjct: 398 GSTSISFILPGIFGYKLIGSECETGAELPFQTKMFKYLGLCLAVWGLVVMVASLTAT 454

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 92/440 (20%), Positives = 178/440 (40%), Gaps = 63/440 (14%)

Query: 76  MNMANSILGSGVIGQPFAMKNCGIIGGLF------ATILMSILVDWTIRLIVINLKLTGK 129
           + + ++  G+G++  P+A K  G++ G+       A  + S+L+   +   V      GK
Sbjct: 10  LTLLHTACGAGILAMPYAFKPFGLVPGVVMIVICGACAMQSLLIQARVARYVA----PGK 65

Query: 130 STYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRN 189
           +++ +++   +     ++  ++  +              D +P ++S++   +  L  RN
Sbjct: 66  ASF-STLTRLINPRLSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIMSSW-TGNAWLLSRN 123

Query: 190 VIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGE---YKG--T 244
           V I+L+ LF   PLS  + ++ L   SM                    S E    KG  +
Sbjct: 124 VQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLVHYVVPSDEILRLKGRVS 183

Query: 245 FHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCL 304
           +   Q          + +  FA  CHHN   I    ++   +   ++  +S+ L+  + +
Sbjct: 184 YLFPQQSHDLNFLNTLPIFVFAYTCHHNMFSIINEQKSVRFEHVMKIPLISISLALALYI 243

Query: 305 TTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIY 364
               +G+L F D  +GNI+  +P   +     R+ +   ++  FPL+    R  I  I+ 
Sbjct: 244 AIGCAGYLTFGDNIIGNIIMLYPQTVSS-TVGRIAIVLLVMLAFPLQCHPARASIHQILQ 302

Query: 365 Y-------------------NKDDP---------------EPV------KLTTKMHALIT 384
           Y                   N+  P               EP+       L  K   +IT
Sbjct: 303 YFTEENATTSTTSVAGRTVTNESSPLIRNNSIDINEVIEEEPIYQPKDTPLRGKSFIIIT 362

Query: 385 SGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLP---- 440
            G+++   C+A+S S+L  +L I+GAT ++ +++ILP L    + G +      LP    
Sbjct: 363 CGILVASYCVAISVSSLAHVLAIVGATGSTSISFILPGLFGYKLIGTEHKADIPLPTRLF 422

Query: 441 -YCGCIVFGVILMFVSTAQT 459
            Y G  +F + L+ + T  T
Sbjct: 423 KYSGLALFVLGLLIMVTCLT 442

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 120/303 (39%), Gaps = 42/303 (13%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D +P +  A F SH  L  RN+ ITLV LF+  PL   + +  L   SM           
Sbjct: 104 DLMPRIF-ATFTSHGLLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCV 162

Query: 229 XXXXXXXXXSGEYKGTFHLHQLFITP-----RIFQGISVISFALVCHHNTSFIFFSLRNP 283
                    S E +     H     P      +     +  FA  CHHN   I   LR+ 
Sbjct: 163 LVLVHYVWPSDEIR-ELRGHVSLGKPVGSFAALLSCFPIFVFAYTCHHNMFSIVNELRDN 221

Query: 284 SLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFN 343
           SLK   +++ +S+ L+  + L    SG+  F D   GNI+  +P         R+ +   
Sbjct: 222 SLKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYP-QSAATTVGRVAIALL 280

Query: 344 MLTTFPLEIFVLRDVIRDIIYY---------------------NKDDPEPV--------- 373
           ++  FPL+    R  +  I++Y                        D E +         
Sbjct: 281 VMLAFPLQCHPARASVDHILHYFGAGKSHEAAPSPSSESSQLIPSSDTEDIVVEEGGPRQ 340

Query: 374 ----KLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVIT 429
                L  K    IT+ ++L+   +A+S ++L  +L ++GAT ++ +++ILP +    + 
Sbjct: 341 LAVMPLEGKRFIAITTSILLLSYLLAISVTSLARVLAVVGATGSTSISFILPGIFGFQLI 400

Query: 430 GKK 432
           G +
Sbjct: 401 GSE 403

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 88/436 (20%), Positives = 175/436 (40%), Gaps = 67/436 (15%)

Query: 76  MNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWT--IRLIVINLKLTGKSTYQ 133
           + + ++  G+G++  P+A K  G+I G+   +L       +  I+  V      G++++ 
Sbjct: 10  LTLLHTACGAGILAMPYAFKPFGLIPGVIMIVLCGACAMQSLFIQARVAKYVPQGRASFS 69

Query: 134 ASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIIT 193
           A +   +    G++  ++  +              D +P ++S +   +  L +RNV I+
Sbjct: 70  A-LTRLINPNLGIVFDLAIAIKCFGVGVSYMIVVGDLMPQIMSVW-TRNAWLLNRNVQIS 127

Query: 194 LVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGE---YKGTFHLHQL 250
           L+ LF   PLS  + ++ L   SM                    S E    KG       
Sbjct: 128 LIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLLHYVAPSDEILRLKGRI---SY 184

Query: 251 FITPR-----IFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLT 305
            + P+     +   + +  FA  CHHN   I    R+   +   ++  +++ L+ I+ + 
Sbjct: 185 LLPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALILYIA 244

Query: 306 TAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYY 365
              +G+L F D  +GNI+  +P   +     R+ +   ++  FPL+    R  I  I+ +
Sbjct: 245 IGCAGYLTFGDNIIGNIIMLYPQAVSS-TIGRIAIVLLVMLAFPLQCHPARASIHQILQH 303

Query: 366 NKDD----------------------------------------PEPVKLTTKMHALITS 385
             ++                                        P+   L  K   +IT 
Sbjct: 304 FAEENVSISATSADEPTVATESSPLIRDSSLDLNEVIEEESIYQPKETPLRGKSFIVITC 363

Query: 386 GLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLP----- 440
            +++    +A+S S+L  +L I+GAT ++ +++ILP L    + G +   K  +P     
Sbjct: 364 SILVASYLVAISVSSLARVLAIVGATGSTSISFILPGLFGYKLIGTEH--KTAVPLTTKI 421

Query: 441 --YCGCIVF--GVILM 452
             Y G ++F  G+I+M
Sbjct: 422 FKYTGLLLFIWGLIIM 437

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 134/355 (37%), Gaps = 63/355 (17%)

Query: 169 DSIPHVLSAFFPSHTDLFH----RNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXX 224
           D +P +LS   P           RN  IT++ L I  PL   +++S L   SM       
Sbjct: 113 DLMPQILSHLIPESHSTSSLLLSRNFHITIMMLCIVSPLCFMKNLSSLRYASMVAISSVV 172

Query: 225 XXXXXXXXXXXXXSGE---YKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLR 281
                        S E    KG          P     + +  FA  CHHN   +     
Sbjct: 173 YLCVLVVFHFLSPSQEIKDLKGELSYWLPNNEPSPLVTLPIFVFAYTCHHNMFSVINEQI 232

Query: 282 NPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLG 341
           + S     +L  +++ L+  + +    SG+  F D  VGNI+  +P   +     R+ + 
Sbjct: 233 DNSFHNIKKLAIIAMSLAFSLYIIIGGSGYYTFGDNIVGNIITLYPQSVSS-TIGRMAIV 291

Query: 342 FNMLTTFPLEIFVLRDVIRDIIYY--------------------------NKD------- 368
           F +   FPL+    R  I  II Y                          N++       
Sbjct: 292 FLVTLAFPLQCHPARASIHHIILYITMKINDAKEIKPSNPQQEPLALSANNQERAMLIRS 351

Query: 369 -------------DPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASL 415
                         P  V L  K   LIT+ +++    +A+S S+L  +L I+GAT ++ 
Sbjct: 352 ERSDTLIEEESPLQPVTVPLEGKQFILITTSILICSYLLAISVSSLAHVLAIVGATGSTS 411

Query: 416 MAYILPPLTNLVITGKKKSLKEKLP-------YCGCI--VFGVILMFVSTAQTIL 461
           +++ILP +    + G +    E+LP       Y G +  ++GV +M  S A +IL
Sbjct: 412 ISFILPGVFGYKLIGSEMLTTEQLPIKTRLFKYSGLLLSIWGVFIMITSLAASIL 466

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 113/440 (25%), Positives = 193/440 (43%), Gaps = 68/440 (15%)

Query: 66  EAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVD----WTIRLIV 121
           E K++   +F+ +  S +G+GV+  P A  N    GGLF +I+M +       W   L+V
Sbjct: 269 EQKTSTLKSFLLLLKSFVGTGVLFLPSAFHN----GGLFFSIVMIMFFGVYSFWCYYLLV 324

Query: 122 INLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPS 181
               +TG +++    +   G W   +IL+S  L               +      AF  +
Sbjct: 325 RVKTITGLTSFGNMGQRVFGPWMKFIILLSLILSQLGFGSTYVIFTAKN----FKAFIEN 380

Query: 182 HTDLFHRNVIITLVTLFISF-PLSLNRDISKLSKTSMXXXXXXXXXXXXXXX-XXXXXSG 239
            T++   N+I  ++  FI F PLS  R +SKL+  S+                     +G
Sbjct: 381 VTNIKDFNIIYPILLQFIIFVPLSYIRRVSKLTLPSLIANGFILIGLSLVIYFSIDHLAG 440

Query: 240 EYKG-----------TFHLHQLFITPRIF--QGISVISFALVCHHNTSFIFFSLRNPSLK 286
           +  G           T H   LFI   IF  +GI +I    +   N      S+R+PS  
Sbjct: 441 DLHGKPADGIISFFNTKHW-TLFIGTAIFAFEGIGLI----IPLQN------SMRDPS-- 487

Query: 287 RFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLT 346
           +F  +  + +I + ++ +  A  G+L++   T   IL NFP  + V+N  +L     +L 
Sbjct: 488 KFPLVLGLVMICTTVMFIIIATIGYLSYGSSTETIILQNFPQKNIVVNLIQLFYALAILL 547

Query: 347 TFPLEIFVLRDVIRDIIYYNK-DDPE---PVKLTTKMHALITSGL------------VLI 390
           + PL+IF   +++ D I+     DPE    + +TT  +A  + GL             +I
Sbjct: 548 STPLQIFPAIEIVEDKIFPKPGSDPECKDEIPITTIYNAN-SGGLDWRIKWFKNMIRTMI 606

Query: 391 IMCIAL----STSNLGALLEIIGATSASLMAYILPPLTNL------VITGKKKSLKEKLP 440
           + C+ L     ++NL  L+ IIG+ +   + Y+ PP+ +L      +  GK+ +  +   
Sbjct: 607 VTCVILLAYFGSNNLDKLVAIIGSLACIPLVYMYPPMLHLKTYSIPMSKGKRFTWSKSFD 666

Query: 441 YCGCIVFGVILMFVSTAQTI 460
           Y   IVFG + M  +T Q+I
Sbjct: 667 YI-LIVFGGVSMVYTTYQSI 685

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 85/431 (19%), Positives = 171/431 (39%), Gaps = 77/431 (17%)

Query: 76  MNMANSILGSGVIGQPFAMKNCGIIGGLF------ATILMSILVDWTIRLIVINLKLTGK 129
           + + ++  G+G++  P+A +  G+  GLF      A  ++ +++  T+   V        
Sbjct: 10  LTLLHTACGAGILAMPYAFQPFGVFPGLFLIAFCGACAMLGLILQSTVAKYVPE----RN 65

Query: 130 STYQASVETAMGQWGGLL-ILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLF-H 187
           +++ A  +    ++  L  I ++   F             D +P +L  F  + T+ F +
Sbjct: 66  ASFFALSQVTNPKFSVLFDIAIAVKCFGVGVSYMIVVG--DVMPQILGTF--TDTEFFLN 121

Query: 188 RNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGT--- 244
           RNV IT+V LFI  PL   ++++ L   S+                    + E + T   
Sbjct: 122 RNVNITIVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLCFLVMFHFFIPNEEIRDTRGP 181

Query: 245 --FHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIV 302
             +   +  + P     + +  FA  CHHN   +    ++    +  Q+   +++L+C +
Sbjct: 182 VSWGFPKDGLNP--LNTLPIFVFAYTCHHNMFSVINEQQDIHFNKLKQICIFAMLLACTL 239

Query: 303 CLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDI 362
            +    SG+L F +   GNI+  + S+       R+ +   ++  FPL+    R  I  I
Sbjct: 240 YIIIGGSGYLTFGNAITGNIITLY-SNSAATTVGRIAIVILVMLAFPLQCHPARASINHI 298

Query: 363 IYY--------------------------NKDDP-------------------------- 370
           ++Y                          N+  P                          
Sbjct: 299 LHYFQLINCDNNQVQESESGHRESSGLIDNEITPQPQLQEAFEQPPDEVVEEEFPEQQKS 358

Query: 371 -EPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVIT 429
            EPV L  K   ++T  +++    +A+S ++L  +L I+GAT ++ +A+ILP +    + 
Sbjct: 359 FEPVTLDPKTFTVVTICILICSYILAVSVTSLAKVLAIVGATGSTSIAFILPGVFGYQLI 418

Query: 430 GKKKSLKEKLP 440
           G + S  + +P
Sbjct: 419 GSEYSTSQIVP 429

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/337 (21%), Positives = 130/337 (38%), Gaps = 70/337 (20%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D +P + S F  SH  L  RN  IT+V +FI  PL   + +  L   SM           
Sbjct: 146 DLLPQIFSNF-TSHEILLERNFHITVVMIFIVAPLCFMKRLDSLRYASMIAISAVGYLCV 204

Query: 229 XXXXXXXXXSGE---YKGTFHLHQLFITPR-----IFQGISVISFALVCHHNTSFIFFSL 280
                    S E    KGT  L +    P+     +     +  FA  CHHNT  I   L
Sbjct: 205 LVVAHFLFPSQEIKDLKGTVSLFR----PKGLHTSMLSSFPIFVFAYTCHHNTFSIVNEL 260

Query: 281 RNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLL 340
           ++ S++   ++   ++ L+  + +    SG+  F D   GNI+  +P   +     R+ +
Sbjct: 261 KDNSVENVRKVVIGAMGLAVCLYIAIGGSGYGTFGDNIGGNIIMLYPHSTST-TVGRIAI 319

Query: 341 GFNMLTTFPLEIFVLRDVIRDIIYY----------------------NKDD--------- 369
              ++  FPL+    R  I  II++                      N+ D         
Sbjct: 320 VLLVMLAFPLQCHPARASINHIIHHLFEERRGGAQNGEERESNAASKNRTDESACNGNSE 379

Query: 370 -------------------------PEPVKLTTKMHALITSGLVLIIMCIALSTSNLGAL 404
                                    P+ V L  +   +ITS +++    +A+S ++L  +
Sbjct: 380 SSRLVQSTETSIPVDELIEECSARQPKVVPLEGRKFVVITSCILIFSYALAVSVTSLARV 439

Query: 405 LEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPY 441
           L ++GAT ++ +++ILP +    + G +     ++P+
Sbjct: 440 LAVVGATGSTSISFILPGIFGYQLIGSEYENTSEMPW 476

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 114/294 (38%), Gaps = 61/294 (20%)

Query: 185 LFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSG---EY 241
           L +R+  ITLV +F+  PL L + ++ L  TS                      G   + 
Sbjct: 120 LLNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCVLVIIHLVSSDGDIEQM 179

Query: 242 KGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLI---L 298
           KG   +      P     + +  FA  CHHN   +F  +      RF    ++ LI   L
Sbjct: 180 KGHVSIGLPHHGPSPLTTLPIFVFAYTCHHN---MFSVINEQKDNRFKTTKYIPLISTSL 236

Query: 299 SCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDV 358
           +CI+ +     G++ F DK VGNI+  +P   + I   R+ +   +   FPL+    R  
Sbjct: 237 ACILYILIGGCGYMTFGDKIVGNIITLYPHSVSSI-IGRIAIALLVTLAFPLQCHPARSS 295

Query: 359 IRDIIYY----------NKDDPE------------------------------------- 371
           I +I+ +          N  +P                                      
Sbjct: 296 IHNILAFFYPSLNPDLKNTQEPTANADTMSSSQLLATERTPLVRSISSIEDNELAEEQGS 355

Query: 372 ----PVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILP 421
               P+++  K+   IT+ +++    +A+S  +L  +L I+GAT ++ +++ILP
Sbjct: 356 IKDVPIEMERKLFLAITAAILIPSYLVAMSVHSLDKVLAIVGATGSTSISFILP 409

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 121/309 (39%), Gaps = 47/309 (15%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D +P ++S +  ++  L  RNV I+L+ LF   PL   + ++ L   SM           
Sbjct: 104 DLMPQIMSVW-TNNAWLLSRNVQISLIMLFFVTPLCFLKKLNSLRYASMIAISSVAYLCA 162

Query: 229 XXXXXXXXXSGEYKGTFHLHQLFITPR-----IFQGISVISFALVCHHNTSFIFFSLRNP 283
                    S +          F  P+     +   + +  FA  CHHN   I    R+ 
Sbjct: 163 LVLVHYIAPSEDILRLRGQISYFFPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSS 222

Query: 284 SLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFN 343
             +   ++  +++ L+ I+ +    +G+L F D  +GNI+  +P   +     R+ +   
Sbjct: 223 RFEHIMKIPLIAVSLALILYIAIGCTGYLTFGDNIIGNIIMLYPQTVSS-TVGRIAIVLL 281

Query: 344 MLTTFPLEIFVLRDVIRDIIYYNKDD---------------------------------- 369
           ++  FPL+    R  I  I+ + + +                                  
Sbjct: 282 VMLAFPLQCHPARASIHQILQHLERENITTSTTSVSGPTFANENSPLMGDRGLDINEVIE 341

Query: 370 ------PEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPL 423
                 P+   L  K    IT G++L    +A+S S+L  +L I+GAT ++ +++ILP L
Sbjct: 342 EESIYQPKETSLKGKSFVFITCGILLASYLVAISVSSLARVLAIVGATGSTSISFILPGL 401

Query: 424 TNLVITGKK 432
               + G +
Sbjct: 402 FGYKLIGTE 410

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 127/321 (39%), Gaps = 57/321 (17%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D +P ++S +   +  L  RNV I+L+ +F+  PLS  + ++ L   SM           
Sbjct: 104 DLMPQIMSVW-TRNAWLLSRNVQISLIMVFLVAPLSFLKKLNSLRYASMIAISSVAYLCV 162

Query: 229 XXXXXXXXXSGE---YKGTFHLHQLFITPR------IFQGISVISFALVCHHNTSFIFFS 279
                    S E    KG       +  P+      I     +  FA  CHHN   I   
Sbjct: 163 LVLVHYIAPSEEILHMKGRIS----YFFPKQSHDLNILNTFPIFVFAYTCHHNMFSIINE 218

Query: 280 LRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLL 339
            R+   +   ++  +++ L+ I+ +    +G+L F D  +GNI+  +P   +     R+ 
Sbjct: 219 QRSSRFEHVMKIPLIAISLALILYVAIGCAGYLTFGDNIIGNIIMLYPQTTSS-TVGRVA 277

Query: 340 LGFNMLTTFPLEIFVLRDVIRDIIYYNKDD------------------------------ 369
           +   ++  FPL+    R  I  I+ +  ++                              
Sbjct: 278 IVLLVMLAFPLQCHPARASIHQILQHFTEENATISTTSTSSPAPTNESSPLIRDNSLDIN 337

Query: 370 ----------PEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYI 419
                     P+   L  K   +IT  +++    +A+S S+L  +L I+GAT ++ +++I
Sbjct: 338 EVIEEESIYQPKETPLKGKSFIVITCAILIASYFVAISVSSLARVLAIVGATGSTSISFI 397

Query: 420 LPPLTNLVITGKKKSLKEKLP 440
           LP L    + G +   KE +P
Sbjct: 398 LPGLFGYKLIGTEH--KEGIP 416

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 89/451 (19%), Positives = 178/451 (39%), Gaps = 60/451 (13%)

Query: 69  SNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTG 128
           SN     + + ++  G+GV+  PFA K  G++ GL    +  I     + L     K   
Sbjct: 3   SNVRSGVLTLLHTACGAGVLAMPFAFKPFGLMPGLITLTICGICSLCGLLLQTRIAKYVP 62

Query: 129 KSTYQ--ASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFF------- 179
           KS     A +   +     ++   +  +              D +P ++S+         
Sbjct: 63  KSENVSFAKLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLMPQIVSSILYRDHDST 122

Query: 180 ---PSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXX 236
                H  +  R + I+L+ LF+  PL   + ++ L   SM                   
Sbjct: 123 GGPQEHHGILDRRLYISLIMLFVIAPLCFKKSLNSLRHASMIAIISVAYLSGLIIYHFLN 182

Query: 237 XSGEYKGTFHL---HQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTH 293
                +G  +    H+   +      + +  FA  CHHN   +     +   +   ++  
Sbjct: 183 RHQLERGQVYFMVPHRDTESHAPLTTLPIFVFAYTCHHNMFSVINEQADKGFRILKRIPI 242

Query: 294 VSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIF 353
           +++ L+ ++ +    +G++ F    VGNIL  +P+  +     RL +   ++  FPL+  
Sbjct: 243 IAISLAFVLYVIIGGAGYMTFGKNIVGNILTLYPNSVST-TIGRLAMLLLVMLAFPLQCH 301

Query: 354 VLRDVIRDIIYY-----------NKDDPEPVKLTTKMHALITSGLV-------------- 388
             R  I++II +           N+DD  P+ + + +++   S                 
Sbjct: 302 PCRSSIKNIIIFIENFRKGKLQENRDDCIPLDVLSSVNSQEESRQQNNEQQNFPSESSRH 361

Query: 389 --LIIMCI-------ALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKK-SLKEK 438
             +I +CI       A+S ++L  +L I+GAT ++ +++ILP L    + G +  S  E+
Sbjct: 362 TNIITLCILGSSYLLAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEYISRDER 421

Query: 439 LP-------YCGCIVF--GVILMFVSTAQTI 460
           +P       Y G ++F  G+++M  S + T+
Sbjct: 422 VPASVKILKYLGLLLFIWGIVVMIASLSATV 452

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/339 (22%), Positives = 130/339 (38%), Gaps = 57/339 (16%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D  P + S F  +H  L  RNV ITL+ LFI  PL   + +S L   S+           
Sbjct: 104 DLTPQIASVFTSNHL-LLDRNVHITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYLCV 162

Query: 229 XXXXXXXXXSGE---YKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSL 285
                    S E    KG   L            + +  FA  CHHN   +    ++ S 
Sbjct: 163 LIFIHFVWPSEEIHDLKGHVSLWIPHDETNPLTTLPIFVFAYTCHHNMFSVINEQKDTSF 222

Query: 286 KRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNML 345
           +   ++   ++ L+  + L     G+L F D  +GNI+  +P   +     R+ +   ++
Sbjct: 223 RHIKKVAIYAMFLALSLYLLIGGMGYLTFGDHIIGNIIKLYPQFAST-TVGRIAIVLLVM 281

Query: 346 TTFPLEIFVLRDVIRDIIYY---------------------------------------- 365
             FPL+    R  I  I++Y                                        
Sbjct: 282 LAFPLQCHPARASINHILFYLQEHLSQSKQNTRTDNTANAVDEASTLIVNGDQEYMIDEL 341

Query: 366 ----NKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILP 421
               + + P  V L  +   +IT  L+L    +A+S S+L  +L ++G+T ++ +++ILP
Sbjct: 342 IEEDSANQPPVVPLHGRKFVIITIFLLLASYLLAISVSSLARVLAVVGSTGSTSISFILP 401

Query: 422 PLTNLVITGKKKS-----LKEKL-PYCG--CIVFGVILM 452
            +    + G +        K KL  Y G    V+GV++M
Sbjct: 402 GIFGYQLIGSEVDSGSLPFKTKLFKYAGLALAVWGVVVM 440

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/343 (21%), Positives = 132/343 (38%), Gaps = 60/343 (17%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D +P ++S F  S+  L  R + ITL  LFI  PL   R +  L   SM           
Sbjct: 104 DLMPQIVSTF-TSNQWLLERTLQITLCMLFIVTPLCFMRKLDSLRYASMVAISSVAYLCV 162

Query: 229 XXXXXXXXXSGEYKGTFHLHQLFI-----TPRIFQGISVISFALVCHHNTSFIFFSLRNP 283
                    S + +    +  +          +     +  FA  CHHN   I   LR+ 
Sbjct: 163 LVVYHFLFPSSDIRQAKGIVSIGFPENNSAASMLSSFPIFVFAYTCHHNMFSIVNELRDN 222

Query: 284 SLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFN 343
           SL    ++  +++ L+  +      SG+L F D   GNI+  +P   +    AR+ +   
Sbjct: 223 SLTNCVRVVLIAMGLAVSLYTVIGGSGYLTFGDNITGNIVTIYPRSVSS-TLARIAIVLL 281

Query: 344 MLTTFPLEIFVLRDVIRDIIYY-------------------NKDDP-------------- 370
           ++  FPL+    R  I +I  Y                   ++  P              
Sbjct: 282 VMLAFPLQCHPARASINNIWCYFSESKIFSPLANEESGLMRHEGSPRTPPSNNEFSISPD 341

Query: 371 --------EPVKLTTKMHA----LITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAY 418
                   +P+  TT +      +IT+ +++    +A+S S+   +L I+GAT ++ +++
Sbjct: 342 WSPLQTSSQPIPTTTTIEGKRFFVITTSILIASYTLAVSVSSFARVLAIVGATGSTSISF 401

Query: 419 ILPPLTNLVITGKKKSLKE--------KLPYCGCIVFGVILMF 453
           ILP +      G + S K+        K       ++G+I+MF
Sbjct: 402 ILPGIFGYHFVGSEYSAKDIPRNLKILKYLAFALTIWGIIVMF 444

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 93/453 (20%), Positives = 173/453 (38%), Gaps = 62/453 (13%)

Query: 68  KSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLT 127
            SN     + + ++  G+GV+  PFA K  G++ GL       I     + L     K  
Sbjct: 2   SSNVLSGVLTLLHTACGAGVLAMPFAFKPFGLMPGLITLTFCGICSLCGLLLQTRIAKYV 61

Query: 128 GKSTYQASVETAMGQWGGLLILVSNGLFAXX---XXXXXXXXXXDSIPHVLSAFF----- 179
            KS   AS           L +V +   A               D +P ++ + F     
Sbjct: 62  PKSE-NASFAKLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLVPQIVQSIFYHNDD 120

Query: 180 -----PSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXX 234
                  H  L  R + ITLV +F+  PL   R ++ L   SM                 
Sbjct: 121 STGGLQEHHRLLDRRLYITLVMMFVIAPLCFKRSLNSLRYASMIAIISVAYLSGLIIYHF 180

Query: 235 XXXSGEYKGTFHL---HQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQL 291
                  +G  +    H+   +      + +  FA  CHHN   +     + + +   ++
Sbjct: 181 LNRHQLERGQVYFMVPHRDSSSHSPLTTLPIFVFAYTCHHNMFSVINEQTDKTFRILRRI 240

Query: 292 THVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLE 351
              ++  + I+ L    +G++ F +  VGNIL  +P+  +     RL +   ++  FPL+
Sbjct: 241 PIFAISFAYILYLIIGGAGYMTFGENIVGNILTLYPNSIST-TIGRLAMLLLVMLAFPLQ 299

Query: 352 IFVLRDVIRDIIY----------------------YNKDDPE-----------PVKLTTK 378
               R  I++I                        +N ++P             ++  ++
Sbjct: 300 CHPCRSSIKNIFIFIEDFRKGRLHDNRTGFIPLDDFNSEEPHDELSQQSSEGPTLRSESQ 359

Query: 379 MHALITSGLVLIIMCI-ALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKK-KSLK 436
            H  + +  VL+   I A+S ++L  +L I+GAT ++ +++ILP L    + G +  +  
Sbjct: 360 RHTNVITLCVLVFSYILAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTNRN 419

Query: 437 EKLP-------YCGCIVF--GVILMFVSTAQTI 460
           E++P       Y G  +F  G+++M  S + T+
Sbjct: 420 ERVPVSIKIFKYLGLSLFIWGLVIMIASLSATV 452

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/312 (20%), Positives = 126/312 (40%), Gaps = 50/312 (16%)

Query: 169 DSIPHVLSAFF----------PSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMX 218
           D +P +LS+              H     R + I+LV +F+  PL   + ++ L   SM 
Sbjct: 105 DLMPQILSSILYRNDDSTGDSQEHHMFLDRRLCISLVMMFVIAPLCFKKSLNSLRHASMI 164

Query: 219 XXXXXXXXXXXXXXXXXXXSGEYKGTFHL---HQLFITPRIFQGISVISFALVCHHNTSF 275
                              S   +G  +    HQ   +      + +  FA  CHHN   
Sbjct: 165 AIVSVAYLCGLIIFHFLYRSELERGQVYFMTPHQDAQSHSPLTTLPIFVFAYTCHHNMFS 224

Query: 276 IFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINF 335
           +     + S K   ++  +++ L+ ++ +    +G++ F D  VGNI+  +P +      
Sbjct: 225 VINEQADKSFKILRRIPILAISLAYVLYVVIGGTGYMTFGDNIVGNIITLYP-NSIYTTI 283

Query: 336 ARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNK----------------------DDPE-- 371
            RL +   +   FPL+    R  I+++I + K                      +DP+  
Sbjct: 284 GRLAMLLLVTLAFPLQCHPCRSSIKNMIVFIKNLRKDKTDDSTAGFIPLDDLSSEDPQEE 343

Query: 372 -----------PVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYIL 420
                      P++ +++   +IT  +++    +A+S ++L  +L I+GAT ++ +++IL
Sbjct: 344 VAQQNNEQSNLPIE-SSRQTNVITLCILIFSYLLAISITSLAKVLAIVGATGSTSISFIL 402

Query: 421 PPLTNLVITGKK 432
           P L    + G +
Sbjct: 403 PGLFGYKLIGSE 414

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 85/426 (19%), Positives = 161/426 (37%), Gaps = 59/426 (13%)

Query: 69  SNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTG 128
           SN     + + ++  G+GV+  PFA K  G++ GL       I     + L     K   
Sbjct: 3   SNVRSGVLTLLHTACGAGVLAMPFAFKPFGLMPGLITLTFCGICSLCGLLLQTRIAKYVP 62

Query: 129 KSTYQ--ASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFF------- 179
           KS     A +   +     ++   +  +              D +P ++ + F       
Sbjct: 63  KSENASFAKLTQLINPSISVVFDFAIAVKCFGVGVSYLIIVGDLVPQIVQSIFYRNDDNM 122

Query: 180 ---PSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXX 236
                H     R + ITL+ +F+  PL   R ++ L   SM                   
Sbjct: 123 SGSQEHHMFLDRRLYITLIIVFVISPLCFKRSLNSLRYASMIAIVSVAYLSGLIIYHFVN 182

Query: 237 XSGEYKGTFHLHQLFITPR-------IFQGISVISFALVCHHNTSFIFFSLRNPSLKRFN 289
                +G  +    F+ P            + +  FA  CHHN   +     + S K   
Sbjct: 183 RHQLERGQVY----FMVPHGDSQSHSPLTTLPIFVFAYTCHHNMFSVINEQVDKSFKVIR 238

Query: 290 QLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFP 349
           ++   +++L+  + +    +G++ F +  VGNIL  +P+  +     RL +   ++  FP
Sbjct: 239 RIPIFAIVLAYFLYIIIGGTGYMTFGENIVGNILTLYPNSIST-TIGRLAMLLLVMLAFP 297

Query: 350 LEIFVLRDVIRDIIYY----------------------NKDDPE--PVKLTTKMHALITS 385
           L+    R  +++II +                      N +DP+  P +   +   L + 
Sbjct: 298 LQCHPCRSSVKNIIIFIENFRKGKLYDNRASFIPLDNFNSEDPQEAPTQQNNEEPNLRSE 357

Query: 386 GLV---LIIMCI-------ALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKK-KS 434
            L    +I +CI       A+S ++L  +L I+GAT ++ +++ILP L    + G +   
Sbjct: 358 SLRHINIITLCILLFSYLLAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTG 417

Query: 435 LKEKLP 440
             E++P
Sbjct: 418 TNERVP 423

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/352 (22%), Positives = 135/352 (38%), Gaps = 65/352 (18%)

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXX 228
           D +P ++S F  +H  L  R   IT VTL I  PL   + +  L  TS            
Sbjct: 104 DLLPQIMSTF-TTHGWLLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYLCV 162

Query: 229 XXXXXXXXXSGEYKGTFHL--HQLFITPR-----IFQGISVISFALVCHHNTSFIFFSLR 281
                    + E     HL  H     P      +     +  FA  CHHN   I     
Sbjct: 163 LVVFHFAVPNSEID---HLRGHVSIWKPSDVDSSMLSSFPIFVFAYTCHHNMFSIINEQS 219

Query: 282 NPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLG 341
           + SL    +L  +++ L+  + ++    G+  F D   GNI+  +P+  +     R+ + 
Sbjct: 220 DKSLDSITKLIRIAITLAMSLYISIGALGYCTFGDHITGNIITLYPNSISS-TIGRIAIA 278

Query: 342 FNMLTTFPLEIFVLRDVIRDIIYY------------------------------------ 365
             ++  FPL+    R  +  I++Y                                    
Sbjct: 279 LLVILAFPLQCHPARASVNHILHYFSKGNTHPPMTTTSAEQNSLLRDSELESSEQLTYEC 338

Query: 366 --------NKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMA 417
                   + + P  V L       ITSG++L    +A+S ++L  +L I+GAT ++ ++
Sbjct: 339 EDELIEENSANQPPVVTLEGPRFIFITSGILLFSYILAMSVTSLANVLSIVGATGSTSIS 398

Query: 418 YILPPL--TNLVITGKKKSL----KEKLPYCGCI---VFGVILMFVSTAQTI 460
           +ILP +    L+ +   KS+    KE++     +   ++G I+M  S + TI
Sbjct: 399 FILPGIFGYKLIASEYAKSVVPPAKERILRIISLLLAIWGFIVMITSLSATI 450

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 112/289 (38%), Gaps = 35/289 (12%)

Query: 185 LFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGT 244
           L  RNV IT  T  +  PL   R +  L   SM                    S E +  
Sbjct: 119 LLDRNVQITFWTAAVIAPLCCMRHLHSLKYASMVAVAAVAYLGALVAARAAWPSPELERL 178

Query: 245 FHLHQLFITPRIFQGISVISF-----ALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILS 299
                L + P    G  + SF     A  CHHN   I   LR+ SL    ++   ++ L+
Sbjct: 179 RGPVSLGLPPGTSGGAMLSSFPIFVFAYTCHHNMFSIVNELRDNSLGACLRVVVAAIALA 238

Query: 300 CIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVI 359
             +  T   +G+L F D   GNI+  +P         R  +   ++  FPL+    R  I
Sbjct: 239 VALYATIGGAGYLTFGDHITGNIIAQYPPAP-ATTLGRAAIAVLVMLAFPLQCHPARASI 297

Query: 360 RDIIYY----------------------------NKDDPEPVKLTTKMHALITSGLVLII 391
             I +Y                              ++P  V L     A IT+ L++  
Sbjct: 298 NHIWHYCIPSHTVAPSEASALIRGGSPPADAAEGPGNEPAAVPLGPPRFAAITAALLIAS 357

Query: 392 MCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLP 440
             +A+S ++L  +L ++GAT ++ +++ILP L    + G  +S  ++LP
Sbjct: 358 YAVAVSVTSLARVLAVVGATGSTAISFILPGLFGYQLIG-SESRADQLP 405

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 104/472 (22%), Positives = 191/472 (40%), Gaps = 59/472 (12%)

Query: 34  DDTAKTADSAVDQN---IFNVNEEDPLTDD---IYLSNEAKSNRYMAFMNMANSILGSGV 87
           DD A   D   +++   + N ++ + L  +   I   ++ K++ + AF+ M  S +G+GV
Sbjct: 264 DDFAVDEDDEFNESEVPLLNASDRERLGHNKRVIARPSQVKTSTFKAFLLMLKSFIGTGV 323

Query: 88  IGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLL 147
           +  P A  N G+I  +       +   W   +++ +   TG S++        G W    
Sbjct: 324 LFLPSAFANGGLIFSVLMLSFFGMYSYWCYYILIRSKVATGVSSFGDIGIKLYGPWMRYA 383

Query: 148 ILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNR 207
           IL S  L               ++       F  H+ L   +++I    +FI  PL+  R
Sbjct: 384 ILASLILTQLGFSAAYVVFTCKNLLAFFQNVFHLHS-LRIEHLLILQTIIFI--PLAFIR 440

Query: 208 DISKLSKTS-------MXXXXXXXXXXXXXXXXXXXXSGE----YKGTFHLHQLFITPRI 256
           ++SKLS TS       M                      E    Y        LFI   I
Sbjct: 441 NVSKLSLTSLLANFFTMAGLIIIVFFVVKHLVIDLDLKPEAGIIYGFNSSKWSLFIGTAI 500

Query: 257 F--QGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNF 314
           F  +GI +I    +   +      S+R P  ++F  +  + ++ + ++ ++ A  G+L F
Sbjct: 501 FAFEGIGLI----IPVQD------SMRKP--EKFPLVLGLVILTATVLFISIAALGYLAF 548

Query: 315 KDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVI---------RDIIYY 365
                  IL N P D+  +N  +      +L + PL++F    +I         + +   
Sbjct: 549 GRYIETVILLNLPQDNIFVNLVQFFYSLAILLSTPLQLFPAIGIIESKLVPKFRKTVSPT 608

Query: 366 NKDD----PEPVKLTTKMHA---LITSGLVLIIMCIA-LSTSNLGALLEIIGATSASLMA 417
           NK+D    P   KL  K+      + S +V+ ++C+A   +S L   +  IG  +   + 
Sbjct: 609 NKNDVQLSPNSGKLDWKVKWTKNFLRSIIVIFVICLAYFGSSKLDVFVSFIGCFACIPLV 668

Query: 418 YILPPLTNLVITG-----KKKSLKEKLPYC---GCIVFGVILMFVSTAQTIL 461
           Y+ PPL +L         + ++LK +L      G ++FG + M  ++ Q I+
Sbjct: 669 YMYPPLLHLKSCSQPAYKQNQTLKNRLMITMDYGLVIFGGVSMLYTSYQCIM 720

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 92/209 (44%), Gaps = 26/209 (12%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S+R+P  ++F  +  + +  S ++ +T A  G+L +       IL N P  +  +N  + 
Sbjct: 509 SMRHP--EKFPMVLALVIGSSTVLFITIASIGYLAYGSAIETVILLNLPQKNVFVNLIQF 566

Query: 339 LLGFNMLTTFPLEIFVLRDVIRDI-------IYYNKDD--------PEPVKLTTKMHALI 383
                ++ + PL++F    +I +        IY  KDD        P   KL  K+  L 
Sbjct: 567 FYSLAIMLSTPLQLFPAIKIIENKVFPKFTKIYVKKDDDTTDIQLRPNSGKLNWKVKWLK 626

Query: 384 TSGLVLIIMCIAL----STSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKL 439
            S   +I+  + L        L   + IIG+ +   + Y+ PP+ +L    + +S  +K 
Sbjct: 627 NSVRAIIVALVILMAYYGADKLDKFVSIIGSFACIPLVYMYPPMLHLQSYSRPRSAGQKF 686

Query: 440 PY-----CGCIVFGVILMFVSTAQTILEA 463
           P+     C  IVFG + M  ++ Q+I  +
Sbjct: 687 PWRSIVDCVLIVFGGVSMCYTSYQSIFAS 715

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 103/475 (21%), Positives = 194/475 (40%), Gaps = 59/475 (12%)

Query: 32  SFDDTAKTADSAVDQNIFNVNEEDPL--------TDDIYLSNEAK--SNRYMAFMNMANS 81
           SF+D   T +S  D+ I   +E  PL           IY+   AK  ++   AF+ M  S
Sbjct: 259 SFEDEFYTEESTSDEGI---DERSPLLARTQAETGKRIYVPKSAKGTTSTMKAFLLMIKS 315

Query: 82  ILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMG 141
            +G+GV+  P A  N G++  L   I       W   ++  +   T  +++     T  G
Sbjct: 316 FIGTGVLFLPGAFSNGGLVFSLIMLIFFGTYSFWCYYILTQSKVATRVASFGDIGLTLYG 375

Query: 142 QWGGLLILVSNGLFAXXXXXXXXXXXXDS-IPHVLSAFFPSHTDLFHRNVIITLVTLFIS 200
            W   +IL+S  +               + +  V + F+     + H    +  + L I 
Sbjct: 376 PWMKFIILLSLVMTQLGFSGAYVVFTAKNLLAFVNNVFYWPGVTIVH----LLALQLVIF 431

Query: 201 FPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXX---SGEYKGTFHLHQLFITPR-- 255
            PLS  R+I+KLS +S+                          +K    +   F + R  
Sbjct: 432 IPLSFIRNIAKLSLSSLVANFLVMGGIVIVIGFTAKHLFFDLNFKPAEDIVMGFNSSRWT 491

Query: 256 IFQGISVISF---ALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFL 312
           ++ G ++ +F    L+       I  S+++P  ++F  +  + +I + ++ +T    G+L
Sbjct: 492 LYVGTAIFAFEGIGLIIP-----IQGSMKHP--EKFPLVLALVIISATVLFVTVGTLGYL 544

Query: 313 NFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRD-------IIYY 365
           ++  KT   IL N P  + ++N  +      +L + PL++F    +I +        IY 
Sbjct: 545 SYGAKTETVILLNLPQGNILVNLIQFFYSSAILLSTPLQLFPAIAIIENKVFPKFTKIYV 604

Query: 366 NKDD-------PEPVKLTTKMHAL---ITSGLV-LIIMCIALSTSNLGALLEIIGATSAS 414
            + D       P   KL  ++  L   + S +V L+++       +L   + I+G+ +  
Sbjct: 605 KRSDHTKVHYKPNSGKLDWRVKWLKNFVRSLIVSLVVIAAYFGADHLDTFVSIVGSFACI 664

Query: 415 LMAYILPPLTNLVITGK-----KKSLKEKLPYC---GCIVFGVILMFVSTAQTIL 461
            + YI PP+ +L    +     + S+ +K P       I+FG I M  ++ Q+I 
Sbjct: 665 PLVYIYPPMLHLESCSRPACQNETSIWKKWPMAVDYVLIIFGAIGMVYTSYQSIF 719

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 65/140 (46%)

Query: 242 KGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCI 301
           +G     +++    +    S+I FA V   N   I   L++ S+    ++   S+++S I
Sbjct: 178 RGEISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNVRKVVDSSILISTI 237

Query: 302 VCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRD 361
           + L     G+L F   T+GNIL N+ SD   I   +  L   ++ TFPL    LR  I +
Sbjct: 238 LFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTFPLLFHPLRTAINN 297

Query: 362 IIYYNKDDPEPVKLTTKMHA 381
           I+ +     E   LT ++ A
Sbjct: 298 IVVWFIIKFEKSSLTPEISA 317

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 92/432 (21%), Positives = 168/432 (38%), Gaps = 88/432 (20%)

Query: 76  MNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQAS 135
           + + ++  G+G++  P+A K  G+I G+   ++ S      + L V   K T      + 
Sbjct: 8   ITLLHTACGAGILAVPYAFKPFGVIPGMLILLVCSSTAILGLLLQVKVTKYTPVGEKHSF 67

Query: 136 VETAMGQWGGLLIL--VSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIIT 193
            E A      L +L  ++  +              D +P +L      H+   +R ++IT
Sbjct: 68  FELASKIHPRLAVLFDIAIAIKCFGVATSYLIAVGDLLPTLL------HSS--NRFLLIT 119

Query: 194 LVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGE---YKGTFHL--- 247
           LV  FI  PLS  + I+ L  TS                     S E    +G   L   
Sbjct: 120 LVWGFIIAPLSFLKKITALRYTSFLAVVSVIYLSILVTFHYADPSQEIIDLRGNVSLFFP 179

Query: 248 ---HQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLI---LSCI 301
                  ++P  F+ + +  FA  CHHN   +F  L   S   F++L ++ L    ++CI
Sbjct: 180 GEDQHNSVSP--FKTLPIFVFAYTCHHN---MFAVLNEQSTNEFSKLKYIPLTAISIACI 234

Query: 302 VCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLT----TFPLEIFVLRD 357
           + L     G++ F      NI+  +P++    + A +L    MLT     FPL+    R 
Sbjct: 235 MYLIVGTFGYVTFGSNITSNIVAQYPTN----SIATILGQTAMLTVVTLAFPLQCQPARA 290

Query: 358 VIRDII--YYNK-----------------------------------------DDPEPVK 374
              +II  ++ +                                         ++  P++
Sbjct: 291 SFINIINAFFPRFKYTPPPLQDEESMYISSTADSINNNNNQNSTPSTPRESTPNETTPIE 350

Query: 375 LTTKM----------HALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLT 424
             +K+          H L+T+ ++L    IA+S  +L  +L I+GAT ++ +++ILP L 
Sbjct: 351 ARSKLPFAQEPTQFQHILLTTIILLGSWLIAISVKSLAHVLAIVGATGSTSISFILPGLF 410

Query: 425 NLVITGKKKSLK 436
             ++  +  S +
Sbjct: 411 GAILISRDNSFE 422

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 105/484 (21%), Positives = 181/484 (37%), Gaps = 75/484 (15%)

Query: 32  SFDD----TAKTADSAVDQN---IFNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILG 84
           SFD+       T  + VD++   + N + E       +L    K++ + AF+ M  S +G
Sbjct: 257 SFDEEFALVPPTYATGVDEHTPLLLNTDPEQQQQVPAHL--RVKTSTFKAFLLMIKSFIG 314

Query: 85  SGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWG 144
           +GV+  P A  N G+   +      S    W   ++V +   TG S++        G W 
Sbjct: 315 TGVLFLPNAFSNGGLAFSISMLFFFSAYSYWCYYILVRSKDATGVSSFGDIGGILFGSWM 374

Query: 145 GLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLS 204
             +IL S  L               ++   L   F +  D+  + +++T   LFI  PLS
Sbjct: 375 KFIILFSLVLTQMGFAGAYVVFTAKNLIAFLDNVF-NWPDIPVKYLLLT--QLFIFIPLS 431

Query: 205 LNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHLHQLFITP---------- 254
             R++SKLS TS+                       Y     ++ L   P          
Sbjct: 432 FVRNVSKLSITSLFANFFIISGLIIVVY--------YTACRWMYDLSFKPAEGVIMVFNP 483

Query: 255 ---RIFQGISVISF---ALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAY 308
               +F G ++ +F    L+          S+R+P  + F ++  + +I + ++ +T   
Sbjct: 484 NRWSLFIGTAIFAFEGIGLIIPVQE-----SMRHP--EEFPKVLGLVIITTTVLFITIGT 536

Query: 309 SGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKD 368
            G+L +  +    IL N P D   +N  +L     +L + PL++F    +I      NK 
Sbjct: 537 LGYLAYGSQIQSVILLNLPQDALSVNMIQLFYSMAILLSTPLQLFPAIGIIE-----NKF 591

Query: 369 DPEPVKLTTKMHA----------------------LITSGLVLIIMCIA-LSTSNLGALL 405
            P   K+  K                         L+ S +VL+++ +A     NL   +
Sbjct: 592 FPRFTKVDIKGQDSADFQLQQNSGRANWRVKWSKNLVRSIIVLLVIILAYFGADNLDLFV 651

Query: 406 EIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIVF----GVILMFVSTAQTIL 461
            I+G  +   + YI P + +L         K       C V      +I  FVS   T  
Sbjct: 652 SIVGCLACIPLVYIYPSMLHLRSCSTPDHEKSNTWKTRCSVLIDYILIIFGFVSMCYTSY 711

Query: 462 EAFA 465
           + FA
Sbjct: 712 QCFA 715

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (49%), Gaps = 4/119 (3%)

Query: 251 FITPRIFQGI----SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTT 306
           +I  R ++G     ++I FA     N   I   L   S+K  + + + S+ +S I+ L+ 
Sbjct: 181 WIKIRDYKGFVTTFNIIIFAFTGAMNLFSIINELEENSMKNISHVINYSIGISTILFLSV 240

Query: 307 AYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYY 365
             +G+L F   TVGNI+ N+  +    N     LG  ++ +FPL    LRD + +II Y
Sbjct: 241 GITGYLTFGSNTVGNIMLNYDPNSVWTNVGNFCLGAMVILSFPLLFHPLRDAVNNIIVY 299

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 66  EAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATIL 108
           EA +    + +N+  +I+G+G++  PF  +N GI+ G+  T+L
Sbjct: 2   EAVATVNSSIVNLVKTIVGAGLLAIPFVFQNDGILFGVLLTLL 44

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 104/488 (21%), Positives = 191/488 (39%), Gaps = 85/488 (17%)

Query: 32  SFDDTAKTADSAVDQNIFNVNEEDPL--------TDDIYLSNEAK--SNRYMAFMNMANS 81
           SF+D   T   + +Q    V+E  PL           I +   AK  ++   AF+ M  S
Sbjct: 257 SFEDEFYTDQESEEQA---VDETSPLLARAEAGTGKKILVPKSAKGTTSTTKAFLLMIKS 313

Query: 82  ILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMG 141
            +G+GV+  P A  N G+   L   +   I   W   ++  +   T  S++     T  G
Sbjct: 314 FVGTGVLFLPGAFSNGGLFFSLAMLVFFGIYSYWCYYILTKSKIATKVSSFGDIGLTLYG 373

Query: 142 QWGGLLILVSNGLFAXXXXXXXXXXXXDS-IPHVLSAFFPSHTDLFHRNVIITLVTLFIS 200
            W   +IL S  +               + +  V + F+     + H    +  + L + 
Sbjct: 374 PWMKFIILFSLVMTQLGFSGAYVVFTAKNLLAFVENVFYWPGVTIVH----LLALQLVVF 429

Query: 201 FPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHLHQLFI-------- 252
            PLS  R+I+KLS +S+                           F    LF         
Sbjct: 430 IPLSFIRNIAKLSFSSLVANFLVMGGIVIVI------------GFTAKHLFFDLNCKPAE 477

Query: 253 ---------TPRIFQGISVISF---ALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSC 300
                    +  +F G ++ +F    L+    +S     +++P  ++F  +  + +I + 
Sbjct: 478 GIVTGFNSQSWTLFVGTAIFAFEGIGLIIPIQSS-----MKHP--EKFPLVMALVIITAT 530

Query: 301 IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIR 360
           ++ ++ A  G+L++  +T   IL N P D  ++N  +      +L + PL++F    +I 
Sbjct: 531 VLFVSVATLGYLSYGAETQTVILLNLPQDSILVNLIQFFYSSAILLSTPLQLFPAIAIIE 590

Query: 361 D-------IIYYNKDD-------PEPVKLTTKMHALITSGLVLIIMCIALS----TSNLG 402
           +        IY  + D       P   KL  ++  L      LI+  + ++     ++L 
Sbjct: 591 NKVFPKFTKIYVKRSDHTKIQYKPNSGKLDWRIKWLKNFVRSLIVSSVVIAAYFGANHLD 650

Query: 403 ALLEIIGATSASLMAYILPPLTNLVITGK-----KKSLKEKLP----YCGCIVFGVILMF 453
           A + I+G+ +   + YI PP+ +L    K     +KS+  K P    Y   +VFG I M 
Sbjct: 651 AFVAIVGSLACIPLVYIYPPMLHLRSCSKPRFAGEKSVWRKWPILLDYV-LVVFGAIGMV 709

Query: 454 VSTAQTIL 461
            ++ Q+I 
Sbjct: 710 YTSYQSIF 717

>NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177
          Length = 705

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 97/207 (46%), Gaps = 26/207 (12%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S++NP  ++F  +  + LI + I+ ++ A  G+L++       IL N P  +  +N  +L
Sbjct: 499 SMKNP--EKFPLVLGLVLITATILFISIATIGYLSYGSSIDVVILLNLPQSNIFVNLIQL 556

Query: 339 LLGFNMLTTFPLEIFVLRDVIRDIIY------YNKDDPEP---------VKLTTKMHAL- 382
                ++ + PL++F    +I   ++      Y KD   P          KL  K+  L 
Sbjct: 557 FYSLAIMLSTPLQMFPAIKIIESKLFPKFIKVYAKDGNSPGSYELSLNSGKLNWKVKWLK 616

Query: 383 --ITSGLVLIIMCIA-LSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKL 439
             + S +V +++ IA L   NL  ++ IIG+ +   + YI PPL +L       S+ +K+
Sbjct: 617 NFVRSIIVTLVVLIAYLEVENLDKVVSIIGSLACIPLVYIYPPLLHLRSHSIPFSVNQKV 676

Query: 440 PYCG-----CIVFGVILMFVSTAQTIL 461
            +        + FG + MF ++ Q+I 
Sbjct: 677 KWRVLFDYLLVGFGTVSMFYTSYQSIF 703

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 240 EYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILS 299
            Y+G     +++    +    S+I FA     N   I   L+  S+     + + S+ +S
Sbjct: 174 SYRGEVCWFKVYDFKGLLSTFSIIVFAYTGSMNLFSIINELKENSMANITSVINTSITIS 233

Query: 300 CIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVI 359
             V L     G+L F   T+GNI+ N+  D   +   +L LG  ++ +FPL     R  I
Sbjct: 234 TAVFLAVGICGYLTFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFPLLFHPCRIAI 293

Query: 360 RDIIYYN----KDDP 370
            +++ ++    K DP
Sbjct: 294 NNLVVWSEIHFKKDP 308

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 25/36 (69%)

Query: 76  MNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
           +N+  +I+G+G++  PFA +N G++ G   T++ ++
Sbjct: 12  VNLVKTIIGAGLLAIPFAFRNDGVVIGALLTLIAAV 47

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 96/239 (40%), Gaps = 57/239 (23%)

Query: 240 EYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILS 299
           E +G  +   ++    +    S+I FA     N   I   L N S++   ++ + S+ +S
Sbjct: 177 ETRGDVNWFSVYDWTGLCSTFSIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIGIS 236

Query: 300 CIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVI 359
             + L    SG+L F   T+GNI+ N+  D       +  LG  ++ +FPL    LR  +
Sbjct: 237 TFLFLLVGISGYLTFGSNTLGNIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLRIAV 296

Query: 360 RD-IIYY-----------------NKDDPEPVKLT-----------------------TK 378
            + +I+Y                 N  D  P+ LT                       T+
Sbjct: 297 NNMVIFYQINYGSNKENTSPNIRSNTSDLSPISLTINDDDIRSMPDDNVDDVLLSNEVTE 356

Query: 379 MHAL----------------ITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILP 421
           +  L                I+  L+L++  ++L+ ++   +L I+GAT  + +++ILP
Sbjct: 357 IEELDNVLCETPFPNHRFYTISLLLLLVMYSVSLTVTSFAYVLAIVGATGGTSISFILP 415

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 25/36 (69%)

Query: 76  MNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
           +N+  +I+G+G++  P+  +N G++ G+  T+L +I
Sbjct: 15  INLTKTIVGAGLLAIPYVFRNDGVLVGILMTVLAAI 50

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/314 (19%), Positives = 124/314 (39%), Gaps = 12/314 (3%)

Query: 63  LSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVI 122
           +S    SN     + + ++  G+G++  PFA K  G++ G FA  +++I    ++  +++
Sbjct: 1   MSEPTYSNTRSGVITLLHTACGAGILAMPFAFKPFGLVPG-FA--MLTICGLCSLLGLLL 57

Query: 123 NLKLTGKSTYQA----SVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAF 178
             ++   +  +A    S+   +     ++  ++  +              D +P ++S  
Sbjct: 58  QARVYRYAPERAASFFSLTQKINPNLSVVFDLAIAIKCFGVGVSYMIVVGDLMPQIVSGL 117

Query: 179 FPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXS 238
              +  L  R   ITL+  F++ PL L ++++ L   SM                    S
Sbjct: 118 -TKNALLLDRVFHITLIMAFVAGPLCLLKNLNSLRYASMVAISAVAYLCILVLVHFIFPS 176

Query: 239 GE---YKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVS 295
            E    KG F +            + +  FA  CHHN   +    +         +  ++
Sbjct: 177 QEIKDLKGDFAVWFPHNEGSPLSTLPIFVFAYTCHHNVFAVINEQKKTRFAHVKVIAIIA 236

Query: 296 LILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVL 355
           ++L+ ++ +    +G+  F +  VGNI+  +P         R+ + F +   FPL+    
Sbjct: 237 MLLALVLYVLIGGAGYFTFGNHIVGNIITLYPHSITS-TIGRVAIVFLVTLAFPLQCHPA 295

Query: 356 RDVIRDIIYYNKDD 369
           R  I  II Y K  
Sbjct: 296 RASIHHIICYIKHK 309

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 369 DPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVI 428
           +PE   L  K   +IT  L+     +A+S ++L  +L I+GAT ++ +++ILP L    +
Sbjct: 388 NPENTPLEGKTFKIITLILIACAYTVAISVTSLAHVLAIVGATGSTSISFILPGLFGFTL 447

Query: 429 TGKKKS-LKEKLP 440
            G + +   E++P
Sbjct: 448 IGSEYTEADEEIP 460

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 96/429 (22%), Positives = 167/429 (38%), Gaps = 57/429 (13%)

Query: 74  AFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVD----WTIRLIVINLKLTGK 129
           AF+ +  S +G+GV+  P A  N    GGLF +I+M +       W   +++   ++ G 
Sbjct: 307 AFLLLLKSFIGTGVLFLPHAFSN----GGLFFSIVMLLFFGLYSFWCYYILIRAKEVVGV 362

Query: 130 STYQASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRN 189
           +++        G W   +IL S                 +++       F S+   F  N
Sbjct: 363 TSFGDIGLRLYGPWVKFIILFSLVFTQLGFSGAYVIFTAENLKA-----FCSNVLHFSEN 417

Query: 190 VII---TLVTLFISFPLSLNRDISKLSKTSMXX---XXXXXXXXXXXXXXXXXXSGEYKG 243
           + I    L    I  PLS  R++SKLS  S+                           K 
Sbjct: 418 IPILYFMLAQFAIFIPLSFIRNVSKLSLPSLLANFFVMGGLVIVLFFSLKQLALESHMKP 477

Query: 244 TFHLHQLFITPR--IFQGISVISF---ALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLIL 298
              +  LF T R  +F G ++ +F    LV     S     +R+P  ++F  +  + +I 
Sbjct: 478 AEGVVLLFNTNRWTMFIGTAIFAFEGIGLVIPVQDS-----MRHP--EKFPLVLGMVIIT 530

Query: 299 SCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDV 358
           S ++ +T    G+L +  K    IL N P  +  +N  +      ++ + PL++F    +
Sbjct: 531 STVLFITIGSIGYLAYGYKIKTVILLNLPQANISVNLIQFFYSLAIMLSTPLQLFPAIKI 590

Query: 359 IRD-------IIYYNKDD--------PEPVKLTTKMHALITSGLVLIIMCIAL----STS 399
           I +        IY  KDD        P   KL  K+  L      LI+  + L       
Sbjct: 591 IENKVFPKFIKIYVKKDDNTTGVEMRPNSGKLNWKVKWLKNFVRSLIVGSVILMAYFGAD 650

Query: 400 NLGALLEIIGATSASLMAYILPPLTNLVI------TGKKKSLKEKLPYCGCIVFGVILMF 453
            L   + +IG+ +   + Y+ PP+ +L         G + +    L Y   I+FG I M 
Sbjct: 651 QLDKFVALIGSFACIPLVYMYPPMLHLRSCSLPNHKGGRINWSAGLDYV-LIIFGAISMI 709

Query: 454 VSTAQTILE 462
            ++ Q++ +
Sbjct: 710 YTSYQSVTQ 718

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 91/424 (21%), Positives = 171/424 (40%), Gaps = 28/424 (6%)

Query: 52  NEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
            EE  L      S   KS+   A + +  S +G+GV+  P A  N G +  L + I+ S+
Sbjct: 110 EEEQELEPTPPSSQHNKSSTTKAILLLLKSFIGTGVLFLPKAFSNGGYVFSLVSLIICSL 169

Query: 112 LVDWTIRLIV---INLKLTGKSTYQASVETAMGQWGGLLILVSNGL-FAXXXXXXXXXXX 167
           +  +   L++     L + G      ++  ++ Q   LL +V + L FA           
Sbjct: 170 ISYYCFILLLDTKSKLNVNGYGDLGLTLYGSILQKSILLSIVLSQLGFAAAYNVFTATNL 229

Query: 168 XDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXX 227
                H LS    ++   F       L+  F+  PLS  R+I+KLS T++          
Sbjct: 230 -----HSLSTSLITNPPDFITIPFCILLQTFLFIPLSFTRNITKLSSTALIADLFIFIGL 284

Query: 228 XXXXXXXXXXSGEYKGTFHLHQLFITP--RIFQGISVISFA----LVCHHNTSFIFFSLR 281
                            +     F T    +F G ++ ++     L+          S++
Sbjct: 285 IYLYYYPIKIIATKGPDWQTMTPFNTKDWSLFIGTAIFTYEGIGLLIPIQE------SMK 338

Query: 282 NPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLG 341
           +P    F +   + L++  +V +T    G+  F       +L NFP D+   +  +LL  
Sbjct: 339 SP--HHFKKSLILVLVIITLVFITIGLLGYSAFGSNVDTVLLQNFPQDNPCTSLVQLLYS 396

Query: 342 FNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHA-LITSGLVLIIMCIA-LSTS 399
             +L + PL++F    ++ + I ++KD       + K       S +V++   I+ L  +
Sbjct: 397 LAILLSTPLQLFPAIKILENWI-FSKDASGKYNHSIKWAKNYFRSTIVILTSLISYLGAN 455

Query: 400 NLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEK--LPYCGCIVFGVILMFVSTA 457
           +L   + ++G+ +   + Y+ PPL +   T    +   K  L     + FG+I M  ++ 
Sbjct: 456 DLNKFVALVGSFACIPLIYVYPPLLHYKATQLDNTFTWKTLLADFSLLTFGIITMIYTSL 515

Query: 458 QTIL 461
           QTI+
Sbjct: 516 QTII 519

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 11/135 (8%)

Query: 255 RIFQG------ISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAY 308
           RI+ G       S+I FA V   N   I   L N S++   ++ + S+ +S I  L    
Sbjct: 182 RIYDGKGLLSTFSIIIFAYVGAMNLFSICRELENDSMENILKVINGSIGISSIFFLLVGI 241

Query: 309 SGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYY--- 365
           SG+L F     GNI+ N+  +   I   +  L F +L +FPL    LR  + +++ +   
Sbjct: 242 SGYLTFGSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFPLLFHPLRIAVNNLVVWFGM 301

Query: 366 --NKDDPEPVKLTTK 378
               DD   V  TT+
Sbjct: 302 TFGADDTCAVPSTTQ 316

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%)

Query: 76  MNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
           +N+  +I+G+G+   PFA KN GI+ G+   +L ++
Sbjct: 12  VNLVKTIVGAGLFAIPFAFKNDGILVGILLIMLAAV 47

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 65/134 (48%), Gaps = 3/134 (2%)

Query: 242 KGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCI 301
           +GT    +++    +    S+I FA V   N   I   L + ++   +++ + S+ +S +
Sbjct: 178 RGTILWFEIYSGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAISTV 237

Query: 302 VCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRD 361
             L+   +G+L F   T+GNI+ N+  +   +N  +  L   +L +FPL    LR    +
Sbjct: 238 AFLSVGITGYLTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLRIACNN 297

Query: 362 IIYY---NKDDPEP 372
           ++ +   N ++ +P
Sbjct: 298 LVVWFEINFNEAQP 311

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 31/51 (60%)

Query: 383 ITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKK 433
           IT GL++++  IAL  ++   +L ++GAT ++ +++ILP L    + G   
Sbjct: 383 ITVGLLVVMYLIALRITSFALVLALVGATGSTSISFILPGLFGYKLIGSDS 433

>KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.252
           YKL146W
          Length = 643

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 91/389 (23%), Positives = 148/389 (38%), Gaps = 36/389 (9%)

Query: 52  NEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
           NE  PL      S   K+    A + +  S +G+GV+  P A  N G        +  +I
Sbjct: 229 NEGTPLVATRSTSERHKTTTVKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLFCAI 288

Query: 112 LVDWTIRLIVINLKLTGKSTYQASVETAMGQWGG---LLILVSNGLFAXXXXXXXXXXXX 168
           L  +   L++I     G   Y    E  M  +GG   L IL+S  L              
Sbjct: 289 LSYYCFVLLIITKDKVGVKGYG---EIGMKLYGGKMKLAILLSVALSQIGFAAAYTVFTA 345

Query: 169 DSIPHVLSAFFPSHTDLFHRNVIITL-VTLFISFPLSLNRDISKLSKTSMXX---XXXXX 224
            ++   +   F    D+      I L   +FI  PLSL R+I+KLS T++          
Sbjct: 346 TNLKLFMDNVFNLSEDVLGLGWFIWLQAAIFI--PLSLTRNIAKLSGTALVADLFILLGL 403

Query: 225 XXXXXXXXXXXXXSGEYKGTFHL-----HQLFITPRI--FQGISVISFALVCHHNTSFIF 277
                        +G    T          LFI   I  F+GI ++            I 
Sbjct: 404 IYVYYYATYYVISNGVATSTMVWFNKSDWTLFIGTAIFTFEGIGLL----------IPIQ 453

Query: 278 FSLRNPSLKRFNQLTHVSLILSCIV--CLTTAYSGFLNFKDKTVGNILNNFPSDDNVINF 335
            S+++P + R   L+ V +I++ I   C    YS F +  D  V   L NFP D      
Sbjct: 454 ESMKHPEVFR-KSLSGVMVIVTVIFISCGLLCYSAFGSHVDTVV---LVNFPQDSYTTAI 509

Query: 336 ARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIA 395
            +LL    +L + PL++F    ++    + +    +       +      G+V+    +A
Sbjct: 510 VQLLYALAILLSTPLQLFPAIRILEQWTFNSNASGKHNPRVKWLKNYFRCGVVIFTTVLA 569

Query: 396 -LSTSNLGALLEIIGATSASLMAYILPPL 423
            +  S+L   + ++G+ +   + YI PPL
Sbjct: 570 WVGASDLDKFVSLVGSLACIPLIYIHPPL 598

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 106/443 (23%), Positives = 166/443 (37%), Gaps = 58/443 (13%)

Query: 52  NEEDPLTDDIYLSNEA------KSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFA 105
           +EE  L D       A      KS+ + A + +  S +G+GV+  P A  N G     F+
Sbjct: 199 DEETALIDGSRQRKRAAHRQAHKSSTFKAVLLLLKSFVGTGVLFLPRAFHNGGWA---FS 255

Query: 106 T--ILMSILVDWTIRLIVINLKLT---------GKSTYQASVETAMGQWGGLLILVSNGL 154
           T  +L   +V +   L++IN K           G S + + +E A+    G ++L   G 
Sbjct: 256 TGCLLACGVVSYYCFLLLINAKTKQKVNGYGDLGASVFGSKMEKAIL---GSIVLSQVGF 312

Query: 155 FAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSK 214
            A                  L  FF +            L+ L +  PLSL R+I+KLS 
Sbjct: 313 VAAYSVFTATN---------LQVFFANVFKFKASMAFWLLIQLPVYLPLSLTRNIAKLSG 363

Query: 215 TSMXXXXXXX---XXXXXXXXXXXXXSGEYKGTFHLHQ-----LFITPRIF--QGISV-I 263
           T++                        G    +  L       LFI   IF  +GI + I
Sbjct: 364 TALIADAFILFGLLYVYYYCSHYVVDHGVASDSMLLFNKNDWTLFIGTAIFTYEGIGLLI 423

Query: 264 SFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNIL 323
                  H   F        S   F  +  VS+    IVC    YS F    D     IL
Sbjct: 424 PIQESMKHPEKF--------SKCLFGVMASVSVAF--IVCGLLCYSAF---GDSVKIVIL 470

Query: 324 NNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALI 383
            NFP D  +    +LL    +L + PL++F +  ++   I+      +       M    
Sbjct: 471 LNFPRDSAMTATVQLLYALAILLSTPLQLFPIIRILETSIFPKDASGKYNPRVKWMKNYF 530

Query: 384 TSGLVLIIMCIA-LSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYC 442
              +VL+ M IA L  ++L   + ++G+ +   + YI PP+ +     +  + K  L   
Sbjct: 531 RVAIVLLNMLIAWLGANDLDKFVSLVGSFACIPLIYIYPPMLHYKTFAQGGASKLALLGD 590

Query: 443 GCIV-FGVILMFVSTAQTILEAF 464
             I  FGV +M  +T Q +   F
Sbjct: 591 QLIAFFGVAVMIYTTYQAVYLWF 613

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 88/192 (45%), Gaps = 21/192 (10%)

Query: 283 PSLKRFNQLTHVSLILSCIVCLTT---------AYSGFLNFKDKTVGNILNNFPSDDNVI 333
           P  +  +   H S  LS ++C+ T          YS F + K +TV  +L NFP D    
Sbjct: 479 PIQESMSHPQHFSKCLSMVMCIVTVIFISCGLLCYSAFGS-KVETV--VLLNFPHDSPYT 535

Query: 334 NFARLLLGFNMLTTFPLEIF----VLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVL 389
              +LL    +L + PL++F    +L +    I    K++P+   L      +I    VL
Sbjct: 536 LMVQLLYALAILLSTPLQLFPAIKILENWCFPISASGKNNPKVKWLKNYFRCII----VL 591

Query: 390 IIMCIALSTSN-LGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIVFG 448
           +   IA   +N L   + ++G+ +   + YI PPL +L     ++++   +     ++FG
Sbjct: 592 LTAFIAYVGANDLDKFVSLVGSFACIPLIYIYPPLLHLKAYWGEQTILRMVLDSLVLIFG 651

Query: 449 VILMFVSTAQTI 460
           V +M  ++ QTI
Sbjct: 652 VAVMGYTSWQTI 663

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 6/127 (4%)

Query: 261 SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVG 320
           S+I FA     N   +   L++ S++    + + S+ LS I+ L    SG+L F +KT G
Sbjct: 195 SIIIFAYTGSMNLFPMINELKDNSMENITLVINNSITLSTILFLIVGLSGYLTFGNKTSG 254

Query: 321 NILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYY------NKDDPEPVK 374
           N++ N+  +   I   +  LG  ++ +FPL    LR  + ++I +      N D  E  +
Sbjct: 255 NLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFQPLRVAVNNVIIWLEITFGNADPNEDTQ 314

Query: 375 LTTKMHA 381
           ++    A
Sbjct: 315 VSEYTRA 321

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 129/299 (43%), Gaps = 29/299 (9%)

Query: 175 LSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXX------XXXXXXXXX 228
           L AFF     L +  +   ++ L    PLSL R+I++LS T++                 
Sbjct: 286 LQAFFKHVFSLEYSLIFWIMIQLAFYLPLSLTRNIARLSATALVADLFILLGLVYVYYYS 345

Query: 229 XXXXXXXXXSGEYKGTFHLHQ--LFITPRIF--QGISVISFALVCHHNTSFIFFSLRNPS 284
                    + +   +F+     LFI   IF  +GI +    L+  H       S+  P+
Sbjct: 346 SFYIWNHGIASDSMVSFNKSDWTLFIGTAIFTYEGIGL----LIPIHE------SMEKPA 395

Query: 285 LKRFNQLTHVSLILSCIV--CLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGF 342
             +   L +V L+++ I   C    YS F   K +TV  IL NFPS+    N  +L+   
Sbjct: 396 HFK-PALMYVILVVTIIFISCGLICYSAF-GAKVETV--ILLNFPSNSIFTNAVQLIYAL 451

Query: 343 NMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIA-LSTSNL 401
            +L + PL++F    ++ + I++     +             + +VLI + IA +  ++L
Sbjct: 452 AILLSTPLQLFPAIKILENKIFHKNASGKFDAKVKWRKNYFRAFVVLIAVIIAWIGANDL 511

Query: 402 GALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTI 460
              + +IG+ +   + YI PPL +  +    K L+        ++FG ++M  ++ QTI
Sbjct: 512 DKFVSLIGSFACIPLIYIYPPLFHYKVFENNKKLQA--IDLAILIFGALVMSYTSWQTI 568

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 58/132 (43%)

Query: 240 EYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILS 299
           E +G      ++    +    S+I FA     N   I   LRN ++     + + S+ ++
Sbjct: 173 EVRGDISWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNRSIAIA 232

Query: 300 CIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVI 359
            +  +  A +G+L F   T+GNI+ N+      ++  +  LG  ++ TFPL     R  +
Sbjct: 233 TVFFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTFPLLFHPCRIAV 292

Query: 360 RDIIYYNKDDPE 371
            ++  + +   E
Sbjct: 293 NNLCVWAQLQRE 304

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 58/126 (46%)

Query: 242 KGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCI 301
           +G  +   ++    +    S+I FA     N   +   L + S++    + + S+I+S  
Sbjct: 178 RGEVYWFHVYDFRGLLSTFSIIIFAYTGAMNLFSMIRELEDISMQNIKNVINGSIIISTG 237

Query: 302 VCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRD 361
           + L    SG+L F     GNI+ N+  + N I   +  LG  ++ +FPL    LR  + +
Sbjct: 238 LFLLVGISGYLTFGSNVEGNIILNYNPNSNWIYIGKFCLGTMLILSFPLLFHPLRIAVNN 297

Query: 362 IIYYNK 367
           ++ + K
Sbjct: 298 LVVWMK 303

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 39/64 (60%), Gaps = 7/64 (10%)

Query: 383 ITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPL-------TNLVITGKKKSL 435
           IT+ L++++  IAL+  +   +L +IGAT ++ +++ILP L       T+ +  G+   L
Sbjct: 402 ITAFLLIVMYIIALNVKSFALVLALIGATGSTSISFILPGLFGYKLIGTDSLAIGQMVPL 461

Query: 436 KEKL 439
           +++L
Sbjct: 462 RDRL 465

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 47/90 (52%)

Query: 261 SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVG 320
           S+I FA     N   I   L+  S+    ++ + S+++S    +     G+L F  +T+G
Sbjct: 188 SIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSACFIILGLFGYLTFGKETLG 247

Query: 321 NILNNFPSDDNVINFARLLLGFNMLTTFPL 350
           N++ N+ +D   + FAR  LG  ++ +FPL
Sbjct: 248 NVILNYDADKLSVRFARFNLGLMVVLSFPL 277

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 53/105 (50%)

Query: 261 SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVG 320
           S+I FA     N   +   L++ S++    + + S+ LS  + L    SG+L F +KT+G
Sbjct: 195 SIIIFAYTGSMNLFPMINELKDNSMENITSVINNSISLSTALFLIVGLSGYLTFGNKTLG 254

Query: 321 NILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYY 365
           N++ N+      I   +  LG  ++ +FPL    LR  + ++I +
Sbjct: 255 NLILNYDPTSIWIVIGKFCLGLMLILSFPLLFQPLRIAVNNVIIW 299

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 58/126 (46%)

Query: 240 EYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILS 299
           E++G      ++    +    ++I FA     N   I   L++ S++  N++   S+  S
Sbjct: 174 EFRGDVSWIGVYDKKGLVSTFTIIVFAFTASMNLFSIINELKDNSMQNINKVITSSISTS 233

Query: 300 CIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVI 359
             + L+    G+L F    VGNI+ N+  +       +L LG  ++ +FPL +   R   
Sbjct: 234 AALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPLLLHPCRIAA 293

Query: 360 RDIIYY 365
            +++++
Sbjct: 294 NNMMHW 299

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 54/107 (50%), Gaps = 12/107 (11%)

Query: 366 NKDDP--EPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPL 423
           N++D   E V    +   +IT+ LV+ +  +AL+ S+   +L ++GAT ++ +++ LP L
Sbjct: 358 NREDSLTEVVPFPNQRFYIITAVLVISLYVLALNVSSFALVLALVGATGSTAISFTLPGL 417

Query: 424 TNLVITGKKKSLKEK--------LPYC--GCIVFGVILMFVSTAQTI 460
               + G + +   +        L  C     ++G+ +MF+S   TI
Sbjct: 418 FGYKLIGSQAARNGQLMSRSDKFLKSCSLALAIYGLAVMFLSLYVTI 464

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 30/46 (65%)

Query: 66  EAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
           +A +  + + +NM  +I+G+G++  P+A K+ GI+ G   TI+ ++
Sbjct: 2   DAGATAFFSTVNMVKTIVGAGMLAVPYAFKSDGILVGTALTIVGAV 47

>CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101w
          Length = 733

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 93/207 (44%), Gaps = 26/207 (12%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S+R P  ++F  +  + +I + +V +  A  G+L +  +    IL N P  + +++  +L
Sbjct: 526 SMRKP--EKFPLVLGLVIICTTVVFIIVATIGYLAYGSEVDTVILLNLPQKNILVSLIQL 583

Query: 339 LLGFNMLTTFPLEIFVLRDVIRDII------YYNKDDPE-------------PVKLTTKM 379
           L    ++ + PL++F    +I   +      + N+ D E               K+    
Sbjct: 584 LYSIAIMLSTPLQMFPAIRIIESGLFKQYDRWVNRSDREGHATEHNTSSGKSSWKVKWMK 643

Query: 380 HALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKS----- 434
           +A+ +S ++L++    +   NL   L IIG+ +   + Y+ PP+ +L  T   +S     
Sbjct: 644 NAVRSSIVILVVAIACVGADNLDKFLSIIGSFACIPLVYMYPPMLHLKSTSLPRSNGKIM 703

Query: 435 LKEKLPYCGCIVFGVILMFVSTAQTIL 461
            +  +     I+FG I M  ++ Q+I 
Sbjct: 704 SRRVIIDIVLIIFGGISMVYTSYQSIF 730

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 66/142 (46%), Gaps = 7/142 (4%)

Query: 257 FQGI----SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFL 312
           F+G+    +++ FA     N   I   L++ S+   N++   ++ +S  + L     G+L
Sbjct: 190 FKGLISTFTIVIFAYTGSMNMFSIINELKDNSMTNINKVVSTTITISSFLFLAVGLCGYL 249

Query: 313 NFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYY---NKDD 369
            F   T+GNI+ N+  +       +L LG  ++ +FPL +   R    +++++   N   
Sbjct: 250 TFGSNTLGNIMLNYDPNSAWTTTGKLCLGSMVILSFPLLLHPCRIAANNMVHWTIINYGK 309

Query: 370 PEPVKLTTKMHALITSGLVLII 391
               ++    H  +TS + +++
Sbjct: 310 CADHQIARNQHTHVTSPITMVV 331

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 371 EPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITG 430
           E V    K   +IT+ LV  +  +AL+ S+   +L ++GAT ++ +++ LP L    + G
Sbjct: 368 EVVPFPNKRFYIITAILVTSLYILALNVSSFALVLALVGATGSTAISFTLPGLFGYKLIG 427

Query: 431 KKKSLKEKLP------YCGC----IVFGVILMFVSTAQTI 460
            + +    L       Y GC     ++G+ +MF+S   T+
Sbjct: 428 SQAARSGMLMSGSDRFYRGCSLALTLYGLGVMFLSLYVTL 467

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 257 FQGI----SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFL 312
           F+G+    S+I FA     N   +   L++ S++    + + S+ LS  + L    SG+L
Sbjct: 187 FKGLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYL 246

Query: 313 NFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIY-----YNK 367
            F ++T+GN++ N+  +   I   +  LG  ++ +FPL    LR  + ++I      Y  
Sbjct: 247 TFGNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNVIIWIEITYGG 306

Query: 368 DDPE 371
            +PE
Sbjct: 307 ANPE 310

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 29/46 (63%)

Query: 66  EAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
           EA S+   +  N+  +I+G+G +  P++ K+ G++ G+  T+L ++
Sbjct: 2   EATSSALSSTANLVKTIVGAGTLAIPYSFKSDGVLVGVILTLLAAV 47

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 64/122 (52%), Gaps = 7/122 (5%)

Query: 257 FQGI----SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFL 312
           F+G+    S+I FA     N   I   L+N S++  + + + S+ +S I+ LT   +G+L
Sbjct: 187 FKGLLSTFSIIIFAYTGAMNLFSIINELKNNSMENVSSIINHSISISTILFLTVGIAGYL 246

Query: 313 NFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYY---NKDD 369
            F   T+GNIL N+ +D   ++ A+  L   ++ +FPL    LR  + +++ +   N   
Sbjct: 247 TFGCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSFPLLFHPLRIAVNNLVVWLEINYGT 306

Query: 370 PE 371
           P+
Sbjct: 307 PQ 308

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 31/46 (67%)

Query: 66  EAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
            A S  + + +N+  +I+G+G++  P+A KN G++ GLF T+L ++
Sbjct: 2   HATSTAHSSTINLVKTIVGAGLLAIPYAFKNDGVLVGLFLTLLAAV 47

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 94/445 (21%), Positives = 172/445 (38%), Gaps = 60/445 (13%)

Query: 33  FDDTAKTADSAVDQNIFNVNEEDPL-TDDIY-----------LSNEAKSNRYMAFMNMAN 80
           F+D   + +   ++    ++E  PL + DI             S +  ++ + AF+ M  
Sbjct: 268 FEDDFYSEEEEDNRGNKTIDERSPLLSGDIESRGGRAKVHAPRSAKGTTSTFKAFLLMIK 327

Query: 81  SILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAM 140
           S +G+GV+  P A  N G+   +       I   W   +++ +   T  S++        
Sbjct: 328 SFIGTGVLFLPNAFANGGLTFSVCMLSFFGIYSYWCYYILIQSKVATKVSSFGDIGFRLY 387

Query: 141 GQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTLFIS 200
           G W   +IL S  L               ++   L   F  H D+    ++   + +FI 
Sbjct: 388 GTWMKFVILFSLVLTQLGFSGAYVVFTAKNLIAFLDNVFRWH-DVPIEYLLFLQLAIFI- 445

Query: 201 FPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHL-HQLFITPR--IF 257
            PLS  R++SKLS TS+                            HL   L  TP   + 
Sbjct: 446 -PLSFIRNVSKLSLTSLIANFLVMAGLIIVVFFVLK---------HLILDLHFTPAEGVI 495

Query: 258 QGISVISFALVCHHNTSFIFF-----------SLRNPSLKRFNQLTHVSLILSCIVCLTT 306
            G +  S++L     T+   F           S+++P  ++F  +  + +  + ++ +T 
Sbjct: 496 MGFNSSSWSLFI--GTAIFAFEGIGLIIPVQDSMKHP--EKFPLVLGLVIGAATVLFVTI 551

Query: 307 AYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRD----- 361
           A  G+L++   T   IL N P  +  +N  +      +L + PL++F    +I +     
Sbjct: 552 ATLGYLSYGQNTETVILLNLPQGNLCVNLIQFFYSLAILLSTPLQLFPAIAIIENKVFPR 611

Query: 362 --IIYYNKDD-------PEPVKLTTKMHALITSGLVLIIMCIAL----STSNLGALLEII 408
              IY  K++       P   KL  K+  L  S   +I+  + L     + NL   + I+
Sbjct: 612 FTKIYVKKNNRTDVELRPNSGKLDWKVKWLKNSVRSVIVSFVILLAYYGSENLDKFVSIV 671

Query: 409 GATSASLMAYILPPLTNLVITGKKK 433
           G  +   + Y+ PPL +L    K +
Sbjct: 672 GCFACIPLVYMYPPLLHLRSCSKPQ 696

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 9/124 (7%)

Query: 257 FQGI----SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFL 312
           F+G+    S+I FA     N   +   L++ S+     + + S+ LS  + L    SG+L
Sbjct: 187 FKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMGNITLVINNSISLSTALFLIVGLSGYL 246

Query: 313 NFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYY-----NK 367
            F + T+GN++ N+  +   I   +  LG  ++ +FPL    LR  + ++I +       
Sbjct: 247 TFGNSTLGNLILNYDPNSVWIIIGKFCLGSMLILSFPLLFQPLRVAVNNVIIWIEITFGN 306

Query: 368 DDPE 371
            DPE
Sbjct: 307 ADPE 310

>KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 601

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 84/190 (44%), Gaps = 16/190 (8%)

Query: 279 SLRNPSLKRFNQL---THVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINF 335
           S+++P  ++FN+      VS+ ++ I+C    YS F +  +     IL NFP    +   
Sbjct: 415 SMKHP--EKFNKCLLGVMVSVSIAFILCGLLCYSAFGSSVETV---ILLNFPRKSAMTAS 469

Query: 336 ARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIA 395
            +LL    ++ + PL++F +  ++   I+      +       M      G+VL    IA
Sbjct: 470 VQLLYALAIMLSTPLQLFPIIRILETSIFPKNASGKYNPRVKWMKNYFRIGIVLANTLIA 529

Query: 396 -LSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIV----FGVI 450
            L  ++L   + I+G+ +   + YI PP+ +          K  L   GC V    FGV 
Sbjct: 530 WLGANDLDKFVSIVGSFACIPLIYIYPPMLHYKAFSNGGGSKLSL---GCDVAIASFGVA 586

Query: 451 LMFVSTAQTI 460
           +M  +T Q +
Sbjct: 587 VMTYTTYQAV 596

>TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.252
           YKL146W
          Length = 596

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 66/143 (46%), Gaps = 5/143 (3%)

Query: 322 ILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHA 381
           +L NFP D       +LL    +L + PL++F    ++ + ++  K   +          
Sbjct: 450 VLLNFPQDSPYTLTVQLLYCLAILLSTPLQLFPAIRILENWVFKKKGSGKYNPKIKWAKN 509

Query: 382 LITSGLVLIIMCIALSTSN-LGALLEIIGATSASLMAYILPPLTNL---VITGKKKSLKE 437
              S +V+   CIA S +N L   + ++G+ +   + YI PPL +     I G    ++ 
Sbjct: 510 YFRSLIVIGTTCIAWSGANDLDKFVSLVGSFACIPLIYIYPPLLHYKACKINGSANLVQN 569

Query: 438 KLPYCGCIVFGVILMFVSTAQTI 460
            L     I+FGVILM  ++ QTI
Sbjct: 570 YLDII-LILFGVILMSYTSFQTI 591

>Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii ACR051C
          Length = 627

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 130/307 (42%), Gaps = 41/307 (13%)

Query: 175 LSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXX 234
           L  FF       HR  +   + L +  PL+L R IS+LS T++                 
Sbjct: 336 LQVFFGEVFGWSHRLSVYIFLQLVVYLPLALTRRISRLSGTALAADVLILFGLVYVYGYS 395

Query: 235 XXXSGEYKGTFHLHQLFITP--RIFQGISVISFA----LVCHHNTSFIFFSLRNPSLKRF 288
                 Y       ++F      +F G ++ ++     LV          S+  P   RF
Sbjct: 396 AVYVLRYGVASQSMKMFNRQDWTLFVGTAIFTYEGIGLLVPIQE------SMSRPG--RF 447

Query: 289 NQ-LTHV-----SLILSC-IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLG 341
              L  V     S+ +SC ++C    YS F + + +TV  IL NFP D  + +  + L  
Sbjct: 448 ASCLVWVIAAVTSIFISCGLLC----YSAFGS-RVETV--ILLNFPKDSVLSSSVQFLYA 500

Query: 342 FNMLTTFPLEIF-VLRDVIRDII---YYNKDDPEPVKLTTKMHALITSGLVLIIMCIA-L 396
             ++ + PL++F  +R +   II      K DP  VK       ++   +V + + IA +
Sbjct: 501 MAIMLSTPLQLFPAIRILEHGIISSSVSGKHDPR-VKWAKNWFRVL---VVFVTVSIAWV 556

Query: 397 STSNLGALLEIIGATSASLMAYILPPLTNLVI---TGKKKSLKEKLPYCGCIVFGVILMF 453
              +L   + +IG+ +   + YI PPL + ++   TG+  +    L     + FGVI MF
Sbjct: 557 GADDLDKFVSLIGSFACVPLIYIYPPLLHYMLFKGTGRVSNAALFLDQL-VVWFGVIGMF 615

Query: 454 VSTAQTI 460
            +++QT+
Sbjct: 616 YTSSQTV 622

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 50/105 (47%)

Query: 261 SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVG 320
           S+I FA  C  N   I   L + S+    ++ + S+ ++  + L+   +G+L F    +G
Sbjct: 196 SIIIFAYTCTMNIFSIINELTDNSVSNVTKVANSSIGIATFLILSVGITGYLTFGSNVLG 255

Query: 321 NILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYY 365
           NI+ N+  D       +  LG  ++ +FPL     R    +++++
Sbjct: 256 NIILNYDPDSIWTRVGKFCLGCMVVLSFPLMFHPCRLATNNMVHW 300

>Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON}
           (11352..13655) [2304 nt, 768 aa]
          Length = 767

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 91/427 (21%), Positives = 161/427 (37%), Gaps = 56/427 (13%)

Query: 74  AFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQ 133
           AF  +  S +G+G++  P A  N G+I  +   +   I   W   +++ +  +T  +++ 
Sbjct: 356 AFFLLLKSFIGTGILFLPRAFDNGGLIFSICMLLFFGIYSYWCYYILIRSKNITQVTSFG 415

Query: 134 ASVETAMGQWGGLLILVSNGLFAXXXXXXXXXXXXDSIP-HVLSAFFPSHTDLFHRNVII 192
                  G+W   +IL S  L               ++   V + F     DL +    +
Sbjct: 416 DIGYKLYGRWMKFVILFSLVLTQLGFAGAYVIFTAKNLKAFVENVFRVPDFDLKY----L 471

Query: 193 TLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHLHQLFI 252
            +  LFI  PLS  R++SKLS  S+                           F +  LF 
Sbjct: 472 MIFQLFIFTPLSYVRNVSKLSFPSLVANFFIMSGLAIVI------------VFTMKHLFY 519

Query: 253 TPRIFQGISVISFALVCHHNTSFI---FFSLRN-----PSLKRFNQLTHVSLILSCIVC- 303
              +     VI +    +  T FI    F+        P         H  L+L  ++  
Sbjct: 520 DLNMRPEEGVI-YGFNSNGWTLFIGTAIFAFEGIGLIIPIQDSMKHPEHFPLVLGLVIMT 578

Query: 304 -----LTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDV 358
                +T A  G+L +       IL N P  +  +N  +L     ++ + PL++F    +
Sbjct: 579 ATVLFVTIATIGYLAYGKLIETVILLNLPKSNIFVNLIQLFYSMAIMLSTPLQLFPAIKI 638

Query: 359 IRDII------YYNKDDP--EPVKLTTKMHAL----------ITSGLVLIIMCIA-LSTS 399
           I + +      YY K D   E V+L      L          + S +VLI++ +A     
Sbjct: 639 IENKVFPKFTKYYVKIDQTREGVRLRQNSGKLDWRVKWRKNFLRSVIVLIVILMAYYGYD 698

Query: 400 NLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGC-----IVFGVILMFV 454
           +L   + IIG+ +   + Y+ PP+ +L       S   K+ Y        I FG + M  
Sbjct: 699 DLDRFVSIIGSFACIPLVYMYPPMLHLRSYSIPSSEGLKIKYRVILDYILIAFGGVSMLY 758

Query: 455 STAQTIL 461
           ++ Q+++
Sbjct: 759 TSYQSLM 765

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/186 (19%), Positives = 85/186 (45%), Gaps = 6/186 (3%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S++NP +  F +   + + +  I+ ++     +  F +K    +L NFP D       +L
Sbjct: 533 SMQNPQV--FPKCLSLVMCIVTIIFISCGLICYSAFGEKVETVVLLNFPQDSAFTLMVQL 590

Query: 339 LLGFNMLTTFPLEIFVLRDVIRDIIY-YNKDDPEPVKLTTKMHALITSGLVLIIMCIALS 397
           L    +L + PL++F    ++ +  +  +       ++  K +      ++   M   + 
Sbjct: 591 LYSLAILLSTPLQLFPAIKILENWTFPIHASGKHNSRIKWKKNYFRCIMVIFTAMVAWVG 650

Query: 398 TSNLGALLEIIGATSASLMAYILPPLTNL--VITGKKKSLKEKLPYCGCI-VFGVILMFV 454
            ++L   + ++G+ +   + YI PPL +    +    K+++ +L     + VFG+I+M  
Sbjct: 651 ANDLDKFVSLVGSFACIPLIYIYPPLLHFKAFLNDTSKTMRFRLGLDMLVFVFGIIIMVY 710

Query: 455 STAQTI 460
           ++ +TI
Sbjct: 711 TSWETI 716

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%)

Query: 261 SVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVG 320
           S+I FA     N   I   L + S++   ++ + S+  S  + +    +G+L F      
Sbjct: 194 SIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTALFILVGMAGYLTFGSNVAQ 253

Query: 321 NILNNFPSDDNVINFARLLLGFNMLTTFPL 350
           N++ NF  D        L LG  +L +FPL
Sbjct: 254 NVILNFDPDAVSTQVGSLALGLMVLLSFPL 283

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 81/187 (43%), Gaps = 15/187 (8%)

Query: 284 SLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKD-----KTVGNILNNFPSDDNVINFARL 338
           S+K  N        + CIV +     G L +       KTV  +L NFP D +     +L
Sbjct: 494 SMKHPNHFRPSLSAVMCIVAVVFISCGLLCYAAFGSDVKTV--VLLNFPQDTSYTLTVQL 551

Query: 339 LLGFNMLTTFPLEIFVLRDVIRDIIY----YNKDDPEPVKLTTKMHALITSGLVLIIMCI 394
           L    +L + PL++F    ++ +  +      K +P+   L       I   +VL  +  
Sbjct: 552 LYALAILLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAI---VVLTSVLA 608

Query: 395 ALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPY-CGCIVFGVILMF 453
            +  ++L   + ++G+ +   + YI PPL +   +    + + +L      IVFGV +M 
Sbjct: 609 WVGANDLDKFVSLVGSFACIPLIYIYPPLLHYKASSISGTSRARLLLDLIVIVFGVAVMV 668

Query: 454 VSTAQTI 460
            ++ QTI
Sbjct: 669 YTSWQTI 675

>NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {ON}
           Anc_2.177
          Length = 710

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 92/209 (44%), Gaps = 29/209 (13%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S++NP  ++F  +    LI +  + +T A  G+L++   T   IL N P D   +   +L
Sbjct: 503 SMKNP--EKFPLVLGFVLIAATFLFITIASIGYLSYGSSTEVVILLNLPQDSIFVISIQL 560

Query: 339 LLGFNMLTTFPLEIFVLRDVIRDIIY------YNKDDPEPVKLTTKMHA----------- 381
                ++ + PL++F    +I + ++      Y + D +   +  ++++           
Sbjct: 561 FYSLAIMLSTPLQMFPAIKIIENKVFPRFTKIYVEGDGDRCDVEFRLNSGKANWKVKWLK 620

Query: 382 -LITSGLVLIIMCIA-LSTSNLGALLEIIGATSASLMAYILPPLTNL-------VITGKK 432
             + S +V  ++  A     NL  ++ +IG+ +   + YI PPL +L         +G  
Sbjct: 621 NFVRSIIVSFVIIFAYYEVDNLDKVVSLIGSFACIPLVYIYPPLLHLRSRSRSQSPSGDP 680

Query: 433 KSLKEKLPYCGCIVFGVILMFVSTAQTIL 461
              K  L +   +VFG I M  ++ Q++ 
Sbjct: 681 SKWKLVLDHI-LVVFGGISMIYTSYQSMF 708

>TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.252
           YKL146W
          Length = 613

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 78/175 (44%), Gaps = 23/175 (13%)

Query: 296 LILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVL 355
            I S ++C    YS F + K +TV  +L NFP D      A+LL    +L + PL++F  
Sbjct: 449 FITSGLIC----YSAFGS-KVETV--VLLNFPQDSPFTKSAQLLYVLAILLSTPLQLFPA 501

Query: 356 RDVIRDIIYYNKDDPEPVKLTTKMHALIT-------SGLVLIIMCIALSTSN-LGALLEI 407
             ++ +  +       PV  + K +  I        S +V+    IA   +N L   + +
Sbjct: 502 IRILENWTF-------PVDASGKHNPHIKWLKNYFRSAIVIATSLIAWGGANDLDKFVSL 554

Query: 408 IGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIV-FGVILMFVSTAQTIL 461
           +G+ +   + YI PP  +      K + K  L     I   GVI+M  +T Q+IL
Sbjct: 555 VGSFACVPLIYIYPPALHFKAFKDKNASKISLVTDVVIASVGVIIMLYNTYQSIL 609

>CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146w or
           uniprot|P50944 Saccharomyces cerevisiae YNL101w
          Length = 681

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 62/143 (43%), Gaps = 7/143 (4%)

Query: 322 ILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIY----YNKDDPEPVKLTT 377
           +L NFP +       +LL    +L + PL++F    ++ +  +      K +P+   L  
Sbjct: 537 VLLNFPQESIYTRAVQLLYALAILLSTPLQLFPAIKILENWTFSPHSSGKHNPKVKWLKN 596

Query: 378 KMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKE 437
              A I     LI    A   ++L   + ++G+ +   + YI PP+ +     K KS   
Sbjct: 597 YFRAAIVCFSALIAWAGA---NDLDKFVSLVGSFACIPLIYIYPPMLHFKAFKKDKSKLF 653

Query: 438 KLPYCGCIVFGVILMFVSTAQTI 460
                  + FG+I+M  ++ QTI
Sbjct: 654 MASDIFLLFFGIIVMIYTSLQTI 676

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 58/105 (55%), Gaps = 15/105 (14%)

Query: 367 KDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNL 426
           +D+   ++  T     I++ L++ +  IAL+  +   +L ++GAT ++ +++ILP L   
Sbjct: 394 RDECPALRFYT-----ISAFLLISMFSIALNIKSFALVLSLVGATGSTSISFILPGLLGY 448

Query: 427 VITGKKK-SLKEKLPYCG-C--------IVFGVILMFVSTAQTIL 461
           ++ G+ K S  E+L     C        +VFG+++MF+S   T++
Sbjct: 449 ILIGRDKISRCEQLSTSDICYKRLSLVLMVFGILVMFLSLYTTLV 493

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 31/45 (68%)

Query: 67  AKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSI 111
           A ++ + + +N+  +I+G+G++  PFA +N GI+ G+  T+L +I
Sbjct: 4   ATASIHSSIINLTKTIVGAGMLAIPFAFRNDGILVGILLTLLAAI 48

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 295 SLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNV-INFARLLLGFNMLTTFPLEIF 353
           S+ +S I+ L  +  G+L F   T+GNI+ N+   +++ I   +L LG  ++ TFPL   
Sbjct: 233 SIAISTIIFLIISIFGYLTFGTLTLGNIMLNYNYSNSLYIILGKLALGIMVILTFPLLFH 292

Query: 354 VLRDVIRDIIYY 365
            LR    +II +
Sbjct: 293 PLRIACNNIIVW 304

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 78/175 (44%), Gaps = 23/175 (13%)

Query: 300 CIVCLTTAYSGFLNFKD-----KTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFV 354
           CIV +     G L +       KTV  +L NFP D +     +LL    +L + PL++F 
Sbjct: 522 CIVAVIFISCGLLCYAAFGSDVKTV--VLLNFPQDTSYTLTVQLLYALAILLSTPLQLFP 579

Query: 355 LRDVIRDIIY----YNKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGA 410
              ++ +  +      K +P+   L       I   +VL  +   +  ++L   + ++G+
Sbjct: 580 AIRILENWTFPSNASGKYNPKVKWLKNYFRCAI---VVLTSILAWVGANDLDKFVSLVGS 636

Query: 411 TSASLMAYILPPLTN-----LVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTI 460
            +   + YI PPL +     L  T + + L + +     IVFGV +M  ++ QTI
Sbjct: 637 FACIPLIYIYPPLLHYKASILSGTSRARLLLDLI----VIVFGVAVMAYTSWQTI 687

>ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL146W
          Length = 678

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 76/159 (47%), Gaps = 5/159 (3%)

Query: 311 FLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIF-VLRDVIRDIIYYNKDD 369
           +  F  K    IL NFP D  +    +LL    ++ + PL++F  +R +   ++  ++  
Sbjct: 521 YAAFGAKVETVILLNFPQDSALGTGVQLLYAAAIMLSTPLQLFPAIRILENVVVTTSRSG 580

Query: 370 PEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVI- 428
               K+    +      +VL+++  +L +++L   + +IG+ +   + Y+ PPL + V+ 
Sbjct: 581 KYSTKVKWIKNWFRALVVVLMLVLASLGSNDLDKFVSLIGSFACIPLIYVYPPLLHYVVF 640

Query: 429 --TGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEAFA 465
             TG    +   L     + FG+ +M  +T QT+++ + 
Sbjct: 641 RGTGTVSQVALALDLA-VMAFGLGIMGYTTVQTVVQWYG 678

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 63/146 (43%), Gaps = 11/146 (7%)

Query: 322 ILNNFPSDDNVINFARLLLGFNMLTTFPLEIF----VLRDVIRDIIYYNKDDPEPVKLTT 377
           +L NFP D       +LL    +L + PL++F    +L + +    Y  K +P+      
Sbjct: 429 VLLNFPQDSPYTLIVQLLYSLAILLSTPLQLFPAIRILENWVFKSRYSGKYNPKIKWAKN 488

Query: 378 KMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTN---LVITGKKKS 434
               L+  G   I     +   +L   + ++G+ +   + YI PPL +   L   G   +
Sbjct: 489 YFRTLVVIGTSFIAW---IGADDLDKFVSLVGSFACIPLIYIYPPLLHIKALKRNGTVTN 545

Query: 435 LKEKLPYCGCIVFGVILMFVSTAQTI 460
           L   +  C  I+FG  ++  ++ QTI
Sbjct: 546 LHLIVDSC-MIIFGFTILIYTSCQTI 570

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 41/221 (18%), Positives = 93/221 (42%), Gaps = 38/221 (17%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S+RNP  ++F  +  + L++   + +     G+L F       IL++F   +  ++ A+L
Sbjct: 343 SMRNP--EKFPLVLSLVLLVCTAIFMLIGTLGYLTFGKDITPVILSSFNQKNKFVSIAQL 400

Query: 339 LLGFNMLTTFPLEIFVLRDVIRDIIYY-----------------NKDDPEPVKLTTK--- 378
                +L + P+++F +  ++ + I+                  N ++     LT K   
Sbjct: 401 CYSIAILLSTPIQLFPVYKMVEEAIFKKNKNNTAISSTSSEPQDNDNEENKAMLTEKIIL 460

Query: 379 ----------MHALITSGLVLIIMCIA-LSTSNLGALLEIIGATSASLMAYILPPLTNLV 427
                     +  L  + +VL++  I+   + +L   + I+G+ +   + YI PP  +L 
Sbjct: 461 SGRDSNKIKWLKNLSRTTIVLLVTIISYFGSQDLSKFVAIVGSVACIPLIYIYPPFFHLK 520

Query: 428 ITGKKKSLKEKLPY-----CGCIVFGVILMFVSTAQTILEA 463
                 SL  K  +        ++FG++ +  ++ Q+I  +
Sbjct: 521 THSLPNSLNLKFKWRVIIDITLLIFGLLAVLYTSYQSIFNS 561

>KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {ON}
           Anc_2.177 YNL101W
          Length = 736

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 86/432 (19%), Positives = 163/432 (37%), Gaps = 87/432 (20%)

Query: 50  NVNEEDPLTDDIYLSNEAKSNRYMA-----FMNMANSILGSGVIGQPFAMKNCGIIGGLF 104
           ++NE++PL     +       R  A     F+ +  S +G+GV+  P    N G++  + 
Sbjct: 294 SINEDNPLLPVASVKALVSEVRGTASTGKVFLLLLKSFIGTGVLFLPSGFANGGLLFSIA 353

Query: 105 ATILMSILVDWTIRLIV-------------INLKLTGK----STYQASVETAMGQWGGLL 147
             +   +   W   +++             I LKL G         A V T +G  G  +
Sbjct: 354 MLVFFGVYSYWCYYILIESKIATKVKSFGDIGLKLYGPWLKFVILFAIVSTQVGFSGAYM 413

Query: 148 ILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNR 207
           I  +  L A            +++ HV     P          +I L  L +  PLS  R
Sbjct: 414 IFTAKNLSAFV----------ENVFHVSDINLP----------MIMLFQLVVYVPLSFVR 453

Query: 208 DISKLSKTSMXX----------XXXXXXXXXXXXXXXXXXSGEYKGTFHLH-QLFITPRI 256
           +ISKLS  S+                               G   G  H    LFI   I
Sbjct: 454 NISKLSLPSLVANFFIMAGLVIVLFFTAKQLFIDSGMKVAEGIIFGVNHERWSLFIGTAI 513

Query: 257 --FQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNF 314
             F+GI +I    +   +T      +R+P  ++F  +  + ++ +  + ++ A  G+L +
Sbjct: 514 FAFEGIGLI----IPVQDT------MRHP--EKFPLVLKLVILTATCLFISVATIGYLAY 561

Query: 315 KDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIY------YNKD 368
                  IL N P  +  +   +L     ++ + PL+++    +I + ++      Y +D
Sbjct: 562 GSSVQTVILLNLPQGNVFVLLIQLFYSMAIMLSTPLQLYPAIKIIENKVFPQFIKIYERD 621

Query: 369 D----------PEPVKLTTK---MHALITSGLVLIIMCIAL-STSNLGALLEIIGATSAS 414
                      P   KL+ +   +  L+ S +V +++  A      L  ++ +IG+    
Sbjct: 622 SQAQTTRVRYRPNSGKLSWRVKWLKNLVRSAIVFLVVLFAYCGIDYLDKVVAVIGSLCCL 681

Query: 415 LMAYILPPLTNL 426
            + Y++PP+ +L
Sbjct: 682 PLVYVIPPMLHL 693

>Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101W
           (REAL)
          Length = 715

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 88/208 (42%), Gaps = 28/208 (13%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S+RNP  ++F  +  + ++ + I+ ++ A  G+L +       IL N P  +  +N  +L
Sbjct: 509 SMRNP--EKFPLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQL 566

Query: 339 LLGFNMLTTFPLEIFVLRDVIRD-------IIYYNKDD--------PEPVKLTTKMHAL- 382
                ++ + PL++F    +I +        IY   DD        P   KL  ++  L 
Sbjct: 567 FYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLDWRVKWLK 626

Query: 383 ---ITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLV------ITGKKK 433
               +  +++++      + NL   + +IG+ +   + YI P + +L         GK  
Sbjct: 627 NFIRSIIVIIVVAIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGKFW 686

Query: 434 SLKEKLPYCGCIVFGVILMFVSTAQTIL 461
             K  L     I FG+  M  ++ Q+I 
Sbjct: 687 RFKPMLDII-LIFFGIASMLYTSYQSIF 713

>YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 713

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 88/207 (42%), Gaps = 26/207 (12%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S+RNP  ++F  +  + ++ + I+ ++ A  G+L +       IL N P  +  +N  +L
Sbjct: 507 SMRNP--EKFPLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQL 564

Query: 339 LLGFNMLTTFPLEIFVLRDVIRD-------IIYYNKDD--------PEPVKLTTKMHAL- 382
                ++ + PL++F    +I +        IY   DD        P   KL  K+  L 
Sbjct: 565 FYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLNWKIKWLK 624

Query: 383 ---ITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNL---VITGKKKSLK 436
               +  +++++      + NL   + +IG+ +   + YI P + +L    +   K    
Sbjct: 625 NFIRSIIVIIVVSIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFW 684

Query: 437 EKLPYCGCIV--FGVILMFVSTAQTIL 461
              P    I+  FG+  M  ++ Q+I 
Sbjct: 685 RFKPMLDTILIFFGIASMLYTSYQSIF 711

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 85/186 (45%), Gaps = 8/186 (4%)

Query: 279 SLRNPSLKRFNQLTHVSLILSC--IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFA 336
           S+R+P+  R   L+ V  I++   I C    Y+ F     KTV  +L NFP + +     
Sbjct: 526 SMRHPNHFR-PSLSAVMCIVAVVFISCGLLCYAAF-GADVKTV--VLLNFPQNSSYTLTV 581

Query: 337 RLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIAL 396
           +LL    +L + PL++F    ++ +  + +    +       +       +VL+   +A 
Sbjct: 582 QLLYALAILLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVLLTSILAW 641

Query: 397 STSN-LGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIV-FGVILMFV 454
             +N L   + ++G+ +   + YI PPL +   +    + + +L     ++ FGV +M  
Sbjct: 642 VGANDLDKFVSLVGSFACVPLIYIYPPLLHFKASSISGTSRGRLLLDLIVISFGVAVMVY 701

Query: 455 STAQTI 460
           ++ QTI
Sbjct: 702 TSWQTI 707

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 86/424 (20%), Positives = 174/424 (41%), Gaps = 50/424 (11%)

Query: 74  AFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQ 133
           AF+ +  S +G+GV+  P A  N G+   +    L+ +   W    I++  K+  K+   
Sbjct: 304 AFLLLLKSFVGTGVLFLPDAFHNGGLAFSIIVLTLVGLYSYWCY-YILVQTKVKVKACSF 362

Query: 134 ASVETAM-GQWGGLLILVSNGLFAXXXXXXXXXXXXDSIPHVLSAFFPSHTDLFHRNVII 192
             + + + G+W   +ILV+  +               ++   L   F  H   F+   I+
Sbjct: 363 GDIGSQLYGKWMKSVILVAIFVSQLGFSAAYMIFTAKNLGAFLQNIF--HLKDFNLGYIM 420

Query: 193 TLVTLFISFPLSLNRDISKLSKTSMXXXXXXXXXXXXXXXXXXXXSGEYKGTFHLH---- 248
            +  +F   PLS  R+ISKLS  S+                    S        +H    
Sbjct: 421 IIQLIFF-VPLSFIRNISKLSLPSLIANVFIMLGLLIILIFA---SKHLFLDLGVHPAAG 476

Query: 249 -QLFITPR---IFQGISVISF---ALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCI 301
            +  I PR   +F G ++ SF    L+     S     ++ P  ++F+ +  + +I + I
Sbjct: 477 VEYGIDPRRWTLFVGTAIFSFEGIGLIIPVQDS-----MKRP--EKFSLVLKLVMITTTI 529

Query: 302 VCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRD 361
           + +T A  G+L +  +    +L N P  +  +N  + L    ++ + PL++F    ++  
Sbjct: 530 IFITIATVGYLAYGSEIQTVVLLNLPQGNLFVNLIQFLYSLAIMLSTPLQLFPAIKILEG 589

Query: 362 IIYYNKDDPEPVKLTTK--------------------MHALITSGLVLIIMCIA-LSTSN 400
            ++Y  +     +L+ +                    +  L+ S +V+  + IA L   +
Sbjct: 590 KVFYRYNKKVSRQLSGEANESTKGGSYSGKSNMKIKWLKNLLRSTIVVGAILIAYLGMDS 649

Query: 401 LGALLEIIGATSASLMAYILPPLTNL---VITGKKKSLKEKLPYCGCIVFGVILMFVSTA 457
           L  ++ IIG+     + +ILPPL ++   + + +  +    L     I  G++ MF ++ 
Sbjct: 650 LDKVVSIIGSFCCLPLVFILPPLLHMKSCMDSSRDDNKHTILVDRVLIACGIVAMFYTSY 709

Query: 458 QTIL 461
           Q++ 
Sbjct: 710 QSLF 713

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 89/205 (43%), Gaps = 41/205 (20%)

Query: 250 LFITPRI--FQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTA 307
           LFI   I  F+G+ ++   +  H+N S         S K F ++  + ++   I+ +   
Sbjct: 211 LFIGTAIYAFEGVGLL---IPIHNNMS---------SPKDFPKILLLVMLTMSIIFILIG 258

Query: 308 YSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNK 367
             G+L++ +K    IL +F +    +N   +     +L + PL++F L  ++ D ++  K
Sbjct: 259 TCGYLSYGEKIKVIILQSF-APGIFVNIIIVCFTIGILLSTPLQLFSLTSLLEDFLFTKK 317

Query: 368 ---------------------DDPEPV---KLTTKMHALITSGLVLIIMCIA--LSTSNL 401
                                 D E      +  +++ +I   L++  +C+   +++  L
Sbjct: 318 KIAVADEDLKVLEESDILCSESDTEAQGTKHINLRVYKIILRFLIVTTVCLIGYITSDKL 377

Query: 402 GALLEIIGATSASLMAYILPPLTNL 426
             L+ I+G+ +   + YI PPL NL
Sbjct: 378 NKLVAIVGSLACIPLVYIYPPLLNL 402

>Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W
           (REAL)
          Length = 719

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 80/186 (43%), Gaps = 13/186 (6%)

Query: 284 SLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKD-----KTVGNILNNFPSDDNVINFARL 338
           S+K  N        + CIV +     G L +       KTV  +L NFP D +     +L
Sbjct: 533 SMKHPNHFQPSLSAVMCIVAVVFISCGLLCYAAFGADVKTV--VLLNFPQDSSYTLTVQL 590

Query: 339 LLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIALST 398
           L    +L + PL++F    ++ +  + +    +       +       +VL+   +A   
Sbjct: 591 LYALAILLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVLLTSVLAWVG 650

Query: 399 SN-LGALLEIIGATSASLMAYILPPLTN---LVITGKKKSLKEKLPYCGCIVFGVILMFV 454
           +N L   + ++G+ +   + YI PP+ +     ++G  ++    L     + FGV++M  
Sbjct: 651 ANDLDKFVSLVGSFACIPLIYIYPPMLHYKAFSLSGISRA--RLLLDLVVLSFGVVVMAY 708

Query: 455 STAQTI 460
           ++ QTI
Sbjct: 709 TSWQTI 714

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 43/112 (38%), Gaps = 4/112 (3%)

Query: 254 PRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLN 313
           PR+  G+ ++ F   CH N        R   LK   ++    L     VCL    +G+L 
Sbjct: 188 PRLL-GLPLLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYAAVCLICGITGYLT 246

Query: 314 FKDKT---VGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDI 362
           F   T     N+L  +P    +    R+    ++  +FPL     R  +  I
Sbjct: 247 FHKSTRTIPSNVLLLYPQGSILGTLCRVTTLLSVTLSFPLLCHPTRAALNHI 298

>KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.252
           YKL146W
          Length = 646

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 9/187 (4%)

Query: 279 SLRNPSLKRFNQLTHVSLILSC--IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFA 336
           S+R+P  K  + L  V  I+S   I C    YS F     +TV  +L NFP D       
Sbjct: 462 SMRHPE-KFQSSLFGVMCIVSVVFISCGLLCYSAF-GSNVQTV--VLLNFPQDSPYTLLV 517

Query: 337 RLLLGFNMLTTFPLEIFVLRDVIRDIIY-YNKDDPEPVKLTTKMHALITSGLVLIIMCIA 395
           +L     +L + PL++F    ++    +  N       K+  + +      +VL  +   
Sbjct: 518 QLFYSMAILLSTPLQLFPAIRILEHWTFPSNASGKYNPKIKWRKNYFRCIIVVLTSVLAW 577

Query: 396 LSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIV--FGVILMF 453
           +  SNL   + ++G+ +   + YI PPL +       +  +     C  ++  FGV +M 
Sbjct: 578 VGASNLDKFVSLVGSLACIPLIYIHPPLLHFKAFKDDQDTRYWSLICDILLLAFGVGVMT 637

Query: 454 VSTAQTI 460
            ++ QT+
Sbjct: 638 YTSVQTL 644

>Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AER380C
          Length = 715

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 49/106 (46%), Gaps = 5/106 (4%)

Query: 51  VNEEDPL----TDDIY-LSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFA 105
           ++E  PL    T+ ++ ++   K++ + AF+ +  S +G+GV+  P A  N G+   +  
Sbjct: 275 IDETTPLLSGDTERLHPITVRVKTSTFKAFLLLIKSFVGTGVLFLPNAFSNGGLAFSIIM 334

Query: 106 TILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLILVS 151
             + S    W   ++V     TG S++        G W   +IL S
Sbjct: 335 LFIFSGYSYWCYYILVRTKVSTGVSSFGDIGAMLYGPWMKYIILFS 380

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 64/152 (42%), Gaps = 1/152 (0%)

Query: 311 FLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDP 370
           +L F  K    +L NFP D       +L+    +L + PL++F    +     + +    
Sbjct: 453 YLAFGAKVETVVLLNFPQDSIATISVQLIYSLAILLSTPLQLFPAIRIFETWTFPSNASG 512

Query: 371 EPVKLTTKMHALITSGLVLIIMCIALSTSN-LGALLEIIGATSASLMAYILPPLTNLVIT 429
           +       +     +G+V+    +A   +N L   + ++G+ +   + YI PPL +L  +
Sbjct: 513 KHNHRVKWLKNYFRTGVVIFTALLAWVGANDLDKFVSLVGSFACIPLIYIYPPLLHLKSS 572

Query: 430 GKKKSLKEKLPYCGCIVFGVILMFVSTAQTIL 461
             + S    L       FGV +M  ++ Q I+
Sbjct: 573 DTQTSKFIILGDLLIFFFGVGVMAYTSYQNIV 604

>Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101W
           (REAL)
          Length = 713

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 88/207 (42%), Gaps = 26/207 (12%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S+RNP  ++F  +  + ++ + ++ ++ A  G+L +       IL N P  +  +N  +L
Sbjct: 507 SMRNP--EKFPLVLGLVILTATLLFISIATLGYLAYGSSVRTVILLNLPQSNIFVNLIQL 564

Query: 339 LLGFNMLTTFPLEIFVLRDVIRD-------IIYYNKDD--------PEPVKLTTKMHAL- 382
                ++ + PL++F    +I +        IY   +D        P   KL  K+  L 
Sbjct: 565 FYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHNDLTTRVELRPNSGKLNWKIKWLK 624

Query: 383 ---ITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNL---VITGKKKSLK 436
               +  +++++      + NL   + +IG+ +   + YI P + +L    +   K    
Sbjct: 625 NFIRSIIVIIVVAIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFW 684

Query: 437 EKLPYCGCIV--FGVILMFVSTAQTIL 461
              P    I+  FG+  M  ++ Q+I 
Sbjct: 685 RFKPVLDSILIFFGIASMLYTSYQSIF 711

>Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101W
           (REAL)
          Length = 716

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 40/207 (19%), Positives = 89/207 (42%), Gaps = 26/207 (12%)

Query: 279 SLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARL 338
           S+++P  ++F  +  + ++ + ++ ++ A  G+L +       IL N P  +  +N  +L
Sbjct: 510 SMKHP--EKFPLVLGLVILTATVLFISIATLGYLAYGSDVKTAILLNLPQSNIFVNLIQL 567

Query: 339 LLGFNMLTTFPLEIFVLRDVIRD-------IIYYNKDD--------PEPVKLTTKMHAL- 382
                ++ + PL++F    +I +        IY   DD        P   KL  K+  L 
Sbjct: 568 FYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLDWKVKWLK 627

Query: 383 ---ITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKL 439
               +  +++++      + NL   + +IG+ +   + YI P + +L      ++  E  
Sbjct: 628 NFIRSIIVIIVVSIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFW 687

Query: 440 PYCGC-----IVFGVILMFVSTAQTIL 461
            +        I+FG+  M  ++ Q+I 
Sbjct: 688 KFKPILDTILILFGITSMLYTSYQSIF 714

>SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 616

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 68/166 (40%), Gaps = 11/166 (6%)

Query: 301 IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIR 360
           I C    YS F     KTV  IL NFP D       +      +L + PL++F    ++ 
Sbjct: 453 ISCGCLCYSAF-GADVKTV--ILLNFPQDSIFTGGVQFSYALAILLSTPLQLFPAIRILE 509

Query: 361 DIIY----YNKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLM 416
           + ++      K +P+   L       +    V I     +  ++L   + ++G+ +   +
Sbjct: 510 NAVFPSHASGKHNPKVKWLKNYFRCFVVIASVAIAW---VGANDLDKFVSLVGSLACIPL 566

Query: 417 AYILPPLTNL-VITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTIL 461
            YI PP+ +     G   S  + +     + FG+ +M   + QT+L
Sbjct: 567 IYIYPPMLHYKAFRGTNISRHDLVLDQVVLWFGIAIMVYISLQTVL 612

>Skud_3.28 Chr3 (49532..50599) [1068 bp, 355 aa] {ON} YCL034W (REAL)
          Length = 355

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 6/44 (13%)

Query: 30  LTSFDDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKSNRYM 73
           LT++DD +   D+A D+N     + D  +DD+Y  NE  ++RY+
Sbjct: 290 LTAYDDRS-ALDTASDEN-----DRDSYSDDVYDENEQDNSRYI 327

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 23/114 (20%), Positives = 49/114 (42%), Gaps = 6/114 (5%)

Query: 240 EYKG---TFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSL 296
           E++G     H+H +     +    S+I  A     N   +   L++ S     ++ + S+
Sbjct: 174 EHRGDVSWLHIHSV---GELVSTFSIIILAYTGSMNMFSVINELKDNSTANAKRVVYYSV 230

Query: 297 ILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPL 350
            +S ++ L+    G+L F +  + N++ N+             LG  ++ +FPL
Sbjct: 231 GISTLIFLSVGLGGYLTFGNNVLTNVILNYDESAITTRIGTFSLGTMVILSFPL 284

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,869,272
Number of extensions: 1752900
Number of successful extensions: 7367
Number of sequences better than 10.0: 131
Number of HSP's gapped: 7426
Number of HSP's successfully gapped: 213
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)