Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00594g1.10ON1941948491e-117
SAKL0C00572g1.10ON3381592924e-31
TDEL0C069301.10ON1841702484e-26
Kwal_33.130231.10ON1931822442e-25
ZYRO0F18370g1.10ON2201602262e-22
TPHA0E039601.10ON1771662111e-20
KNAG0C002701.10ON1741872102e-20
KLTH0F00572g1.10ON1951642051e-19
NCAS0B090601.10ON1671642014e-19
NDAI0A001901.10ON1711621918e-18
KAFR0D001901.10ON1851661797e-16
TBLA0A049701.10ON181551299e-09
Ecym_10121.10ON1771501165e-07
Kpol_2002.131.10ON164371007e-05
Smik_3.191.10ON144135740.18
KLTH0F07194g5.333ON92960710.98
TBLA0F029207.512ON92321682.5
Suva_7.1516.134ON26557646.2
NOTE: 3 genes in the same pillar as KLLA0C00594g were not hit in these BLAST results
LIST: Skud_3.8 YCL056C Suva_3.157

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00594g
         (194 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...   331   e-117
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...   117   4e-31
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   100   4e-26
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    99   2e-25
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...    92   2e-22
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...    86   1e-20
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    86   2e-20
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    84   1e-19
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    82   4e-19
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...    78   8e-18
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    74   7e-16
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    54   9e-09
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    49   5e-07
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    43   7e-05
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...    33   0.18 
KLTH0F07194g Chr6 (627776..630565) [2790 bp, 929 aa] {ON} some s...    32   0.98 
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    31   2.5  
Suva_7.151 Chr7 (283314..284111) [798 bp, 265 aa] {ON} YGL117W (...    29   6.2  

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score =  331 bits (849), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 173/194 (89%)

Query: 1   MCGDKEDDTEKLLDATKTIKSLIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGII 60
           MCGDKEDDTEKLLDATKTIKSLIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGII
Sbjct: 1   MCGDKEDDTEKLLDATKTIKSLIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGII 60

Query: 61  SDTNFLYQKLNKGDIGSKVWXXXXXXXXXXXXXXXXXXXXXKLKLRKECMNIASTYSPGF 120
           SDTNFLYQKLNKGDIGSKVW                     KLKLRKECMNIASTYSPGF
Sbjct: 61  SDTNFLYQKLNKGDIGSKVWLVSLLLSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGF 120

Query: 121 KKLVKEKILAESNQLSLKIRSLCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAA 180
           KKLVKEKILAESNQLSLKIRSLCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAA
Sbjct: 121 KKLVKEKILAESNQLSLKIRSLCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAA 180

Query: 181 TVLKFVSSSYQISL 194
           TVLKFVSSSYQISL
Sbjct: 181 TVLKFVSSSYQISL 194

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score =  117 bits (292), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 96/159 (60%)

Query: 32  SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWXXXXXXXXXXX 91
           S ED+LI  L S+++ FDD+YLL++FGII +TNF+Y+ LNKG +GSK+W           
Sbjct: 175 SFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKS 234

Query: 92  XXXXXXXXXXKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRSLCMDLLQDLL 151
                     +  L+KE  +     S  F K++ +K   +  QL  +I+ + +D+LQ+L 
Sbjct: 235 LGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNLA 294

Query: 152 YMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190
           Y+++V++D+FK+ L  +++R LE +SS  TV +F  + +
Sbjct: 295 YLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGF 333

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  100 bits (248), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 91/170 (53%)

Query: 21  SLIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVW 80
           SL         S ED LI  L SV SFFD++Y  +S GII + NFLY++LNKG  GSK+W
Sbjct: 10  SLGKPTGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLW 69

Query: 81  XXXXXXXXXXXXXXXXXXXXXKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIR 140
                                +++L+ E   +          ++KEKIL    + +  +R
Sbjct: 70  FVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMR 129

Query: 141 SLCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190
              +DLLQ+ +Y++IV ID+FK+N+  + ++ LE +S+  T+++F +  +
Sbjct: 130 ETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGF 179

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score = 98.6 bits (244), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 101/182 (55%), Gaps = 1/182 (0%)

Query: 6   EDDTEKLLDATKTIKSL-IANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTN 64
           +D     L+A K   SL +   +    ++E+  I  + SV+  FDD++LL+SFGIIS++N
Sbjct: 5   QDFLPHFLNARKLFDSLDVTKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESN 64

Query: 65  FLYQKLNKGDIGSKVWXXXXXXXXXXXXXXXXXXXXXKLKLRKECMNIASTYSPGFKKLV 124
           ++Y+KLNK    SKVW                     + +LRKE ++     S   ++ +
Sbjct: 65  YVYRKLNKSGFCSKVWLLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRAL 124

Query: 125 KEKILAESNQLSLKIRSLCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLK 184
            +KI  +   ++ ++  + ++++Q++ Y+IIV+ D+F +NL  ++K  LE  SS  TVLK
Sbjct: 125 SDKIALKIKDVNRRLILVALEIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLK 184

Query: 185 FV 186
           F+
Sbjct: 185 FL 186

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score = 91.7 bits (226), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 88/160 (55%), Gaps = 1/160 (0%)

Query: 32  SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWXXXXXXXXXXX 91
           + ED LI  L S+   FD++YLL++ GIIS+ N LY++LNKG+ GSK+W           
Sbjct: 56  TFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKS 115

Query: 92  XXXXXXXXXXKLKLRKECMNIASTYSPGF-KKLVKEKILAESNQLSLKIRSLCMDLLQDL 150
                     K KL++E   + +       K++++ K      + S+ I+ + ++LLQ L
Sbjct: 116 FSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTL 175

Query: 151 LYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190
            Y+ IV I++FKIN+S K  + LE +S    V++  ++ Y
Sbjct: 176 AYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGY 215

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 90/166 (54%), Gaps = 1/166 (0%)

Query: 22  LIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWX 81
           + ++E+      E  L++ L S+++ FD ++ LRS G+I + NF Y+ LN+ +IGSK+W 
Sbjct: 6   VFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWF 65

Query: 82  XXXXXXXXXXXXXXXXXXXXKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRS 141
                                  L+ E   I          ++ +KI   +  L  KI++
Sbjct: 66  VTLILSIRKLYKNILKSTKLLSLLKTELTKIEKNNDLT-SDIILQKIQNNNTILKKKIKN 124

Query: 142 LCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVS 187
             ++L+QD +Y+IIVS++IFKI++S K    LE++S++ ++LKF +
Sbjct: 125 FIIELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFT 170

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 95/187 (50%), Gaps = 40/187 (21%)

Query: 26  EDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWXXXXX 85
           + A S S ED+L+  L S+ S FD++YLL+S GIIS  NFLY+KLNKG++GSKVW     
Sbjct: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61

Query: 86  XXXXXXXXXXXXXXXXKLKLRKECMNIASTYSPGFK------KLVKEKILAES------- 132
                            L +RK    +       FK      +++++K L +S       
Sbjct: 62  -----------------LSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVL 104

Query: 133 NQLSLKIRSLC--------MDLLQDLLYMIIVSIDIFKINLSL-KFKRALELISSAATVL 183
           N+LS  +R  C        +DL Q L+Y+ IVS D F I     KFK+ L  +S+  T+L
Sbjct: 105 NKLSTNLRK-CHFMIIDTFLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTIL 163

Query: 184 KFVSSSY 190
           + + S Y
Sbjct: 164 RMLVSVY 170

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score = 83.6 bits (205), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 82/164 (50%)

Query: 27  DAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWXXXXXX 86
           +    ++E  L+  L +++  FDDL LLRSFG+I + N  YQKLNK    SK W      
Sbjct: 27  EGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTL 86

Query: 87  XXXXXXXXXXXXXXXKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRSLCMDL 146
                          + +L++E            +K++  K+ A   +++ K+  + ++L
Sbjct: 87  SSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLILVALEL 146

Query: 147 LQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190
           +Q++ Y+ +V+ D+    L+ K+KR LE +SS   + + + S +
Sbjct: 147 IQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGF 190

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score = 82.0 bits (201), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 91/164 (55%), Gaps = 7/164 (4%)

Query: 32  SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWXXXXXXXXXXX 91
            LED ++++L S+ + FD++Y  +S G++S+ N LY+ LNKGD GSK+W           
Sbjct: 3   GLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKL 62

Query: 92  XXXXXXXXXXKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLK-----IRSLCMDL 146
                     + K++KE ++ +   +   K LV   +L E  +LSL      IR+  ++L
Sbjct: 63  ITRLTKSLKIRAKIKKE-IDESPKENDEDKSLVNS-LLREKLELSLAKCMDIIRNNVLEL 120

Query: 147 LQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190
           LQ ++Y+ I  I++FK+ +  K+K  LE +S+  T+++   S Y
Sbjct: 121 LQTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGY 164

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score = 78.2 bits (191), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 85/162 (52%), Gaps = 8/162 (4%)

Query: 32  SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWXXXXXXXXXXX 91
           ++ED +I  L  + + FD++YLL+S GIIS+ N LY+ LNKG+ GSK+W           
Sbjct: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63

Query: 92  XXXXXXXXXXKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLK-----IRSLCMDL 146
                     +++L KE  N  S      + LV   +L E   + +K     I  L ++L
Sbjct: 64  VHQLIRAVKARIRLVKERKN--SKRITRNENLV-SSVLHEKLDIGIKKCSSMIMDLLLEL 120

Query: 147 LQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSS 188
            Q L+Y+ +VSI+IFK+  S K    LE +S+   +++  S+
Sbjct: 121 FQTLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFSA 162

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 73.6 bits (179), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 93/166 (56%), Gaps = 8/166 (4%)

Query: 32  SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWXXXXXXXXXXX 91
           +LED+LID L  + + FD++Y L++ G+I + NF+Y+KLNKG++GSK+W           
Sbjct: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77

Query: 92  XXXXXXXXXXKLKLRKECMNIA-----STYSPGFKKLVKEKILAESNQLSLKIRSLCMDL 146
                     + K   E   ++     S+ +     ++K+K+L    + +  IR L ++ 
Sbjct: 78  FKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLEF 137

Query: 147 LQDLLYMIIVSIDIFKI---NLSLKFKRALELISSAATVLKFVSSS 189
           LQ LLY+IIV I++FK+      +K  R LE++S+  TV + ++++
Sbjct: 138 LQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRIITAT 183

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa]
          {ON} Anc_1.10 YCL056C
          Length = 181

 Score = 54.3 bits (129), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (1%)

Query: 27 DAPSNSLEDL-LIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVW 80
          D  +NS+    ++  L S+ S FD++Y LRS G+ISDTN  Y+ LN+ ++GSK+W
Sbjct: 2  DIVNNSIWKFDILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIW 56

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 72/150 (48%), Gaps = 18/150 (12%)

Query: 23  IANEDAPSN----SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDI--G 76
           ++ ED+ +N    + ED L ++L S  +F+D +YL +S GII   N +Y+ L  G I  G
Sbjct: 19  LSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSG 78

Query: 77  SKVWXXXXXXXXXXXXXXXXXXXXXKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLS 136
           S++                       L+L +    + +   P     +K+K     +++ 
Sbjct: 79  SRLLFLLLVARKTFLKL---------LRLVRLWYALKNVLPPAS---IKKKYNETKSRVK 126

Query: 137 LKIRSLCMDLLQDLLYMIIVSIDIFKINLS 166
             I  L +DLL  L+Y+I+V ID+FK  +S
Sbjct: 127 RSILRLSVDLLDTLVYLIVVLIDLFKFKVS 156

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
          complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 28/37 (75%)

Query: 34 EDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKL 70
          ED+++D L  + S FD +Y +++ GII+D +FLY+K+
Sbjct: 7  EDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKI 43

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 33.1 bits (74), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (42%), Gaps = 13/135 (9%)

Query: 22  LIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWX 81
           +++ + +   S ++L I+    VSS  D   +L + G++ D      KL    +  KVW 
Sbjct: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDD------KLYVSGVLRKVWL 54

Query: 82  XXXXXXXXXXXXXXXXXXXXKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRS 141
                               K K+ +  +N      PG   LVKEK++    +   +IR 
Sbjct: 55  CYSWISVIKCVWKLINLCKVKFKIDQR-LN-----GPG-NGLVKEKLMNFKKRYRDQIRQ 107

Query: 142 LCMDLLQDLLYMIIV 156
           +   LLQDL Y++++
Sbjct: 108 ITATLLQDLSYLMVL 122

>KLTH0F07194g Chr6 (627776..630565) [2790 bp, 929 aa] {ON} some
           similarities with uniprot|P46676 Saccharomyces
           cerevisiae YDR310C SUM1 Suppresor of mar1-1 (sir2)
           mutation nuclear protein involved in silencing
          Length = 929

 Score = 32.0 bits (71), Expect = 0.98,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 1   MCGDKEDDTEKLLDATKTIKSLIANEDAPSNSLEDLL---IDSLTSVSSFFDDLYLLRSF 57
           +C + ED  + L + T   KSL  N+    N LEDLL   +++ +SV++  + L  +  F
Sbjct: 150 VCSNDEDLNQVLGNLTSATKSLAHNQSVLENKLEDLLRNQVNTDSSVNNLLEKLDQVSQF 209

>TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.512
           YLR451W
          Length = 923

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 35  DLLIDSLTSVSSFFDDLYLLR 55
           DL+++S  SVS FFD LY+LR
Sbjct: 650 DLIVNSRMSVSVFFDSLYILR 670

>Suva_7.151 Chr7 (283314..284111) [798 bp, 265 aa] {ON} YGL117W
           (REAL)
          Length = 265

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 16  TKTIKSLIANEDAPSNSLEDLLI--DSLTSVSSFFDDLYLLRSFGIISDTNFLYQKL 70
           T +++SL   + +PS  +EDL I   S+T V +  + LY   S+  +   N  +QKL
Sbjct: 94  TNSLRSLHEEKRSPSELVEDLTIKLKSITEVYNHLNKLY--HSYLTVKHNNIAHQKL 148

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,980,219
Number of extensions: 620408
Number of successful extensions: 2369
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2382
Number of HSP's successfully gapped: 24
Length of query: 194
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 90
Effective length of database: 41,556,135
Effective search space: 3740052150
Effective search space used: 3740052150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)