Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00572g1.9ON71271235860.0
SAKL0C00550g1.9ON73272726160.0
Kpol_2002.121.9ON73971024510.0
ZYRO0F18392g1.9ON72571624050.0
NCAS0B090701.9ON73070623700.0
TPHA0E039701.9ON74772323540.0
KNAG0C002601.9ON74471623390.0
KAFR0D001801.9ON72370923060.0
TBLA0A075601.9ON74168022860.0
CAGL0B00418g1.9ON74367822830.0
NDAI0A001801.9ON74068722770.0
Ecym_1011na 1ON71671521680.0
Suva_3.1561.9ON71272221610.0
YCL057W (PRD1)1.9ON71272221530.0
Smik_3.181.9ON71270921450.0
Skud_3.71.9ON71271021390.0
AGR406C1.9ON68367617810.0
AGR405Cna 1ON71767717150.0
ABR185WsingletonON4574149731e-124
KNAG0A062002.432ON7895765052e-53
CAGL0D02112g2.432ON7615474858e-51
Kpol_297.82.432ON7875534743e-49
Suva_11.912.432ON7755824672e-48
Skud_11.932.432ON7725484653e-48
Kwal_26.76162.432ON7705614573e-47
NDAI0E020102.432ON7785564573e-47
SAKL0E03938g2.432ON7675484557e-47
Smik_11.1022.432ON7725484522e-46
ZYRO0G20130g2.432ON7866454433e-45
KAFR0D029502.432ON7776254399e-45
YKL134C (OCT1)2.432ON7725484362e-44
TDEL0A020802.432ON7876034372e-44
AFR198W2.432ON7765464292e-43
KLTH0D04730g2.432ON7725824273e-43
NCAS0A042802.432ON7735584248e-43
Ecym_60992.432ON7735434168e-42
TBLA0I007102.432ON7735604123e-41
TPHA0G023902.432ON7956304114e-41
KLLA0B12397g2.432ON7795593714e-36
CAGL0I03718g7.322ON1201116850.14
Skud_4.409na 2ON165575810.49
Skud_4.4088.331ON203075800.62
KLTH0H01892g7.322ON120970761.7
Kwal_56.245267.322ON121070761.8
TDEL0C022407.322ON120170752.6
KAFR0L013907.322ON120670743.2
KNAG0B027207.322ON120475743.5
TPHA0D024505.545ON52237733.6
ZYRO0F11110g7.322ON120170733.8
ADR077C7.322ON120470734.4
TBLA0F022307.322ON121670726.1
KLLA0F04884g7.322ON121270716.5
Suva_4.997.322ON120170716.7
YDL145C (COP1)7.322ON120170717.3
KLLA0E04511g7.221ON302104707.4
Skud_4.1097.322ON120170717.6
Smik_4.907.322ON120170718.0
NCAS0A139407.322ON120570709.5
KAFR0B049502.363ON62074709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00572g
         (712 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...  1385   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...  1012   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   948   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   931   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   917   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   911   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   905   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   892   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   885   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   884   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        881   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   839   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   837   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   833   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   830   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    828   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   690   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   665   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   379   e-124
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   199   2e-53
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   191   8e-51
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   187   3e-49
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   184   2e-48
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   183   3e-48
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   180   3e-47
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   180   3e-47
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   179   7e-47
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   178   2e-46
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   175   3e-45
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   173   9e-45
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   172   2e-44
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   172   2e-44
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   169   2e-43
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   169   3e-43
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   167   8e-43
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   164   8e-42
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   163   3e-41
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   162   4e-41
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   147   4e-36
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    37   0.14 
Skud_4.409 Chr4 (728373..733340) [4968 bp, 1655 aa] {ON} YDR150W...    36   0.49 
Skud_4.408 Chr4 (727248..733340) [6093 bp, 2030 aa] {ON} YDR150W...    35   0.62 
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    34   1.7  
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    34   1.8  
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    33   2.6  
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    33   3.2  
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    33   3.5  
TPHA0D02450 Chr4 (505488..507056) [1569 bp, 522 aa] {ON} Anc_5.5...    33   3.6  
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    33   3.8  
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    33   4.4  
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    32   6.1  
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    32   6.5  
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    32   6.7  
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    32   7.3  
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    32   7.4  
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    32   7.6  
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    32   8.0  
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    32   9.5  
KAFR0B04950 Chr2 complement(1027783..1029645) [1863 bp, 620 aa] ...    32   9.6  

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score = 1385 bits (3586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/712 (94%), Positives = 676/712 (94%)

Query: 1   MRNVLANLRFKSATSLVVIPTLAFASFQFNAIRSIMTKTDFVVPQAAPSWNYTTEELLKQ 60
           MRNVLANLRFKSATSLVVIPTLAFASFQFNAIRSIMTKTDFVVPQAAPSWNYTTEELLKQ
Sbjct: 1   MRNVLANLRFKSATSLVVIPTLAFASFQFNAIRSIMTKTDFVVPQAAPSWNYTTEELLKQ 60

Query: 61  THEAXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTS 120
           THEA                PSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTS
Sbjct: 61  THEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTS 120

Query: 121 TKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGL 180
           TKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGL
Sbjct: 121 TKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGL 180

Query: 181 NLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDEDG 240
           NLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDEDG
Sbjct: 181 NLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDEDG 240

Query: 241 ITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNY 300
           ITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNY
Sbjct: 241 ITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNY 300

Query: 301 DSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRY 360
           DSYADYNLDIKMAKKEEAVLTFLNDLKNKLKP                    NTPYDRRY
Sbjct: 301 DSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNTPYDRRY 360

Query: 361 YIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGDTWHP 420
           YIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGDTWHP
Sbjct: 361 YIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGDTWHP 420

Query: 421 DVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVC 480
           DVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVC
Sbjct: 421 DVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVC 480

Query: 481 NFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLE 540
           NFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLE
Sbjct: 481 NFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLE 540

Query: 541 FWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKD 600
           FWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKD
Sbjct: 541 FWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKD 600

Query: 601 ISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYY 660
           ISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYY
Sbjct: 601 ISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYY 660

Query: 661 TKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
           TKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL
Sbjct: 661 TKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score = 1012 bits (2616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/727 (66%), Positives = 575/727 (79%), Gaps = 22/727 (3%)

Query: 6   ANLRFKSATSLVVIPTLAFASFQ---------------FNAIRSIMTKTDFVVPQAAPSW 50
           AN    + TSL+ IP LAF ++                ++ + + M+ T  V PQAAPSW
Sbjct: 7   ANKFCSTTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSAT-LVPPQAAPSW 65

Query: 51  NYTTEELLKQTHEAXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHV 110
            Y+ E++L+ T+E                 P+VE+ V P+L HENT  PL NQLTFLQHV
Sbjct: 66  KYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHV 125

Query: 111 SSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFEIYKFVEK 170
           S+DKE+RD STK TEL+++F IE+SLR  LF QFD VW   KDDA+FKK+HFE+YKFVEK
Sbjct: 126 SADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYKFVEK 185

Query: 171 CHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVM 230
           CHKD++R+GLNLPEE+R++VKE++KKISNNSLQFSKNLGEQ EF+ FT EEL GVS +VM
Sbjct: 186 CHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVM 245

Query: 231 KQFET-VDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQ 289
            QFE   D DG+ K+KV+FKYPDI PVLK+AKN ETRKRAF GDQNKVPQNE LFLETL+
Sbjct: 246 DQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLR 305

Query: 290 LRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXX 349
           LR++LA LL Y +YA+YNLDIKMAKK+E VL FL DLKNKLKP                 
Sbjct: 306 LRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDC 365

Query: 350 XXXNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKF 409
                P+D  YYIWDNRYYDN+YLK+N+ +DEEKI+EYFPLE TI GML+IYETVLKLKF
Sbjct: 366 KELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKF 425

Query: 410 IEEDNGD---TWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFL 465
           +EE + +    WH DVK+L+VWK+D    P FVGWIYFDLHPR+GKYGHAANFGI+SS++
Sbjct: 426 VEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYV 485

Query: 466 KSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPS 525
           + DG+RS+PVTALVCNFSKP+  KPALLKHSE+TTFFHELGHGIHDLVGGN IGRFNGP 
Sbjct: 486 R-DGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPG 544

Query: 526 ATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQ 585
           ATPWDFVEAPSQMLEFWTWNK EL +LS+HY+T EKIP+ LLDSL+ TKH+NGALFALRQ
Sbjct: 545 ATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQ 604

Query: 586 LHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGY 645
           L FGLFDM VHT KD+  L+VT LWN LR+E+ L++NGD  TKGFNSFGHIMS +YSAGY
Sbjct: 605 LTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSGAYSAGY 664

Query: 646 YGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKA 705
           YGYMWA+VFA+DMY+TKF  DPLN DVGV+YRDI+L+RGGLYEI+DNL EFLGR+PNN+A
Sbjct: 665 YGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEA 724

Query: 706 FLKELGL 712
           FLKELGL
Sbjct: 725 FLKELGL 731

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/710 (63%), Positives = 556/710 (78%), Gaps = 15/710 (2%)

Query: 14  TSLVVIPTLAFASFQFNAIRSIMTKTDFVV-PQAAPSWNYTTEELLKQTHEAXXXXXXXX 72
            S   +P +AF   ++    S MT +  ++ PQ AP+WN+T E ++K             
Sbjct: 33  VSFFAVPAIAFTILKY----STMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIF 88

Query: 73  XXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGI 132
                   P+VENF+ PY++HEN +SPL NQLTFLQHVS+DK++RD+S K TELI+NF I
Sbjct: 89  DNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEI 148

Query: 133 ESSLRFKLFRQFDIVWNQLKDDAQF--KKD--HFEIYKFVEKCHKDFLRSGLNLPEEQRD 188
           E+SLR  LF QFD +W  +KD+++F  K D  ++E Y+F+EKCHKDF+RSGLNL +E+R+
Sbjct: 149 EASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKRE 208

Query: 189 KVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDED--GITKYKV 246
            VK+I+KKI++NSL FSKNLGEQ EFI FTKEEL GVS+ VM+QFE   ++  G  K+KV
Sbjct: 209 IVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKV 268

Query: 247 TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADY 306
           TFKYPDI PVLKSAKN  TRK AF  DQNKVP+NEALF++TL+LRNDL+ +L+Y +YA+Y
Sbjct: 269 TFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANY 328

Query: 307 NLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRYYIWDNR 366
           NL++KMAK EE V  FL+DLK KL+P                    N PYD  YYIWD+R
Sbjct: 329 NLEMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMKELNLPYDNHYYIWDHR 388

Query: 367 YYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNG---DTWHPDVK 423
           YYDN+YLK NF +D EKI+EY+P+ES+I GML+IYETV+KLKF+EE +    + WH DVK
Sbjct: 389 YYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVK 448

Query: 424 KLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNF 482
           +LSVWKMD+ + P F+GWIYFDLHPR+GKYGHAANFGISSS++  +  RSYPVTALVCNF
Sbjct: 449 QLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNF 508

Query: 483 SKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFW 542
           SKPT DKP+LLKH+ELTTFFHELGHGIHDLVG N   R NGP + PWDFVEAPSQMLEFW
Sbjct: 509 SKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFW 568

Query: 543 TWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDIS 602
           TWNK EL SLSKHY+T EKIP+SL++SLV TKH+NGALFALRQLHF  FDM+VHT +D+S
Sbjct: 569 TWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVS 628

Query: 603 KLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTK 662
           KLN+ ELWN LRE+ICL++NGD  +KG++SFGHIMS +YSAGYYGYMWA+VFA+DMYYTK
Sbjct: 629 KLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTK 688

Query: 663 FLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
           F  DPLNS  GV+YRDIIL+RGG+YE+ DNL EFLGR+PNN AFLKE+GL
Sbjct: 689 FAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/716 (61%), Positives = 554/716 (77%), Gaps = 8/716 (1%)

Query: 5   LANLRFKSATSLVVIPTLAFASFQFNAIR-SIMTKTD-FVVPQAAPSWNYTTEELLKQTH 62
           +A    KS  S+V +P LA   ++ +  + S M+  + F+ PQ+APSW +T + LL +TH
Sbjct: 9   VAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQSLLDETH 68

Query: 63  EAXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTK 122
                             P+VEN V PY+HHEN +  + +QLTF Q VS+DKE+RD S +
Sbjct: 69  RLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRDASVQ 128

Query: 123 VTELIENFGIESSLRFKLFRQFDIVWNQLKDDA-QFKKDHFEIYKFVEKCHKDFLRSGLN 181
            TE ++NFGIE SLR  LF QFD +WN+LKD + +     +EIYK+VEK H+D+ R GL 
Sbjct: 129 ATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQ 188

Query: 182 LPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETV-DEDG 240
           LPE++RDKVK++K KI+ NSL+FSKNLGEQ EF+ FTKEEL GVSE+VM QFE   DE+G
Sbjct: 189 LPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQFKDENG 248

Query: 241 ITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNY 300
            TKYKVTFKYPDIFPVLK+AKN +TRK AF  DQ+KVPQNE LF+ETLQLRN+LA++L Y
Sbjct: 249 TTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGY 308

Query: 301 DSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRY 360
            +YA+YNL++KMAK ++ V  FLN+LK+KLKP                      PYD  Y
Sbjct: 309 STYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGLPYDGHY 368

Query: 361 YIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGD---T 417
           Y+WD+RYYDN+YLK N+ +D EKI+EY+P+ESTI GML IYET+LKLKF+EE + +    
Sbjct: 369 YVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETDPEKRSV 428

Query: 418 WHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVT 476
           WH DVK+L+VWKMD+ + P FVGWIYFDLHPR+GKYGHAANFGIS+S++K DG+RSYPVT
Sbjct: 429 WHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGTRSYPVT 488

Query: 477 ALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPS 536
           ALVCNFSKP+  KP+LLKH+E++TFFHELGHGIHDLVG N +  FNGP A PWDFVEAPS
Sbjct: 489 ALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPS 548

Query: 537 QMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVH 596
           QMLEFWTWN++EL  LS HY++ EKIP  LL SL+ TKH++GALFALRQLHFGLFDM VH
Sbjct: 549 QMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVH 608

Query: 597 TTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFAS 656
           T+K+++KL++ +LWN LREE+ L++NGD  TKG++SFGHIMSDSYSAGYYGYMWA+VFA+
Sbjct: 609 TSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAA 668

Query: 657 DMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
           DMY+T+F  DPL+S  GVQYRDI+L RGGLYE  DNL EFLGR+P+ +AFLKELGL
Sbjct: 669 DMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGL 724

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/706 (63%), Positives = 544/706 (77%), Gaps = 8/706 (1%)

Query: 15  SLVVIPTLAFASFQFNAIRSIMTKTDFVVPQA--APSWNYTTEELLKQTHEAXXXXXXXX 72
           S +V+P  AF   + +   ++ T    +V     AP+W ++ E +L +T E         
Sbjct: 23  SAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDNATNLY 82

Query: 73  XXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGI 132
                   PSVE+ V PY+H+EN    + NQLTFLQHVS+DK +RD S + TEL+++F I
Sbjct: 83  DSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFSI 142

Query: 133 ESSLRFKLFRQFDIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKE 192
           E+S+R  LF+QFD +WNQ+KDD   K   FE YKF+EK HKD++R+GLNLPEE+R++VK+
Sbjct: 143 EASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKD 202

Query: 193 IKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFET-VD-EDGITKYKVTFKY 250
           IKKKI++NSL +SKNLGEQ E+++FTKE+L GVSE+VM+QFE  VD +    KYKVTFKY
Sbjct: 203 IKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKY 262

Query: 251 PDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADYNLDI 310
           PDIFPVLK+A+  +TRK A+I DQNKVPQNEALF+ETL+LRN LA+LL Y +YA+YNLDI
Sbjct: 263 PDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDI 322

Query: 311 KMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRYYIWDNRYYDN 370
           KMAK +E V  F+N+LK+KLKP                       YD  YYIWD+RYYDN
Sbjct: 323 KMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEELGLAYDDHYYIWDHRYYDN 382

Query: 371 QYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDN---GDTWHPDVKKLSV 427
           ++LK N+ +D E+I+EY+PLESTIKGML IYET+LKLKF++E N    D WH DVK+L+V
Sbjct: 383 KFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAV 442

Query: 428 WKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNFSKPT 486
           WKMDD   P F+GWIYFDLHPR+GKY HAANFGISSS++  DG RS+PVTALVCNFSK T
Sbjct: 443 WKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKST 502

Query: 487 KDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNK 546
             KP+LLKH+E+TTFFHELGHGIHDLVG N   RFNGP ATPWDFVEAPSQMLEFWTWNK
Sbjct: 503 DKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNK 562

Query: 547 KELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISKLNV 606
            EL SLS HYQT EKI + LLDSL+ TKH+NGALFALRQLHFGLFDM VHTTK++  LN+
Sbjct: 563 NELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNL 622

Query: 607 TELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLED 666
            +LWN LRE+ICL++NG+  TKG++SFGHIMSDSYSAGYYGYMWA+VFA+DMYYTKF  D
Sbjct: 623 LKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASD 682

Query: 667 PLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
           PLNS  GVQYRDI+LA GGLYEI D L EFLGR+P N AFLKELGL
Sbjct: 683 PLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGL 728

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/723 (62%), Positives = 546/723 (75%), Gaps = 26/723 (3%)

Query: 15  SLVVIPTLAFASFQ--------FNAIRSIMTKTDFVVPQAAPSWNYTTEELLKQTHEAXX 66
           SLV IP +A   +         + A +  M +  F+ PQ +P W+++ E +L    +   
Sbjct: 25  SLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSPERILSDAKKIID 84

Query: 67  XXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTEL 126
                         PS+ENFV P ++ EN  S   NQLTFLQHVS DK +RD S + TEL
Sbjct: 85  TSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATEL 144

Query: 127 IENFGIESSLRFKLFRQFDIVWNQLKDDAQFK-------KDHFEIYKFVEKCHKDFLRSG 179
           I NF IE SLR+ +F+QFD ++N LKD+ ++        KD +EI+K+VEKCHKD++RSG
Sbjct: 145 ITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKTATPKD-YEIFKYVEKCHKDYVRSG 203

Query: 180 LNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETV--D 237
           LNL EE+R+++KEIKK+I+ NSLQFSKNLGEQNEF+ FTKEEL GVS++VMKQFET   +
Sbjct: 204 LNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETYTDE 263

Query: 238 EDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAEL 297
           + G  K+KVTFKYPDIFPVLK+AKN  TRK AF  DQNKVP+NE LF++TL+LR  L ++
Sbjct: 264 QTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKI 323

Query: 298 LNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYD 357
           L YD+YA+YNLDIKMAK +E V+ FL DLK+KLKP                    N  YD
Sbjct: 324 LGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYD 383

Query: 358 RRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGD- 416
             YYIWD+RYYDN+YLK  F +D EKI+EY+P+ESTI+GML+IYETV+ LKFIEE + D 
Sbjct: 384 DHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDL 443

Query: 417 --TWHPD-VKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRS 472
             TW  D VK+L+VWKMDD + P FVGWIYFDLHPREGKYGHAANFG++ S++  D  R 
Sbjct: 444 KSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRI 503

Query: 473 YPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFV 532
           YPVTALVCNFS  T DKPALLKH+E+TTFFHELGHGIHDLVG N IGRFNGP A PWDFV
Sbjct: 504 YPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFV 563

Query: 533 EAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFD 592
           EAPSQMLEFWTWNK EL SLSKHY+T EKIP+SLL+SL+ TKH+NGALFALRQLHFGLFD
Sbjct: 564 EAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFD 623

Query: 593 MKVHTTKD---ISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYM 649
           MKVHTT D   I  +++ +LWN LREEI L++NGD   KG++SFGHIMSDSYSAGYYGYM
Sbjct: 624 MKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYM 683

Query: 650 WADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKE 709
           WA+VFA+DMYY+KF +DPLN+  G++YRDIILARGG+ E  DNL EFLGR+P+ +AFLKE
Sbjct: 684 WAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKE 743

Query: 710 LGL 712
           LGL
Sbjct: 744 LGL 746

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/716 (61%), Positives = 543/716 (75%), Gaps = 19/716 (2%)

Query: 16  LVVIPTLAFASFQF---------NAIRSIMTKTDFVVPQAA-PSWNYTTEELLKQTHEAX 65
            VV+PT  FA+  F          +          V P  A P W + + ++ ++     
Sbjct: 27  FVVLPTALFATSHFYQSSRSYSSTSSGLSRMSPQLVPPAGALPRWEFPSAKIGEEATRII 86

Query: 66  XXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTE 125
                          PS++N V PY++HEN+I  + NQL FLQHVSSDKE+R+ S K TE
Sbjct: 87  ESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLCFLQHVSSDKEIREASNKATE 146

Query: 126 LIENFGIESSLRFKLFRQFDIVWNQLK---DDAQFKKDHFEIYKFVEKCHKDFLRSGLNL 182
           L++NF IE+SLR  LF QFD +W +LK   ++    ++ FEIYKFVEKCHKDF+R+GLNL
Sbjct: 147 LLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQFEIYKFVEKCHKDFVRAGLNL 206

Query: 183 PEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDEDGI- 241
            EE R+KVK+IK KI++NSL+FSKNLGEQ EF+ F+KE+L GVS+ VM+QFE V ++   
Sbjct: 207 SEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQLDGVSDTVMEQFEQVKDETTN 266

Query: 242 -TKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNY 300
            T YKVTFKYPDIFPVLK AKNAETRK AF GDQNKVPQNE LF+ TL+LR++LA LL Y
Sbjct: 267 ETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATLKLRDELATLLGY 326

Query: 301 DSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRY 360
           D+YA+YNL+IKMAKK+  V  FLNDLK+KLKP                      P+D RY
Sbjct: 327 DTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLGEKEIGILKSIKEAECKELGVPFDGRY 386

Query: 361 YIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNG---DT 417
           YIWD+RYYD +YLK NF +D E IAEY+P++STI+GML+IYETV KLKF+EE +    + 
Sbjct: 387 YIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKIYETVFKLKFVEEKDTAKKNV 446

Query: 418 WHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVT 476
           W+ DVK+++VWKMD+   P FVGWIYFDLHPR+GKYGHAANFGI+SS+++ DGSRSYPVT
Sbjct: 447 WNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASSYIREDGSRSYPVT 506

Query: 477 ALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPS 536
           ALVCNFSK +  KP+LLKH+E+TTFFHELGHGIHDLVG N   RFNGP ATPWDFVEAPS
Sbjct: 507 ALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPS 566

Query: 537 QMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVH 596
           QMLEF+TW+K  L+SLSKHY+T E+IP+ LLDSL+ TKH+NGALFALRQLHFGLFDM VH
Sbjct: 567 QMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVH 626

Query: 597 TTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFAS 656
           T+KD++ L++ +LW  LR+EI L++NG   TKG++SFGHIMSDSYSAGYYGYMWA+VFA+
Sbjct: 627 TSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFAT 686

Query: 657 DMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
           DMY TKF  +PL+S VG++YRDI+LA GGLYEI+DNL EFLGR+P+  AFLKELGL
Sbjct: 687 DMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKEFLGREPSKDAFLKELGL 742

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/709 (63%), Positives = 540/709 (76%), Gaps = 9/709 (1%)

Query: 11  KSATSLVVIPTLAFASFQFNAIRSIMTKTDFVVPQAAPSWNYTTEELLKQTHEAXXXXXX 70
           KS  SLV IP  ++    +N + S MT + F+ PQAAPSWN+    LL            
Sbjct: 14  KSFLSLVCIPATSY--LVYNRLYSNMTISAFIAPQAAPSWNWNPSRLLFDAECVIDNSNR 71

Query: 71  XXXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENF 130
                     P+VEN V PY+ HEN ISPL N+L FLQHVS D ++R+ S K TEL++ F
Sbjct: 72  LYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKF 131

Query: 131 GIESSLRFKLFRQFDIVWNQL--KDDAQFKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRD 188
            IE+SLR  LF QFD +W ++  K D   K+  FE +KF+EK HKD++RSGLNLPE++R+
Sbjct: 132 EIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKRE 191

Query: 189 KVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFET-VDED-GITKYKV 246
           K+KEIK KI NNSLQ+SKNLGEQ E I FT+EEL GVS+ V +QFE  +DE+ G  K+KV
Sbjct: 192 KIKEIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFIDEETGEEKFKV 251

Query: 247 TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADY 306
           TFKYPDIFPVLK+AKN ETR++AF+ DQNKVPQNE LF+ETL+LRN+LA  LNY +YA+Y
Sbjct: 252 TFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANY 311

Query: 307 NLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRYYIWDNR 366
           NL+ KMAK++E VL FLNDLK +LKP                    N  YD  YYI+D+R
Sbjct: 312 NLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHR 371

Query: 367 YYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEE-DNGDTWHPDVKKL 425
           YYDN+YLK NF +D E I+EY+PLE TI GML+IYE + KLKF EE  N   WH DVK+L
Sbjct: 372 YYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETKNKSVWHEDVKQL 431

Query: 426 SVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSD-GSRSYPVTALVCNFS 483
           +VWKMD+   P FVGWIYFDLHPR+GKYGHAANFGISSS++  + G RSYPVTALVCNFS
Sbjct: 432 AVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFS 491

Query: 484 KPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWT 543
           K T  +P+LLKH+E+TTFFHELGHGIHDLVG N + RFNGP ATPWDFVEAPSQMLEFWT
Sbjct: 492 KSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWT 551

Query: 544 WNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISK 603
           WN  ELKSLS HY++ EKIPD LL SL++TKH+NGALFALRQLHFGLFDM VHTT ++  
Sbjct: 552 WNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVES 611

Query: 604 LNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKF 663
           LN+ +LWN LREEICL++ G   +KG++SFGHIMSDSYSAGYYGYMWA+VFA+DMY+TKF
Sbjct: 612 LNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKF 671

Query: 664 LEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
             +PL+S+VGVQYRDI+LA GGLYEI DNL +FLGR+P+  AFLKELGL
Sbjct: 672 SPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/680 (63%), Positives = 534/680 (78%), Gaps = 10/680 (1%)

Query: 43  VPQAAPSWNYTTEELLKQTHEAXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFN 102
            PQAAP+WN+T  +L+K   +                 P   NF+ PY+++EN +  L N
Sbjct: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120

Query: 103 QLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDA-QFKKD- 160
           QLTFLQHVSS+K++RD S K T+L++NF IE+SLR+ LF QFD +WNQ+KD   +++KD 
Sbjct: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180

Query: 161 -HFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTK 219
              E Y+FV K H+DF+R+GLNL E +R+K+KEIKK I+NNSL+F+ NLGEQ EF+ FTK
Sbjct: 181 KDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFTK 240

Query: 220 EELIGVSENVMKQFETVDED--GITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKV 277
           EEL GVS++VM+QFE  +++  G   YKVTFKYPDIFPVLK+A+N ETRK+AF GDQNKV
Sbjct: 241 EELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKV 300

Query: 278 PQNEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXX 337
            +N  LF  TL+LRN LA++L Y +YA+YNL++KMAK +++V  FL DL ++LKP     
Sbjct: 301 SENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSKE 360

Query: 338 XXXXXXXXXXXXXXXNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGM 397
                          N P+D  YY+WD+RYYDN+YLK N+ +D EKI+EY+PL+STI+GM
Sbjct: 361 IEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEGM 420

Query: 398 LQIYETVLKLKFIEED----NGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKY 452
           L IYET+L LKFIEE     N + WH +VK+L+VWKMD+   P FVGWIYFDLHPR+GKY
Sbjct: 421 LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY 480

Query: 453 GHAANFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDL 512
           GHAANFGISSS++K +  RSYPVTALVCNFSK T DKPALLKH+E+TTFFHELGHGIHDL
Sbjct: 481 GHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDL 540

Query: 513 VGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVR 572
           VG N+  RFNGP A PWDFVEAPSQMLEFWTWNK EL SLSKHY+T EKIP  LL+SLV 
Sbjct: 541 VGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVA 600

Query: 573 TKHINGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNS 632
           TKH+NGALFALRQLHFGLFDMKVHT+KD+  L+  +LWN LREE+ L++NGD+ TKG++S
Sbjct: 601 TKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDS 660

Query: 633 FGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDN 692
           FGHIMSDSYSAGYYGYMWA+VFA+DMYYTKF  +PL + VGV+YRD +LARGGLYEIEDN
Sbjct: 661 FGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDN 720

Query: 693 LTEFLGRKPNNKAFLKELGL 712
           L +FLGRKP+N+AFLKELGL
Sbjct: 721 LIQFLGRKPSNEAFLKELGL 740

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/678 (65%), Positives = 536/678 (79%), Gaps = 13/678 (1%)

Query: 44  PQAAPSWNYTTEELLKQTHEAXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFNQ 103
           PQ  PSW +  E++L QT E                 P++EN + PY++HEN    L NQ
Sbjct: 69  PQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENENELLINQ 128

Query: 104 LTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFE 163
           LTFLQHVS DK +RD S + T L+++F IES  R  LF+QFD++WNQ+KD    KKD FE
Sbjct: 129 LTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKD----KKDEFE 184

Query: 164 ---IYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKE 220
              I++FVEKCHKD++R+GLNLP ++ +KVKEIKKKI++N L+FSKNLGEQ E+I FT E
Sbjct: 185 DFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYILFTAE 244

Query: 221 ELIGVSENVMKQFETV-DEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQ 279
           EL GV E+V++QFE V DE GI K KVT+KYPDIFPVLK+A+N ETR +AF+GDQNKVP+
Sbjct: 245 ELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPE 304

Query: 280 NEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLK-PXXXXXX 338
           NE LF +TL+LRN+LA +L YD+YA+YNLDIKMAK  + VL+F+NDL  KL+ P      
Sbjct: 305 NEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELD 364

Query: 339 XXXXXXXXXXXXXXNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGML 398
                         N  YD  YYIWD+RYYDN+YLK+NF +DEEKIAEY+PLESTI GML
Sbjct: 365 ILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGML 424

Query: 399 QIYETVLKLKFIE-EDNGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAA 456
           +IYET+LKLKF+E ++N  TWH DVK+L+VWK+D    P FVGWI+FDLHPR+GKYGHAA
Sbjct: 425 KIYETLLKLKFVEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAA 484

Query: 457 NFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGN 516
           NFG+SSS++ ++G+RSYP+TALVCNFSK TKDKP+LLKHSE+TTFFHELGHGIHDLVG N
Sbjct: 485 NFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNN 544

Query: 517 DIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHI 576
            IGRFNGP A PWDFVEAPSQMLEFWTWN KEL SLS++Y+   KI   LL+SL++TKH+
Sbjct: 545 RIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHV 604

Query: 577 NGALFALRQLHFGLFDMKVH--TTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFG 634
           NGALFALRQLHFGLFDMKVH  + +++ KL++ +LWN LRE+ICLI NGD  T G+NSFG
Sbjct: 605 NGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFG 664

Query: 635 HIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLT 694
           HIMS SYSAGYYGYMWA+VFA+DMYYTKF  DPLN +VGV+YRDI+LARGGLYEI+DNL 
Sbjct: 665 HIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLE 724

Query: 695 EFLGRKPNNKAFLKELGL 712
           EFLGRKP   AFL+ELGL
Sbjct: 725 EFLGRKPAKDAFLEELGL 742

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/687 (62%), Positives = 523/687 (76%), Gaps = 10/687 (1%)

Query: 34  SIMTKTDFVVP-QAAPSWNYTTEELLKQTHEAXXXXXXXXXXXXXXXXPSVENFVTPYLH 92
           ++  K  F+ P    P W +T +++L +T                   PS+EN + PY++
Sbjct: 56  TVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYMN 115

Query: 93  HENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLK 152
           +EN +  L NQLTFLQHVS+DK++RD S + T L+E+  I +SLR++++ QF+ VW  ++
Sbjct: 116 YENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQ 175

Query: 153 DDAQFKKDH-FEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQ 211
           +D  F K+H FE YKF+EK HKD LR+GL    E+  ++K IK KIS ++L FS NLGEQ
Sbjct: 176 NDDDFLKNHQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQ 233

Query: 212 NEFITFTKEELIGVSENVMKQFETVDEDGIT--KYKVTFKYPDIFPVLKSAKNAETRKRA 269
           NE+++FTKEEL GVSE VM QFE   +      KYKVTFKYPDIFPVLK+AKN +TRK A
Sbjct: 234 NEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIA 293

Query: 270 FIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNK 329
           F+GDQNKVP+NE L    L+LR +LA  L Y +YA+YNLDIKMAK +E VL FLNDLK K
Sbjct: 294 FLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKEK 353

Query: 330 LKPXXXXXXXXXXXXXXXXXXXXNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFP 389
           LKP                      PYD  YYIWD+RYYDN+YLK NF +D EKI+EY+P
Sbjct: 354 LKPLAEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYP 413

Query: 390 LESTIKGMLQIYETVLKLKFIEEDN---GDTWHPDVKKLSVWKMDDNF-PSFVGWIYFDL 445
           LESTI GML+IYETVL LKFIEE +    + WHPDVK+LSVW MDD   P+FVGWIYFDL
Sbjct: 414 LESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDL 473

Query: 446 HPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHEL 505
           +PR+GKYGHAANFGI+SS++  +  RSYPVTALVCNFSKPTK+KPALLKHSE+TTFFHEL
Sbjct: 474 YPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHEL 533

Query: 506 GHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDS 565
           GHGIHDLVG N   RFNGP + PWDFVEAPSQMLEFWTWNK EL SLSKHY+T EKIP+ 
Sbjct: 534 GHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPED 593

Query: 566 LLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDI 625
           LLDSL+ TKH+NGALFALRQLHFGLFDM VHTTKDI  L++ +LWN  REEICL++NG+ 
Sbjct: 594 LLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGEN 653

Query: 626 QTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGG 685
            TKG+NSFGHI+SDSYSAGYYGYMWA+VFA+DMY+TKF  +PL+  VG++YRD+ILA+GG
Sbjct: 654 FTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGG 713

Query: 686 LYEIEDNLTEFLGRKPNNKAFLKELGL 712
           LYEI DNL EFLGR+P+NK FLKELGL
Sbjct: 714 LYEINDNLLEFLGREPSNKPFLKELGL 740

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/715 (55%), Positives = 519/715 (72%), Gaps = 12/715 (1%)

Query: 3   NVLANLRFKSATSLVVIPTLAFASFQ--FNAIRSIMTKTDFVVPQAAPSWNYTTEELLKQ 60
           N+L N    +  S +++P LA A  +   N  R++   +  + P+ APSW++  +E++  
Sbjct: 9   NILKN---SATVSFLLLPALAIAGNRSVHNQERNM---SSLLSPKLAPSWDFAADEIVSL 62

Query: 61  THEAXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTS 120
             +A                P +ENFV   + HE+      +QLTFLQHVS+DKE+RD S
Sbjct: 63  AQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRDAS 122

Query: 121 TKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGL 180
            + T+LI+ +GIE+S R+ L+ QF  VW Q KDD   KK+  E+Y ++E  +KD++ +G+
Sbjct: 123 IEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYWYMENVNKDYIHAGM 182

Query: 181 NLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDEDG 240
            LPEE R+K+KEIKKK++NNSL FS NLGEQN++I FTK+EL+GVSE  + QFE V EDG
Sbjct: 183 GLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVSETTLGQFEKVIEDG 242

Query: 241 ITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNY 300
           + KYK+TFKYPDI PVL +AKN ETRKRA+IGDQNKVPQNE + +ETL+LRN+LAE+  +
Sbjct: 243 VEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGH 302

Query: 301 DSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRY 360
            +YA Y L++KMAKK+E V  FL DLK+KL P                      PY+  +
Sbjct: 303 PTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLKEQEYKELGLPYNGSF 362

Query: 361 YIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEED---NGDT 417
             WD RYYD++YLK+NF +DEE++A+YFPL+ TI GML IY+ +  LKF+EE      + 
Sbjct: 363 NSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNV 422

Query: 418 WHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTA 477
           WH DVK+ +VW +D   P FVGWIYFDLHPREGKYGHAANFG+ S ++  +G+R YPVT 
Sbjct: 423 WHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTV 482

Query: 478 LVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQ 537
           LVCNFSKP+  +PALLKH E+ TFFHELGHGIH LVG + IG  NGPS+ PWDFVEAPSQ
Sbjct: 483 LVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQ 542

Query: 538 MLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHT 597
           MLEFW WNK ++  LSKHY+T E+IPD L+DSL++TKH+N  L  LRQLHF LFDM VHT
Sbjct: 543 MLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHT 602

Query: 598 TKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASD 657
            K++ KL++  LWN+LREE+ LI NGD+ TKG++SF HIMS  YSAGYYGYMW++VFA+D
Sbjct: 603 DKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMS-GYSAGYYGYMWSEVFAAD 661

Query: 658 MYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
           MY+T F  +PL++ VG +YRDIILA+GGL +IED+L EFLGR+PNNKAFLKELGL
Sbjct: 662 MYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/722 (57%), Positives = 518/722 (71%), Gaps = 22/722 (3%)

Query: 1   MRNVLANLRFKSATSLVVIPTLAFASFQFNAIRSIMTKTDF-VVPQAAPSWNYTTEELLK 59
           MR +L    F S     VI  L +  F    + S+ T   F   PQ  PSW++T  ++  
Sbjct: 1   MRLLLCKNWFASP----VITPLLYTRF----LSSMTTTASFPTAPQTPPSWSFTPNDISG 52

Query: 60  QTHEAXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDT 119
           +T E                 P+V NFV P++  EN + P+ NQLTFLQHVSSDKE+RD 
Sbjct: 53  RTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDA 112

Query: 120 STKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFE--IYKFVEKCHKDFLR 177
           S   +  ++   I+ SLR  +F QF  VW     DAQ + D  E   ++++EK +KD++ 
Sbjct: 113 SVDSSMKLDELNIDLSLRHDVFLQFARVWQ----DAQSQADSIERETFRYIEKSYKDYIH 168

Query: 178 SGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVD 237
           SGL L E  R KVKEIKKKIS NS+ FSKNLGEQ EFITFTKE+L GV ++++ QFET++
Sbjct: 169 SGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIE 228

Query: 238 ---EDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDL 294
              +   T YKVTFKYPDIFPV+K A +++TRK+AF+ DQNKV +NEA+ L+TL+LR+++
Sbjct: 229 SGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEV 288

Query: 295 AELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNT 354
           A LL YD+YA+YNL  KMAK    V+ FLNDLK KL P                    N 
Sbjct: 289 ASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQ 348

Query: 355 PYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDN 414
             D  YYIWD+RYYDN+YL +NF +D EKI+E+FPLE+TI GMLQIYET+  LKFIE  N
Sbjct: 349 DEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKN 408

Query: 415 ---GDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGS 470
                 WH DVK+L+VW MDD   P F+GWIYFDLHPR+GKYGHAANFG+SSSF+ +D +
Sbjct: 409 PQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTT 468

Query: 471 RSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWD 530
           RSYPVTALVCNFSK TKDKP+LLKH+E+ TFFHELGHGIHDLVG N   RFNGP + PWD
Sbjct: 469 RSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWD 528

Query: 531 FVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGL 590
           FVEAPSQMLEFWTWNK EL  LS HY+T EKIP+ L+DSL++TKH+NGALF LRQLHFGL
Sbjct: 529 FVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGL 588

Query: 591 FDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMW 650
           FDMKVH+ KD+  L++ + WN LR++I L+ NG   +KG+ SFGHIMSDSYSAGYYGY+W
Sbjct: 589 FDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLW 648

Query: 651 ADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKEL 710
           A+VFA+DMY+TKF +DPLN+  G+QYRDI+LARGGL +I D+L EFLGR+P+  AFLKEL
Sbjct: 649 AEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKEL 708

Query: 711 GL 712
           GL
Sbjct: 709 GL 710

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/722 (58%), Positives = 525/722 (72%), Gaps = 22/722 (3%)

Query: 1   MRNVLANLRFKSATSLVVIPTLAFASFQFNAIRSIMTKTDF-VVPQAAPSWNYTTEELLK 59
           MR +L    F S    V+ P L   S     + S+   T F + PQA P+W++T  ++  
Sbjct: 1   MRLLLCKNWFASP---VISPLLYTRS-----LYSMANTTSFPIAPQAPPNWSFTPSDISG 52

Query: 60  QTHEAXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDT 119
           +T+E                 PSV NFV P++  EN + P+ NQLTFLQHVSSDKE+RD 
Sbjct: 53  KTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDA 112

Query: 120 STKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFE--IYKFVEKCHKDFLR 177
           S   +  ++   I+ SLR  +F QF  VW     D Q K D  E   +K+VEK +KD++ 
Sbjct: 113 SVNSSMKLDELNIDLSLRHDIFLQFARVWQ----DVQSKADSVERETFKYVEKSYKDYIH 168

Query: 178 SGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVD 237
           SGL L E  R K+KEIKKKIS NS+ FSKNLGEQ E+ITFTKE+L GV ++++ QFET+ 
Sbjct: 169 SGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIK 228

Query: 238 ED---GITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDL 294
            D     T YKVTFKYPDIFPV+K A +A+TRK+AF+ DQNKVP+NEA+ L+TL+LR++L
Sbjct: 229 SDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDEL 288

Query: 295 AELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNT 354
           A LL YD+YA+YNL  KMA+    V+ FLNDLK+KL P                    N 
Sbjct: 289 ASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQ 348

Query: 355 PYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIE--- 411
             D  YYIWD+RYYDN+YL +NF +D EKI+EYFPLE+TI GML+IYET+  LKFIE   
Sbjct: 349 GADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKD 408

Query: 412 EDNGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGS 470
             N   WH DVK+++VW MDD   P+FVGWIYFDLHPR+GKYGHAANFG+SSSF+  D +
Sbjct: 409 SQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTT 468

Query: 471 RSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWD 530
           RSYPVTALVCNFSK TKDKP+LLKH+E+ TFFHELGHGIHDLVG N   RFNGP + PWD
Sbjct: 469 RSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWD 528

Query: 531 FVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGL 590
           FVEAPSQMLEFWTWNK EL +LS HY+T EKIP+SL++SL++TKH+NGALF LRQLHFGL
Sbjct: 529 FVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGL 588

Query: 591 FDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMW 650
           FDMKVHT KD+  L++ + WN LR++I LI NG   +KG++SFGHIMSDSYSAGYYGY+W
Sbjct: 589 FDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLW 648

Query: 651 ADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKEL 710
           A+VFA+DMY+TKF +DPLN+  G+QYRDI+LARGGLY+I DNL EFLGR+P+  AFLKEL
Sbjct: 649 AEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKEL 708

Query: 711 GL 712
           GL
Sbjct: 709 GL 710

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/709 (59%), Positives = 517/709 (72%), Gaps = 19/709 (2%)

Query: 14  TSLVVIPTLAFASFQFNAIRSIMTKTDF-VVPQAAPSWNYTTEELLKQTHEAXXXXXXXX 72
           TS ++ P L   S     + S+   T F + PQA P+W +T  ++  +T E         
Sbjct: 11  TSPIISPLLYTRS-----LYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFY 65

Query: 73  XXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGI 132
                   P+V NFV P++  EN + P+ NQLTFLQHVSSDKE+RD S   +  ++   I
Sbjct: 66  ESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNI 125

Query: 133 ESSLRFKLFRQFDIVWNQLKDDAQFKKDHFE--IYKFVEKCHKDFLRSGLNLPEEQRDKV 190
           + SLR  ++ QF  VW     DAQ K D  E   +K++EK +KD++ SGL L E  R K+
Sbjct: 126 DLSLRHDIYLQFARVWQ----DAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLKI 181

Query: 191 KEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDED---GITKYKVT 247
           K+IKKKIS NS+ FSKNLGEQ E+ITFTKE+L GV ++V+ QFET+  D     T YKVT
Sbjct: 182 KDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVT 241

Query: 248 FKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADYN 307
           FKYPDIFPV+K A +A+TRK AF+ DQNKVP+NEA+ L+TL+LR+ LA LL YD+YA+YN
Sbjct: 242 FKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYN 301

Query: 308 LDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRYYIWDNRY 367
           L  KMAK    V+ FLNDLK+KL P                    N   D  YYIWD+RY
Sbjct: 302 LYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRY 361

Query: 368 YDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGDT---WHPDVKK 424
           YDN+YL +NF +D EKI+EYFPLE+TI GMLQIYET+  LKFIE  +G +   WH DVK+
Sbjct: 362 YDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQ 421

Query: 425 LSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNFS 483
           L+VW MDD   P FVGWIYFDLHPR+GKYGHAANFG+SSSF+ +D  RSYPVTALVCNFS
Sbjct: 422 LAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFS 481

Query: 484 KPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWT 543
           K TKDKP+LLKH+E+ TFFHELGHGIHDLVG N   RFNGP + PWDFVEAPSQMLEFWT
Sbjct: 482 KSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWT 541

Query: 544 WNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISK 603
           WNK EL  LS HY+T EKIP+SL+DSL++TKH+NGALF LRQLHFGLFDMKVHT KD+  
Sbjct: 542 WNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQN 601

Query: 604 LNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKF 663
           L++ E WN LR++I LI NG   +KG++SFGHIMSDSYSAGYYGY+WA+VFA+DMY+TKF
Sbjct: 602 LSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKF 661

Query: 664 LEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
            +DPLN+  G+QYRDI+LARGGL +I D+L +FLGR+P+  AFLKELGL
Sbjct: 662 AKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/710 (59%), Positives = 515/710 (72%), Gaps = 21/710 (2%)

Query: 14  TSLVVIPTLAFASFQFNAIRSIMTKTDF--VVPQAAPSWNYTTEELLKQTHEAXXXXXXX 71
           TS V+ P L      +    S MT      + PQA P+W++T  ++  +T E        
Sbjct: 11  TSPVISPLL------YTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKF 64

Query: 72  XXXXXXXXXPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFG 131
                    PSV NF+ P++  EN + P+ N+LTFLQHVSSDKE+RD S   +  ++   
Sbjct: 65  YELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELN 124

Query: 132 IESSLRFKLFRQFDIVWNQLKDDAQFKKDHF--EIYKFVEKCHKDFLRSGLNLPEEQRDK 189
           I+ SLR  +F QF  VW     DAQ K D    E +K++EK +KDF+ SGL L E  R K
Sbjct: 125 IDLSLRHDIFLQFARVWQ----DAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180

Query: 190 VKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETV-DEDGI--TKYKV 246
           +KEIKKKIS NS+ FSKNLGEQ E+ITFTKE+L GV ++++ QFET   E G   T YKV
Sbjct: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240

Query: 247 TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADY 306
           TFKYPDIFPV+K A +A+TRK+AF+ DQNKVP+NEA+ L+TL+LR++LA LL Y++YADY
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300

Query: 307 NLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRYYIWDNR 366
           NL  KMAK    V+ FLNDLK KL P                        D  YYIWD+R
Sbjct: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360

Query: 367 YYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEE---DNGDTWHPDVK 423
           YYDN++L +NF +D EKI+EYFPLE+TI GMLQIYET+  LKFIE     N   WH DVK
Sbjct: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420

Query: 424 KLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNF 482
           +L+VW MDD   P F+GWIYFDLHPR+GKYGHAANFG+SSSF+ +D  RSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480

Query: 483 SKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFW 542
           SK TKDKP+LLKH+E+ TFFHELGHGIHDLVG N   RFNGP + PWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 543 TWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDIS 602
           TWNK EL SLS HY+T E+IP+SL+DSL++TKH+NGALF LRQLHFGLFDMKVHT KD+ 
Sbjct: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600

Query: 603 KLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTK 662
            L++   WN LR+EI L+ NG   +KG++SFGHIMSDSYSAGYYGY+WA+VFA+DMY+TK
Sbjct: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 663 FLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
           F +DPLN+  GVQYRDI+LARGGLY+I DNL EFLGR+P+  AFLKELGL
Sbjct: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/676 (50%), Positives = 460/676 (68%), Gaps = 6/676 (0%)

Query: 41  FVVPQAAPSWNYTTEELLKQTHEAXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISPL 100
            V PQAAPSWN++ ++++  +H+                 P+++N++ P ++HE     L
Sbjct: 7   LVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLL 66

Query: 101 FNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKD 160
           +NQL FL++VS D E+R+ S   T +++++ I  + ++ L++ FD VW Q KDD +FKK+
Sbjct: 67  WNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDEKFKKE 126

Query: 161 HFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKE 220
           +FE+Y+++EK    + RSG+ +P E R ++ E+K KI+   L+FS NLGE+ E+I FTKE
Sbjct: 127 NFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKE 186

Query: 221 ELIGVSENVMKQFETVDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQN 280
           EL GV + V+ QFE + E G+ K+KVTFKYPDI PVL+ A N ETR+RA + D+N+V  N
Sbjct: 187 ELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVAAN 246

Query: 281 EALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXX 340
           E L  ETL+LR +LA+LL + ++A YNLD KMAK EE VL FLNDL  KL P        
Sbjct: 247 EPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEI 306

Query: 341 XXXXXXXXXXXXNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQI 400
                       N  +D  +Y WD  YY N+ L++ + ++ + +A+YFP+ES I+GML I
Sbjct: 307 LKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGMLNI 366

Query: 401 YETVLKLKFIE---EDNGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAA 456
           Y T+ +LKF+E   E     WH DVK+ +VW +DD + P F GW+YFDLHPR+GKYGHAA
Sbjct: 367 YTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHAA 426

Query: 457 NFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGN 516
           NFG+ S++ K DGS+SYPVT LV NFSKPT  +PALLK  ELTTFFHELGHGIHDLVG N
Sbjct: 427 NFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVGSN 486

Query: 517 DIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHI 576
           D+   NGP + PWDFVEAPSQMLE+WT  +  L  LSKHY+T EKIP SLLD+      +
Sbjct: 487 DLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGL 546

Query: 577 NGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHI 636
           N  L  L QL  GLFDM VH T+D     V +LWN L  EI L++  +  + G++SFGHI
Sbjct: 547 NSGLANLGQLKLGLFDMYVH-TRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHI 605

Query: 637 MSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEF 696
           M+   +  YYGY+W+ VFA+DMY TKF  +P N+ VGV+YRD ILA GGLY++ DNL +F
Sbjct: 606 MAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLRKF 664

Query: 697 LGRKPNNKAFLKELGL 712
           LGR PNNKAFL+ LGL
Sbjct: 665 LGRDPNNKAFLRGLGL 680

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/677 (48%), Positives = 448/677 (66%), Gaps = 6/677 (0%)

Query: 41  FVVPQAAPSWNYTTEELLKQTHE-AXXXXXXXXXXXXXXXXPSVENFVTPYLHHENTISP 99
            V PQ  P WNYT  E++   +  A                 +++N++ P L+++     
Sbjct: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71

Query: 100 LFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKK 159
           L+NQL FL++VS D ++R+ S    ++++ +    S ++ L+  F+ +W Q KDD +FK 
Sbjct: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKV 131

Query: 160 DHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTK 219
            ++E+YK++EK    + R+  NL   +  ++ ++ +KIS ++LQFS NLGE+ E+ITFT+
Sbjct: 132 TNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFTE 191

Query: 220 EELIGVSENVMKQFETVDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQ 279
           EEL GVS  V+ QFE + E G+ K KVTFKYPDI PVL++A N ETR++A++ DQN+V  
Sbjct: 192 EELEGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAA 251

Query: 280 NEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXX 339
           NE L  ETL LR  +A+L  Y +YA+YNL  KMAK EE V+ FL DL  +L P       
Sbjct: 252 NEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDRE 311

Query: 340 XXXXXXXXXXXXXNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQ 399
                        N  +D   Y WDN YY+N+ L++ +QID E +A+YFP+ES I+GML 
Sbjct: 312 ILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGMLD 371

Query: 400 IYETVLKLKFIE---EDNGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHA 455
            Y+T+ +LKF+E       + WH DVK+ +VW +DD + P F GWIYFDL+PR+GKY HA
Sbjct: 372 TYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHA 431

Query: 456 ANFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGG 515
           ANFG++S+F K DGS+SYPVT LVCN +KPT  + A+L+  E+TT FHELGHGIH LV  
Sbjct: 432 ANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVAN 491

Query: 516 NDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKH 575
           N +   N   + PWDFVEAPSQMLE+WT  +  L  LSKHY+T EKIP SLLD+   +  
Sbjct: 492 NKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNSSG 551

Query: 576 INGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGH 635
           +   L+ L QL  GLFDM VH T++   L V +LWN +R EI LI++ +  + G+N+FGH
Sbjct: 552 LGSGLYYLGQLRLGLFDMYVH-TREYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGH 610

Query: 636 IMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTE 695
           IM+ SYSAGYYGY+W+ VFA+DMY TKF  +P NS VG QYRD ILA GGLY++ DNL +
Sbjct: 611 IMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNLRK 670

Query: 696 FLGRKPNNKAFLKELGL 712
           FLGR+PNN+AFL+ LG 
Sbjct: 671 FLGREPNNRAFLRGLGF 687

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  379 bits (973), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 199/414 (48%), Positives = 266/414 (64%), Gaps = 11/414 (2%)

Query: 304 ADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRYYIW 363
           A Y L++K AK  + V +FLNDL+ KLKP                       YD   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 364 DNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGDT---WHP 420
           D  YY+ + L+ NF +DEE+ A+YFPLE TIK ML  Y T+ +  F+EE    T   WH 
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 421 DVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALV 479
           D K+ SVWKMDD + P F GW+YFDLHPR+GK+GH A F    + +  +GSR YPVT+LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 480 CNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQML 539
           CNFS P+K+KPALLKH E+  FFHELGHG H L+   ++      S  P DF+EAPSQML
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CSSSWVPRDFIEAPSQML 286

Query: 540 EFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHT-T 598
           E+W W K  +  LSKH +T E+IP+SL+D +V++K  N A+  L Q+   L DM VH   
Sbjct: 287 EYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKHV 344

Query: 599 KDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDM 658
                L++  LWN+L E++ LI N +  T+ + SF HI+ + Y+AGYYGY W+ VFA+DM
Sbjct: 345 GSYETLDLNALWNNLCEDVILIKNPE-PTRAYCSFSHIV-EGYAAGYYGYQWSKVFAADM 402

Query: 659 YYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712
           Y+++F +  L+  +G  Y D I+ARGGLYE+EDNL EFL R+PNN+A+L++ GL
Sbjct: 403 YFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  199 bits (505), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 156/576 (27%), Positives = 271/576 (47%), Gaps = 58/576 (10%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLG-EQNEFITFTKEEL--IGVSENV 229
           +DF +SG+ +  + RD+  E+ + IS     F  N    ++EFI    EEL   GVS  +
Sbjct: 221 EDFEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIASEELDNSGVSPIL 280

Query: 230 MKQFETVDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQ 289
           ++Q  T      T YKV       + +L+S KN   RK  +    +   +        ++
Sbjct: 281 LRQLTTTVRG--THYKVPAYGTAPYIILRSCKNENARKAVWTALHSCPDKQINRLTHMVK 338

Query: 290 LRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXX 349
           +R+ L+ ++    +A Y L  KMAK  E VL F+  L    KP                 
Sbjct: 339 MRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMAAEELKLLANMKLNDL 398

Query: 350 XXXNT-----------PYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGML 398
                           P+DR YY+  ++        KN   + E I  YF L S ++G+ 
Sbjct: 399 GLPEANSEKEILETVRPWDRDYYVAKSQQTRK---AKNQLTNHEPINAYFTLGSVLEGLS 455

Query: 399 QIYETV--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAA 456
            +++++  + L+ +    G+TW  +V++++V   ++N    +G +Y DL  R+ K    A
Sbjct: 456 NLFKSIYGISLEVVASIPGETWSSEVRRVNVKTENNN---IIGVVYCDLFERKAKTSSPA 512

Query: 457 NFGISS---------------SFLKSDGSR-SYPVTALVCNFSKPTKDKPALLKHSELTT 500
           +F +                 S + S G +   P+ +LVCNF++ + ++  LL+ SE+ T
Sbjct: 513 HFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFARTSDNELCLLQLSEIET 572

Query: 501 FFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEE 560
            FHE+GH +H ++G   +   +G   T  DFVE PS ++E +  + + LK + +HY T+E
Sbjct: 573 LFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFARDPRVLKGIGRHYITKE 631

Query: 561 KIPDSLL-DSLVRTKHI-NGALFALRQLHFGLFDMKVHTTK---DISKLNVTELWNSLRE 615
           K+P+ LL + L  T+++ N   FA  Q    + D +++       +  L+V EL++ L  
Sbjct: 632 KVPEDLLAEELNSTRYLQNCETFA--QAKMAMLDQRLYDNNIIFHVRDLDVVELYHDLER 689

Query: 616 EI-CLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGV 674
            +  L+D+   QT     FGH+    Y A YY Y+     A+ ++   F+ DP +   G 
Sbjct: 690 NLEVLVDD---QTNWCGKFGHLF--GYGATYYSYLLDRAIAAKIWDCLFVNDPFSRTGGE 744

Query: 675 QYRDIILARGGLYE----IEDNLTEFLGRKPNNKAF 706
            +++ +L  GGL +    I D L + + +K + KA 
Sbjct: 745 NFKNAVLKWGGLRDPWECIADVLDQPMLKKGDTKAM 780

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  191 bits (485), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 151/547 (27%), Positives = 255/547 (46%), Gaps = 46/547 (8%)

Query: 174 DFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLG-EQNEFITFTKEEL--IGVSENVM 230
           DF +SG+ +    R++  E+ ++IS    +F  N      EFI   ++E+   G+S  + 
Sbjct: 194 DFEKSGIYMKAGIREQFIELSQQISVIGQEFINNTDYVAKEFIKVKRDEMDKSGISPLLT 253

Query: 231 KQFETVDEDGITKYKVTFKYPDI-FPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETL- 288
            +   ++ D   KY     Y  I   +LKS  + + RK  +    N  P+ +   L  L 
Sbjct: 254 AR---LNRDLTGKYYKIPTYGQIPLQILKSCPDEDIRKEVWAALHN-CPKAQIQRLNQLV 309

Query: 289 QLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXX 348
           +LR  L+ LL   SY+DY LD KMA   E V  F+  L N  KP                
Sbjct: 310 RLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNVTKPLAARELEFIARDKLNA 369

Query: 349 XXXXNTPYDRRYYI---WDNRYYDNQYLKKN--FQIDEEKIAEYFPLESTIKGMLQIYET 403
               +   +    I   WD  Y+ ++Y   N    I +E++  YF L + I G+ ++++ 
Sbjct: 370 PDSRHMSDNEILSIVKPWDKNYFSSKYDSDNEMAMIRDEQLRYYFSLGNVINGLSELFKR 429

Query: 404 V--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGIS 461
           +  + L+    +NG+TW PDV++L V   ++     VG IY DL  R GK  + A+F + 
Sbjct: 430 IYGITLQPSRTENGETWSPDVRRLDVISEEE---GLVGVIYCDLFERVGKISNPAHFTVC 486

Query: 462 SS---------------FLKSDGSR-SYPVTALVCNFSK---PTKDKPALLKHSELTTFF 502
            S                  SDG+    PV +LVCNFS    P  ++   L  +E+ T F
Sbjct: 487 CSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTVALPNGNRTCFLHMNEIETLF 546

Query: 503 HELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKI 562
           HE+GH +H ++G   +   +G      DFVE PS ++E +  + + L+++  HY+T E  
Sbjct: 547 HEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDIRVLRTIGSHYETSEPA 605

Query: 563 PDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTT---KDISKLNVTELWNSLREEICL 619
           P++LL+  +             Q    + D K+H +    DI +++  +++  L   + +
Sbjct: 606 PEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLSDIERIDSAKIYQKLETRLQV 665

Query: 620 IDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDI 679
           +   D ++     FGH+    Y A YY Y++    AS ++ + F +DP N   G ++++ 
Sbjct: 666 L--ADDESNWCGRFGHLF--GYGATYYSYLFDRAIASKVWDSLFKDDPFNRTGGEKFKER 721

Query: 680 ILARGGL 686
           +L  GGL
Sbjct: 722 VLKWGGL 728

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  187 bits (474), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 149/553 (26%), Positives = 260/553 (47%), Gaps = 56/553 (10%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKN---LGEQNEFITFTKEELIGVSENV 229
           +DF +SG+ +  E R++   + + IS    +F  N   + + N  ++  + + +G+   +
Sbjct: 217 EDFEKSGIYMKPEVREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLGIDPEL 276

Query: 230 MKQFETVDEDGITKYKV-TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETL 288
           + Q E  D  G   YK+ T+ Y   F +LKS  + E R++ ++   N   +      + +
Sbjct: 277 LSQIEK-DIAG-KNYKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIKRLTDLV 333

Query: 289 QLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXX 348
           +LR  L++LL   SYA+Y L+ KMAK  + V+ F+  L +  KP                
Sbjct: 334 KLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGIAEKKLTI 393

Query: 349 XXXXNT-----------PYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGM 397
               +            P+DR YY    R    Q   KN    EE + +YF L + ++G+
Sbjct: 394 KSNGSNLSVCDILKTVRPWDRDYYSAIER---EQTSAKNLYGSEE-VLKYFTLGNVMQGL 449

Query: 398 LQIYETV--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHA 455
             +++ +  +KL+      G+TW P+V+K++V   D+     +G IY DL  R GK  +A
Sbjct: 450 SNLFQKIYGIKLELDVPKIGETWSPEVRKINVISEDEGL---IGIIYCDLFERSGKTSNA 506

Query: 456 ANFGISSS---------------FLKSDGSR-SYPVTALVCNFSKPT---KDKPALLKHS 496
           A+F I  S                + S G+R   P+ +LVCNFSK      D    L   
Sbjct: 507 AHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSVCFLHLP 566

Query: 497 ELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHY 556
           E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E++  + + L+++ KHY
Sbjct: 567 EVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLETIGKHY 625

Query: 557 QTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVH---TTKDISKLNVTELWNSL 613
            T+E +   +L+  ++            Q    + D  +H    +  +  L+V +L+  L
Sbjct: 626 LTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHLDVVKLYQDL 685

Query: 614 REEI-CLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDV 672
             ++  L+D+   ++     FGH+    YSA YY Y++    AS ++   F  +P +   
Sbjct: 686 ERQLGVLVDD---KSNWCGKFGHLF--GYSAVYYSYLFDRAIASKIWGALFERNPFSRAS 740

Query: 673 GVQYRDIILARGG 685
           G +YR+ +L  GG
Sbjct: 741 GDKYRNSVLQWGG 753

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  184 bits (467), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 158/582 (27%), Positives = 273/582 (46%), Gaps = 50/582 (8%)

Query: 140 LFRQFDIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISN 199
           L      V N  K  ++  ++  ++ K +     DF +SG+ +  + R+K  ++ ++IS 
Sbjct: 176 LCNMLKTVLNSPKISSKLSEEELKVGKIL---LDDFEKSGIYMNPDVREKFIQLSQEISL 232

Query: 200 NSLQFSKNL---GEQNEFITFTKEELIGVSENVMKQFETVDEDGITKYKV-TFKYPDIFP 255
              +F  +    G  +  I+  + +   VS  ++KQ    D  G   YKV TF Y   + 
Sbjct: 233 VGQEFINHTDYPGSNSVKISCRELDNSNVSAFLLKQLNK-DVKG-QNYKVPTFGYA-AYA 289

Query: 256 VLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKK 315
           +LKS +  + RK+ +    +   +        ++LR +LA+L++  SYA+Y L+ KMAK 
Sbjct: 290 LLKSCEKEQVRKKIWTALHSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKN 349

Query: 316 ----EEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRYYIWDNRYYDNQ 371
               ++ +LT +ND  +K                            +    WD  YY  +
Sbjct: 350 PKDVQDFILTLMNDTIDKTATELKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGK 409

Query: 372 YLKKNFQ--IDEEKIAEYFPLESTIKGMLQIYETV--LKLKFIEEDNGDTWHPDVKKLSV 427
           YL+ N       ++I+ YF L + I+G+  +++ +  +KL+    D G+TW PDV++L+V
Sbjct: 410 YLQLNPSNAPSAKEISSYFTLGNVIQGLSDLFQHIYGIKLEPAIADEGETWSPDVRRLNV 469

Query: 428 WKMDDNFPSFVGWIYFDLHPREGKYGHAANFGISSSFL---------------KSDGSR- 471
              ++     +G IY DL  R GK  + A+F +  S                  +DGS  
Sbjct: 470 ISEEEGI---IGIIYCDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFF 526

Query: 472 SYPVTALVCNFSK-PTKDKPAL--LKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATP 528
             PV +LVCNF+  P   K +L  L+ SE+ T FHE+GH +H ++G   +   +G     
Sbjct: 527 QLPVISLVCNFAPIPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT 586

Query: 529 WDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHF 588
            DFVE PS ++E +  + + L  + KHY+T E +   +L S +RT +         Q   
Sbjct: 587 -DFVELPSILMEHFAKDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKM 645

Query: 589 GLFDMKVHTTKDISKL---NVTELWNSLREEI-CLIDNGDIQTKGFNSFGHIMSDSYSAG 644
            + D   H  + IS +   +V + + +L   +  L+D+   Q+     FGH+    Y A 
Sbjct: 646 AMLDQSFHDEEVISNIDNYDVVKNYQALERRLKVLVDD---QSNWCGRFGHLF--GYGAT 700

Query: 645 YYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGL 686
           YY Y++    AS ++Y  F +DP +   G +++  +L  GGL
Sbjct: 701 YYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGL 742

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  183 bits (465), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 155/548 (28%), Positives = 254/548 (46%), Gaps = 47/548 (8%)

Query: 174 DFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNL---GEQNEFITFTKEELIGVSENVM 230
           DF +SG+ +  + R+K  E+ ++IS    +F  +    G  +  I     +   VS  ++
Sbjct: 204 DFEKSGIYMNPDVREKFIELSQEISLIGQEFINHTDYPGSNSVKIPCKDLDNGNVSAFLL 263

Query: 231 KQFETVDEDGITKYKV-TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQ 289
           KQ    D  G   YK+ TF Y   + +LKS +  E RK+ +    +   +        ++
Sbjct: 264 KQLNK-DVKG-QNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLSHLIK 320

Query: 290 LRNDLAELLNYDSYADYNLDIKMAKK----EEAVLTFLNDLKNKLKPXXXXXXXXXXXXX 345
           LR  LA L+N +SYA+Y L+ KMAK     ++ +LT +N   +K                
Sbjct: 321 LRAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIAELKTKDL 380

Query: 346 XXXXXXXNTPYDRRYYIWDNRYYDNQYLKKNFQ--IDEEKIAEYFPLESTIKGMLQIYET 403
                       R    WD  YY  +YL+ N     + ++I+ YF L + I+G+  +++ 
Sbjct: 381 KKPLATKTDDILRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVIEGLSDLFQH 440

Query: 404 VLKLKFIEE--DNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGIS 461
           +  ++   E  D G+TW PDV++L+V   ++     +G IY DL  R GK  + A+F + 
Sbjct: 441 IYGIRLEPEIADEGETWSPDVRRLNVISEEE---GIIGIIYCDLFERNGKTSNPAHFTVC 497

Query: 462 SSFL---------------KSDGSR-SYPVTALVCNFSK-PTKDKPAL--LKHSELTTFF 502
            S                   DGS    PV +LVCNF+  P   K  L  L+ SE+ T F
Sbjct: 498 CSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFLQLSEVETLF 557

Query: 503 HELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKI 562
           HE+GH +H ++G   +   +G      DFVE PS ++E +  + + L  +SKHY+T E I
Sbjct: 558 HEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKISKHYETGETI 616

Query: 563 PDSLLDSLVRTKHINGALFALRQLHFGLFDMKVH---TTKDISKLNVTELWNSLREEI-C 618
              +L S +RT +         Q    + D   H      DI   ++ + + +L   +  
Sbjct: 617 QAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNYQALERRLKV 676

Query: 619 LIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRD 678
           L+D+   Q+     FGH+    Y A YY Y++    AS ++Y  F +DP +   G +++ 
Sbjct: 677 LVDD---QSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKK 731

Query: 679 IILARGGL 686
            +L  GGL
Sbjct: 732 HLLKWGGL 739

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  180 bits (457), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 142/561 (25%), Positives = 266/561 (47%), Gaps = 45/561 (8%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLG-EQNEFITFTKEEL--IGVSENV 229
           +DF +SG+++  +  ++   I ++IS    +F  N    +++++    +EL   GVS  +
Sbjct: 203 EDFEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLL 262

Query: 230 MKQFETVDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETL- 288
           + Q     ++    YKV       F +L+S  N   R + +    +  P+ +   L+ L 
Sbjct: 263 LNQLSRDLKN--QNYKVPAYGYAAFSILRSCPNENVRMKIWTA-MHSCPEKQISRLKQLV 319

Query: 289 QLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXX 348
            LR  LA ++   SYA+Y L  KMAK    V  F+  L +  KP                
Sbjct: 320 MLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKSGH 379

Query: 349 XXXXNTPYD-----RRYYIWDNRYYD--NQYLKKNFQIDEEKIAEYFPLESTIKGMLQIY 401
               N P       R    WD  +Y   N   ++   ++ E I+ YF L + ++G+ +++
Sbjct: 380 LGV-NVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLSRLF 438

Query: 402 ETV--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFG 459
           E +  ++L+ +    G+TW P+V++++V    +     +G +Y DL  R+GK  + A+F 
Sbjct: 439 EDIYGIRLEPVVAKAGETWSPEVRRINVVSEKEGI---IGVVYCDLFERQGKTSNPAHFT 495

Query: 460 ISSSF----------------LKSDGSRSYPVTALVCNFSK--PTKDKPALLKHSELTTF 501
           +  S                 L S      PV +LVC+F++   ++    LL+ S++ T 
Sbjct: 496 VCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSDVDTL 555

Query: 502 FHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEK 561
           FHE+GH +H ++G   +   +G      DFVE PS ++E +  + + L  + +HY T++ 
Sbjct: 556 FHEMGHAMHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFARDSRVLSRIGRHYATDQP 614

Query: 562 IPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDIS--KLNVTELWNSLREEICL 619
           IP  LL       +         Q    + D ++H++K ++  KL+V +L++ + +++ +
Sbjct: 615 IPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVEKDMEV 674

Query: 620 IDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDI 679
           +   D Q+     FGH++   Y A YY Y++    AS ++   F EDP N + G ++++ 
Sbjct: 675 L--ADDQSNWCGRFGHLLG--YGASYYSYLFDRAIASKIWQHLFAEDPFNRENGEKFKES 730

Query: 680 ILARGGLYEIEDNLTEFLGRK 700
           +L  GG  +  + + + L RK
Sbjct: 731 VLKWGGSKDPWECVADALDRK 751

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  180 bits (457), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 142/556 (25%), Positives = 263/556 (47%), Gaps = 57/556 (10%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGE-QNEFITFTKEEL--IGVSENV 229
           +DF++SG+ +   ++D+   + + IS    ++  N+ +     I   + EL   G+  +V
Sbjct: 209 QDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDNAGIEFDV 268

Query: 230 MKQFETVDEDGITKYKVTFKYPDI-FPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETL 288
             Q   + +D   KY     Y  + F +LK+  + E RK+ ++   +   Q        +
Sbjct: 269 ACQ---LGKDITGKYYKIPTYGHLPFLILKACTDPEIRKKIWVAMHDCSKQQIERLTNLV 325

Query: 289 QLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXX 348
           ++R  LA  +  + YA Y +D KMAK  + V  FL  L + LKP                
Sbjct: 326 KIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFISDLIHNE 385

Query: 349 XXXXNT-----------PYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGM 397
                +           P+DR YY   +R   N+  +K+  +D+  +  Y+PL + I+G+
Sbjct: 386 KGEKPSDDVDEILTAVRPWDREYYTAIHR---NK--QKHLLLDDYALDVYYPLGNVIQGL 440

Query: 398 LQIYETVLKLKF--IEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHA 455
             I+E++  ++F       G+TW  DV++L+V    +     +G IY DL  R+GK  +A
Sbjct: 441 SDIFESIYGIRFEPAVAGKGETWSSDVRRLNVVSEKE---GLIGIIYCDLFRRQGKTNNA 497

Query: 456 ANFGISSSF---------------LKSDGSR-SYPVTALVCNFSKP---TKDKPALLKHS 496
           A+F I  S                   DG++   P+ +L+CNF+     + +   LL  +
Sbjct: 498 AHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGETICLLALN 557

Query: 497 ELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHY 556
           E+ T FHE+GH IH ++G   +   +G   +  DFVE PS ++E +  + + LK +  HY
Sbjct: 558 EIETLFHEMGHAIHSMLGRTRLQNVSGTRCST-DFVELPSVLMEHFARDTRVLKRIGHHY 616

Query: 557 QTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVH---TTKDISKLNVTELWNSL 613
           +T +++P +LL+  +             Q    + D +++     ++I  ++V ++++ L
Sbjct: 617 KTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKIYHEL 676

Query: 614 REEI-CLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDV 672
            +E+  L+D+   ++     FGH+    Y A YY Y++    AS ++   F +DP +   
Sbjct: 677 EKELEVLVDD---ESNWCAKFGHLF--GYGATYYCYLFDRAIASKVWKKLFEKDPYSRSG 731

Query: 673 GVQYRDIILARGGLYE 688
           G ++++ +L  GGL E
Sbjct: 732 GEKFKNDVLKWGGLRE 747

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  179 bits (455), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 144/548 (26%), Positives = 259/548 (47%), Gaps = 47/548 (8%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLG-EQNEFITFTKEEL--IGVSENV 229
           +DF +SG+++  E R++   + ++IS     F  N    ++ +I    EEL   G+++ V
Sbjct: 198 EDFEKSGIHMNPEVREQFIALSQQISVVGQDFINNTEYVRSNYIKVEVEELNKSGINKIV 257

Query: 230 MKQFETVDEDGITKYKV-TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETL 288
           + Q  + D  G   YK+ TF Y   + +L+S  +   R + +    +   +  A   + +
Sbjct: 258 LNQL-SKDIKG-RHYKIPTFGYIP-YSILRSCPDDNIRMKVWSALHSCSEKQIARLDQLI 314

Query: 289 QLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXX 348
           +LR+ LA ++   S+A Y L+ KMAK  E V  F+  L +  KP                
Sbjct: 315 KLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIADLKAKH 374

Query: 349 XXXXNTPYDRRYYI------WDNRYYDNQY-LKKNFQIDEEKIAEYFPLESTIKGMLQIY 401
               N P +  + I      WD  +Y + + L++    + E+I+ YF L   I+G+  ++
Sbjct: 375 VPG-NKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNNEQISSYFSLGVVIQGLSNLF 433

Query: 402 ETV--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFG 459
           + +  + L+ +    G+TW P+V++++V    +     +G +Y DL  R+GK  + A+F 
Sbjct: 434 KQIYGIYLEPVVPKTGETWSPEVRRINVVSEKEGV---IGVVYCDLFERQGKTANPAHFT 490

Query: 460 ISSSFLKSDGSR----------------SYPVTALVCNFSKPT---KDKPALLKHSELTT 500
           +  S    DG                    PV +LVCNFS  T   +    LL+ SE+ T
Sbjct: 491 VCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSICLLQLSEIET 550

Query: 501 FFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEE 560
            FHE+GH +H ++G   +   +G      DFVE PS ++E +  + + L+ ++ HY T E
Sbjct: 551 LFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQRMASHYSTGE 609

Query: 561 KIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVH---TTKDISKLNVTELWNSLREEI 617
            IP+ LL S            A  Q    + D ++H     K++  L++ +L+++L  ++
Sbjct: 610 SIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVKLYHNLERQL 669

Query: 618 CLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYR 677
            ++   D ++     FGH+    Y A YY Y++    AS ++   F  DP     G +++
Sbjct: 670 EVL--SDDKSNWCGRFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPFCRRSGEKFK 725

Query: 678 DIILARGG 685
           + +L  GG
Sbjct: 726 NSVLKWGG 733

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  178 bits (452), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 153/548 (27%), Positives = 257/548 (46%), Gaps = 47/548 (8%)

Query: 174 DFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNL---GEQNEFITFTKEELIGVSENVM 230
           DF +SG+ +    R+K  ++ ++IS    +F  ++   G  +  I     +   VS  ++
Sbjct: 204 DFEKSGIYMNPGVREKFIQLSQEISLVGQEFINHIDYPGSNSVKIPCKDLDSSKVSTFLL 263

Query: 231 KQFETVDEDGITKYKV-TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQ 289
           KQ    D  G   YKV TF Y   F +LKS +    RK+ +    +   +        ++
Sbjct: 264 KQLNK-DVKG-QNYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIK 320

Query: 290 LRNDLAELLNYDSYADYNLDIKMAKK----EEAVLTFLNDLKNKLKPXXXXXXXXXXXXX 345
           LR  LA L++  SYA+Y L+ KMAK     ++ +LT +N+  +K                
Sbjct: 321 LRAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAKDL 380

Query: 346 XXXXXXXNTPYDRRYYIWDNRYYDNQYLKKNFQ--IDEEKIAEYFPLESTIKGMLQIYET 403
                       +    WD  YY  +Y++ N       ++I+ YF L + I+G+  +++ 
Sbjct: 381 KKPLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQGLSDLFQQ 440

Query: 404 V--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGIS 461
           +  ++L+    D G+TW PDV++L+V   ++     +G IY DL  R GK  + A+F + 
Sbjct: 441 IYGIRLEPAIADEGETWSPDVRRLNVISEEE---GIIGIIYCDLFERNGKTSNPAHFTVC 497

Query: 462 SSF-------------LKSDGSRSY---PVTALVCNFSK-PTKDKPAL--LKHSELTTFF 502
            S              +  + + SY   PV +LVCNFS  P   K +L  L+ SE+ T F
Sbjct: 498 CSRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQLSEVETLF 557

Query: 503 HELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKI 562
           HE+GH +H ++G   +   +G      DFVE PS ++E +  + + L  + KHY+T E I
Sbjct: 558 HEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRVLTRIGKHYETGETI 616

Query: 563 PDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTK---DISKLNVTELWNSLREEI-C 618
              +L   ++T +         Q    + D   H  K   DI   NV + + +L   +  
Sbjct: 617 QKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQALERHLKV 676

Query: 619 LIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRD 678
           L+D+   Q+     FGH+    Y A YY Y++    AS ++YT F +DP + + G +++ 
Sbjct: 677 LVDD---QSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNNGDKFKK 731

Query: 679 IILARGGL 686
            +L  GGL
Sbjct: 732 HLLKWGGL 739

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  175 bits (443), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 153/645 (23%), Positives = 292/645 (45%), Gaps = 60/645 (9%)

Query: 82  SVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLF 141
            ++N++       +T+  + +   F++    D    D +    E +  F    +    L 
Sbjct: 127 GLQNYILRLDQLSDTLCRVIDLCEFIRSSHPDSHFVDAAQDCHEEMFEFMNVLNTDVNLC 186

Query: 142 RQFDIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNS 201
            +   V N  +   +   +  ++ K +    +DF +SG+ +  E R++   + ++IS   
Sbjct: 187 NKLRTVLNTPEVVCKLSSEEVKVGKIL---LEDFEKSGIYMNPEIREQFIALSQEISIVG 243

Query: 202 LQFSKNLG-EQNEFITFTKEEL--IGVSENVMKQFETVDEDGITKYKVTFKYPDIFPVLK 258
             F  N    +  +IT   E +   G+++ ++ Q  + D  G   YK+       + VL+
Sbjct: 244 QDFINNTDFVRTNYITVDCETIHNSGINQLILSQL-SKDIKG-KHYKIPTHGYIAYSVLR 301

Query: 259 SAKNAETRKRAFIGDQNKVPQNEALFLETL-QLRNDLAELLNYDSYADYNLDIKMAKKEE 317
           +  +   RK+ +    +  P  + + L+ L +LR  LA L+   SYA+Y L+ KMAK  E
Sbjct: 302 ACPDEIVRKKLWTA-MHSCPDKQIVRLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPE 360

Query: 318 AVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNT------------PYDRRYYIWDN 365
            V  F++ L    +P                     +            P+DR +Y   +
Sbjct: 361 EVTDFIDSLIKVTQPKAKQELGFISDLKRKHMDLPPSETSNLDTLDIVRPWDRDFY---H 417

Query: 366 RYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETV--LKLKFIEEDNGDTWHPDVK 423
             Y  Q  ++   ID+++I+ YF L + ++G+  ++  +  ++L+ +    G+TW P+V+
Sbjct: 418 TIYSIQQ-RRQSPIDDQQISMYFTLGNVMQGLSDLFHQIYGIRLEPVIAQKGETWSPEVR 476

Query: 424 KLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGISSS---------------FLKSD 468
           +L+V   ++     +G +Y DL  R+GK  + ++F +  S                   D
Sbjct: 477 RLNVVSDEEGV---IGVVYCDLFERDGKTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKD 533

Query: 469 GSR-SYPVTALVCNFSKPT---KDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGP 524
           G++   P+ +LVCNF+           LL  SE+ T FHE+GH +H ++G   +   +G 
Sbjct: 534 GTKFQLPIISLVCNFASSVVSFGQSLCLLHISEIETLFHEMGHAMHSMLGRTRLQNLSGT 593

Query: 525 SATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALR 584
                DFVE PS ++E +  + + L+ + KH  T E +P+SLL + ++            
Sbjct: 594 RCAT-DFVELPSILMEHFARDTRVLRQIGKHCNTGEPVPESLLTNYLQDLQYMQYCETFS 652

Query: 585 QLHFGLFDMKVHTTKDIS---KLNVTELWNSLREEI-CLIDNGDIQTKGFNSFGHIMSDS 640
           Q    + D ++H  + I+    L+V  L+ +L  E+  L+D+   Q+     FGH+    
Sbjct: 653 QAKMAMLDQRLHGKEIITGMDTLDVVALYQNLERELRVLVDD---QSTWCGRFGHLF--G 707

Query: 641 YSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGG 685
           Y A YY Y++    AS ++ + F EDP +   G ++++ +L  GG
Sbjct: 708 YGATYYSYLFDRAIASKVWESLFQEDPFSRAGGQRFKEYVLKWGG 752

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  173 bits (439), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 161/625 (25%), Positives = 275/625 (44%), Gaps = 47/625 (7%)

Query: 95  NTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDD 154
           +T+  + +   F++ V  DKE    + +  E  E F   ++L   +    D +   L D+
Sbjct: 132 DTLCRVIDLCEFIRSVHPDKEFLSAAQQCHE--EMFEFMNTLNTDV-ELCDKLKTLLHDN 188

Query: 155 AQFKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGE-QNE 213
               K   E  K      +DF +SG+ +    R++  E+ ++IS     F  N  + +  
Sbjct: 189 EILSKLSEEEIKVGRILLEDFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTN 248

Query: 214 FITFTKEELIGVSENVMKQFETVDEDGITK-YKVTFKYPDIFPVLKSAKNAETRKRAFIG 272
           +I     +L     N +    ++ +D I + YK+    P  + VLK  KN E R   +  
Sbjct: 249 YIKVNASKLESAGLNRL-LLNSLKKDAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTA 307

Query: 273 DQNKVPQNEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKP 332
             +   +        ++LR  LA L+  +S++ Y L  K+AK  + V  F+  L   ++P
Sbjct: 308 LHSCSSEQILRLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRP 367

Query: 333 XXXXXXXXXXXXXXXXXXXXNT----PYDRRYYIWDNRYYDNQYLKKNFQIDE---EKIA 385
                               N             WD  YY + Y K   + +    E ++
Sbjct: 368 NTEKELKFIADLKREDQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFTEPLS 427

Query: 386 EYFPLESTIKGMLQIYETV--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYF 443
            YF L    +G+  +   +  +KL+     +G+TW  DV+K++V   ++     +G IYF
Sbjct: 428 SYFTLGGVFEGLSDLLTQIYGIKLEPAIPVSGETWFNDVRKINVISEEE---GIIGIIYF 484

Query: 444 DLHPREGKYGHAANFGISSS---------------FLKSDGSR-SYPVTALVCNFSKPT- 486
           DL  R GK  + A+F +  S                 K DG+    P+ +LVCNFS+ T 
Sbjct: 485 DLFERYGKTSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTF 544

Query: 487 -KDKP-ALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTW 544
             DK   LL  SE+ T FHE+GH IH ++G   +   +G      DFVE PS ++E +  
Sbjct: 545 QSDKTICLLTLSEIETLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILMEHFAS 603

Query: 545 NKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTK---DI 601
           + + LK +S HY+T EKI +  L   ++      +     Q    + D ++H+ K   ++
Sbjct: 604 DTRVLKKMSCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNL 663

Query: 602 SKLNVTELWNSLREEI-CLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYY 660
             LNV E++ +L   +  L+D+   ++     FGH+    Y A YY Y++    A  ++ 
Sbjct: 664 DNLNVVEIYQNLERRLQVLVDD---RSNWCGKFGHLF--GYGATYYSYLFDRAIARKVWN 718

Query: 661 TKFLEDPLNSDVGVQYRDIILARGG 685
             F  DP N   G ++++ +L  GG
Sbjct: 719 HLFANDPFNKTNGEKFKESLLKWGG 743

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  172 bits (436), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 149/548 (27%), Positives = 250/548 (45%), Gaps = 47/548 (8%)

Query: 174 DFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNL---GEQNEFITFTKEELIGVSENVM 230
           DF +SG+ +  + R+K  ++ ++IS    +F  +    G  +  I     +   VS  ++
Sbjct: 204 DFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSVKIPCKDLDNSKVSTFLL 263

Query: 231 KQFETVDEDGITKYKV-TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQ 289
           KQ    D  G   YKV TF Y   + +LKS +N   RK+ +    +   +        ++
Sbjct: 264 KQLNK-DVKG-QNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIK 320

Query: 290 LRNDLAELLNYDSYADYNLDIKMAKK----EEAVLTFLNDLKNKLKPXXXXXXXXXXXXX 345
           LR  LA L++  SYA+Y L+ KMAK     ++ +LT +N+   K                
Sbjct: 321 LRAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKFIAELKAKDL 380

Query: 346 XXXXXXXNTPYDRRYYIWDNRYYDNQYLKKN--FQIDEEKIAEYFPLESTIKGMLQIYET 403
                       +    WD  YY  +Y + N     + ++I+ YF L + I+G+  +++ 
Sbjct: 381 KKPLTTNTDEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQGLSDLFQQ 440

Query: 404 V--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGIS 461
           +  ++L+    D G+TW PDV++L+V   ++     +G IY DL  R GK  + A+F + 
Sbjct: 441 IYGIRLEPAITDEGETWSPDVRRLNVISEEE---GIIGIIYCDLFERNGKTSNPAHFTVC 497

Query: 462 SSFL---------------KSDGSR-SYPVTALVCNFSK---PTKDKPALLKHSELTTFF 502
            S                   DG+    PV +LVCNFS     +K     L+ SE+ T F
Sbjct: 498 CSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQLSEVETLF 557

Query: 503 HELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKI 562
           HE+GH +H ++G   +   +G      DFVE PS ++E +  + + L  + KHY T E I
Sbjct: 558 HEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIGKHYGTGETI 616

Query: 563 PDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTK---DISKLNVTELWNSLREEI-C 618
              +L   +++ +         Q    + D   H  K   DI   +V E + +L   +  
Sbjct: 617 QADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQALERRLKV 676

Query: 619 LIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRD 678
           L+D+   Q+     FGH+    Y A YY Y++    AS ++Y  F +DP +   G +++ 
Sbjct: 677 LVDD---QSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKK 731

Query: 679 IILARGGL 686
            +L  GGL
Sbjct: 732 HLLKWGGL 739

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  172 bits (437), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 156/603 (25%), Positives = 265/603 (43%), Gaps = 97/603 (16%)

Query: 161 HFEIYKF-------VEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGE--- 210
           H E+++F       VE C  D LR  L  PE        IK K+SN  +   K L E   
Sbjct: 170 HEEMFEFMNILNTDVELC--DTLRQVLTDPE--------IKGKLSNEEITVGKILLEDFE 219

Query: 211 ----------QNEFITFTKE-ELIG---------VSENVMK-QFETVDEDGITKYKVT-- 247
                     +++FI  ++E  L+G         V  N +K + E VD  GI K  ++  
Sbjct: 220 KSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRSNYIKIKCEEVDNSGINKLLISQL 279

Query: 248 --------FKYPD----IFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLA 295
                   +K P      + +L+S  + E R   +        +      + L+LR  LA
Sbjct: 280 PKDVRGKYYKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRCSDKQINRLDQLLRLRAILA 339

Query: 296 ELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTP 355
           +L+  +S+A Y L+ KMA+  + V  F+  L N ++P                      P
Sbjct: 340 KLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIYELKSKQEKREIQP 399

Query: 356 YDRRYYI------WDNRYYDNQY--LKKNFQIDEEKIAEYFPLESTIKGMLQIYETV--L 405
                 I      WD  YY + Y   ++   ID+E+I+ YF L + I+G+  ++E++  +
Sbjct: 400 SPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTLGNVIQGLSDLFESIYGI 459

Query: 406 KLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGISSS-- 463
           +L+ +    G+T+ P+V++L+V    +     +G +Y DL  R GK  + ++F +  S  
Sbjct: 460 RLEPVVPKTGETFSPEVRRLNVVCEQEG---VIGVVYCDLFERAGKTSNPSHFTVCCSRQ 516

Query: 464 -------------FLKSDGSR-SYPVTALVCNFSKPTKDKP---ALLKHSELTTFFHELG 506
                           S+G     PV ALVCNFS  T  +     LL+ +E+ T FHE+G
Sbjct: 517 IYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGKSICLLQLNEVETLFHEMG 576

Query: 507 HGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSL 566
           H +H ++G   +   +G      DFVE PS ++E +  + + L+ + KH++T   I + L
Sbjct: 577 HAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDVRVLERIGKHHRTGAPISEKL 635

Query: 567 LDSLVRTKHINGALFALRQLHFGLFDMKVH---TTKDISKLNVTELWNSLREEI-CLIDN 622
           L + +             Q    + D  +H     KD    +VT  +  L  ++  L+D+
Sbjct: 636 LLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHFDVTAAYQQLERDMKVLVDD 695

Query: 623 GDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILA 682
              ++     FGH+    Y A YY Y++    AS ++ + F  DP +   G ++++ +L 
Sbjct: 696 ---KSNWCGKFGHLF--GYGATYYSYLFDRAIASKVWDSLFSSDPYSRVNGEKFKECVLK 750

Query: 683 RGG 685
            GG
Sbjct: 751 WGG 753

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  169 bits (429), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 145/546 (26%), Positives = 246/546 (45%), Gaps = 50/546 (9%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGE-QNEFITFTKEEL--IGVSENV 229
           +DF ++G     E R +  ++ + IS     F  N     + +I    ++L   G S  V
Sbjct: 214 EDFEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSYIKIPCKDLESSGTSHLV 273

Query: 230 MKQFETVDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRA----FIGDQNKVPQNEALFL 285
           ++Q  T D  G   YK+       + +L +  +   R++     F   + +V + ++L  
Sbjct: 274 LRQL-TKDTMG-NNYKIPTSGYAPYTLLNACPSEAIRRQVWTAMFSCSEKQVKRLKSL-- 329

Query: 286 ETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXX 345
             LQLR  LA ++    Y  Y L+ KMAK  E V  FLN L +  KP             
Sbjct: 330 --LQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGELEELAKLK 387

Query: 346 XXXXXXXNTPYDRRYYIWDNRYYDN---QYLKKNFQIDE-EKIAEYFPLESTIKGMLQIY 401
                   T   +    WD  YY +    + + N ++D    I  YF L   ++G+  ++
Sbjct: 388 RNVENLSETNTLKLMRPWDRDYYSSLSPNFTRPNHRVDGFTSINTYFSLGVVMQGISDLF 447

Query: 402 ETV--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFG 459
             +  + LK +    G+TW PDV+KL V    +     +G IY DL  R GK    ++F 
Sbjct: 448 RDIYGISLKPVVAQAGETWAPDVRKLQVISETEGI---IGLIYCDLLERPGKTTSPSHFT 504

Query: 460 ISSSFL---------------KSDGSR-SYPVTALVCNF--SKPTKDKP-ALLKHSELTT 500
           +  S                   DGSR   PV +L+CNF  ++  K+K   LL+ S++ T
Sbjct: 505 VCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSLCLLELSDVET 564

Query: 501 FFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEE 560
            FHE+GH +H ++G   +   +G      DFVE PS ++E +  +++ L  +S +Y T E
Sbjct: 565 LFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKDRRVLLRISSNYATGE 623

Query: 561 KIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEI-CL 619
            IP+ LL +     +         Q+   + D ++H+  D  + ++  +++ L  E+  L
Sbjct: 624 PIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITD--QDDIIAVYHGLEREMEVL 681

Query: 620 IDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDI 679
           +D+   QT     FGH+    Y A YY Y+     A+ ++   F +DP +   G ++++ 
Sbjct: 682 VDD---QTNWCGRFGHLF--GYGASYYSYLMDRAIAAKIWDHLFKKDPFSRSSGEKFKEG 736

Query: 680 ILARGG 685
           +L  GG
Sbjct: 737 VLKWGG 742

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  169 bits (427), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 147/582 (25%), Positives = 270/582 (46%), Gaps = 60/582 (10%)

Query: 145 DIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQF 204
           +I+   L DD    K   E  K  +   +DF +SG+++  E  ++   + ++IS    +F
Sbjct: 176 EILKRVLSDDLIASKLSEEELKVGKILLEDFEKSGIDMAPEVGEQFINLSQQISIVGQEF 235

Query: 205 SKNLG-EQNEFITFTKEEL--IGVSENVMKQFETVDEDGITKYKV-TFKYPDIFPVLKSA 260
             N    ++E++  +  EL   G+S  ++    + D  G   YKV T+ Y   F +L+S 
Sbjct: 236 ISNTDFPKSEYVKVSCNELETSGISPLLLNHL-SRDTKG-QNYKVPTYGYI-AFSILRSC 292

Query: 261 KNAETRKRAFIGDQNKVPQNEALFLETL-QLRNDLAELLNYDSYADYNLDIKMAKKEEAV 319
            +   R + +    +  P+ +   L+ L +LR  LA+++  +SY+DY L+ KMAK    V
Sbjct: 293 PSENIRMKVWTA-VHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYV 351

Query: 320 LTFLNDLKNKLKPXXXXXXXXXXXXXXXXXXXXNTPYDRRYY----IWDNRYYDN--QYL 373
             F+  L   +KP                        D         WD  +Y       
Sbjct: 352 RGFVESLAEAIKPLAMRELRALANLKSSHLDLPIPKTDEEVLKFVRPWDRDFYSTLISLQ 411

Query: 374 KKNFQIDEEKIAEYFPLESTIKGMLQIYETV--LKLKFIEEDNGDTWHPDVKKLSVWKMD 431
           ++   ++ E+I  YF L + ++G+  + E +  ++L+      G+TW P+V++++V    
Sbjct: 412 QQRKTLENEQINSYFSLGTVMQGLSSLLEDIYGIRLEPAVAKVGETWSPEVRRINVVSDQ 471

Query: 432 DNFPSFVGWIYFDLHPREGKYGHAANFGISSSFL----KSDGSR-------------SYP 474
           +     +G +Y DL  R+GK  + A+F +  S      ++D S                P
Sbjct: 472 EGV---IGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLP 528

Query: 475 VTALVCNFSKPTKDKP--ALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFV 532
           V +LVC+FS+ +  K    LL+ SE+ T FHE+GH IH ++G   +   +G      DFV
Sbjct: 529 VISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISGTRCAT-DFV 587

Query: 533 EAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALF-------ALRQ 585
           E PS ++E +  + + L  + KHY T E +PD LL       H+N              Q
Sbjct: 588 ELPSILMEHFAHDSRVLSRIGKHYITNEPVPDELL-------HLNQNELKYLQNTETFSQ 640

Query: 586 LHFGLFDMKVHTTKDIS--KLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSA 643
               + D ++H+ + ++   ++V E+++ + +++ ++   D ++     FGH++   Y A
Sbjct: 641 AKMAMLDQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLT--DDKSNWCGRFGHLL--GYGA 696

Query: 644 GYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGG 685
            YY Y++    AS ++   F  DP +   G ++++ +L  GG
Sbjct: 697 SYYSYLFDRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGG 738

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  167 bits (424), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 142/558 (25%), Positives = 264/558 (47%), Gaps = 65/558 (11%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGE-QNEFITFTKEEL--IGVSENV 229
           +DF +SG+ +    R +   + ++IS     F  N+   ++  +     EL   GV+  +
Sbjct: 204 EDFEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKIKCSELNKSGVNSLL 263

Query: 230 MKQFETVDEDGITKYKVTFKYP--DIFPV--LKSAKNAETRKRAFIGDQNKVPQNEALFL 285
           +KQ     +D   KY   +K P     P+  ++S  +A  R + +    +  P ++   L
Sbjct: 264 LKQLP---KDITGKY---YKIPTSGYIPISLIRSCPDATIRAKVW-ASLHSCPNDQIRRL 316

Query: 286 ETL-QLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXX 344
             L +LR  LA LLN  S+A Y L+ KMAK  + V  F+  L + ++P            
Sbjct: 317 THLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKFMADL 376

Query: 345 XXXXXXXXNT-----------PYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLEST 393
                    +           P+DR YY   +    +  L +N  I+      YF + + 
Sbjct: 377 KCKELNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINM-----YFTMGNI 431

Query: 394 IKGMLQIYETV--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGK 451
           +KG+  I++ +  ++L+ +  + G+TW P+V++L+V    +     +G +Y DL  R GK
Sbjct: 432 MKGLSHIFQRIYGIRLEAVVPEEGETWSPEVRRLNVISETE---GLIGVVYCDLFERAGK 488

Query: 452 YGHAANFGISSSF---------------LKSDGSR-SYPVTALVCNFSKP--TKDKP-AL 492
             + A+F +  S                   DG+    PV +LVCNFS    + DK   L
Sbjct: 489 TSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDKMICL 548

Query: 493 LKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSL 552
           L+ +E+ T FHE+GH +H ++G + +   +G      DFVE PS ++E +  +K+ L  +
Sbjct: 549 LQLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRVLHEI 607

Query: 553 SKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHT---TKDISKLNVTEL 609
             HY+T E++ + ++++ ++            Q    + D ++++    KD+  ++V ++
Sbjct: 608 GFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHVDVVKI 667

Query: 610 WNSLREEI-CLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPL 668
           + +L E++  L+DN   ++     FGH+    Y A YY Y++    AS ++   F +DP 
Sbjct: 668 YQTLEEDLKVLVDN---KSNWCGKFGHLFG--YGASYYSYLFDRAIASKVWDQLFAKDPF 722

Query: 669 NSDVGVQYRDIILARGGL 686
           + + G ++++ +L  GGL
Sbjct: 723 SREGGEKFKNCVLKWGGL 740

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  164 bits (416), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 138/543 (25%), Positives = 249/543 (45%), Gaps = 44/543 (8%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKN---LGEQNEFITFTKEELIGVSENV 229
           +DF +SG+ +  + R++  E+ + IS    +F  N   +G     I     E  GVS+ V
Sbjct: 211 EDFEKSGIYMNPKVRERFIELSQVISIVGQEFITNTEYVGTSFVEIETDVLEASGVSQMV 270

Query: 230 MKQFETVDEDGITKYKV-TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETL 288
           ++Q  + D  G   YK+ T+ Y   + ++++  +   RK+ +       P+ +   L+ L
Sbjct: 271 LQQL-SKDLSG-KFYKIPTYGYLP-YSIIRTCPSEYIRKKVWTA-MYSCPEKQIKRLKKL 326

Query: 289 -QLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXXXXXXXXXXXXX 347
            +LR  LA ++    YA Y L+ KMAK  + V  F+N L    KP               
Sbjct: 327 VRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLADMKHD 386

Query: 348 XXXXXNTPYDRRYYIWDNRYYDNQYL----KKNFQIDEEKIAEYFPLESTIKGMLQIYET 403
                 +        WD  Y+ +  L    +    +  + +  YF L   I+G+  ++++
Sbjct: 387 NHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGLSDLFQS 446

Query: 404 V--LKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGIS 461
           +  ++L+ +    G+TW P+V+K+ V    +     +G IY DL  R+GK  + A+F + 
Sbjct: 447 IYGIRLEPVVAKTGETWDPEVRKIQVISEANG---VIGVIYCDLFERQGKTPNPAHFTVC 503

Query: 462 SSFLKSDGSRSY----------------PVTALVCNFS--KPTKDKPALLKHSELTTFFH 503
            S         Y                PV +LVCNFS  +   D   LL+ SE+ T FH
Sbjct: 504 CSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQLSEVETLFH 563

Query: 504 ELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIP 563
           E+GH +H ++G   +   +G      DFVE PS ++E +  + + L  +S HY T E++P
Sbjct: 564 EMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSHYATGERVP 622

Query: 564 DSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEI-CLIDN 622
             +L +  +            Q+   + D ++H+  D S+ ++  +++ L +E+  L+D+
Sbjct: 623 KEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTDNSE-DIVTVYHGLEKELQVLVDD 681

Query: 623 GDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILA 682
              ++     FGH+    Y A YY Y+     A+ ++   F  DP +   G ++++ +L 
Sbjct: 682 ---RSNWCGRFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEKFKNSVLK 736

Query: 683 RGG 685
            GG
Sbjct: 737 WGG 739

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  163 bits (412), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 140/560 (25%), Positives = 250/560 (44%), Gaps = 74/560 (13%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQ 232
           +DF +SG+ +  E RD+   + + IS     F  N        ++T+++ I +      +
Sbjct: 207 EDFEKSGIQMSPEIRDRFISLSQDISLAGQDFLNN-------TSYTEKDYIKIK---CDE 256

Query: 233 FETVDEDGITKYKVT-------FKYPDI----FPVLKSAKNAETRKRAFIGDQNKVPQNE 281
           F+   +    KYK++       +K P      +  L   K+ E RK+ ++   +   +  
Sbjct: 257 FDKACDYPALKYKLSKDLSGKYYKIPTYGKIPYTALLKCKDEELRKKLWVAFHSCSNKQI 316

Query: 282 ALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPXXXX----- 336
               + ++ R +LA+LL+  SY++Y L+ KMAK  + V  FLN L   + P         
Sbjct: 317 ERLTKIIKHRIELAKLLSKSSYSEYTLEGKMAKGPKEVNNFLNALLKSILPEVTKELEPI 376

Query: 337 ------XXXXXXXXXXXXXXXXNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPL 390
                                   P+DR YY       +  Y        +  I EYF L
Sbjct: 377 SNKKCLSEGFSLETSEQSILNNIKPWDRDYYNPIQATSEGAY--------QMLIMEYFTL 428

Query: 391 ESTIKGMLQIYETVLKLKF--IEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPR 448
            + I G+  ++ ++  ++F   + ++G+TW  DV+KL+V   D+     +G IY DL  R
Sbjct: 429 GNIIHGLSNLFNSIYGIRFEPGKIEDGETWSKDVRKLNVISEDE---GLIGVIYCDLFER 485

Query: 449 EGKYGHAANFGISSSFL-----------------KSDGSRSYPVTALVCNF----SKPTK 487
           EGK    +++ I  S                   K+  +   P+ +LVCNF    +K ++
Sbjct: 486 EGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKTGKNFQLPIVSLVCNFQVTNAKESR 545

Query: 488 DKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKK 547
            +   L+H E+ T FHE+GH +H ++G       +G      DFVE PS ++EF+  N K
Sbjct: 546 -RICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-DFVEIPSILMEFFANNPK 603

Query: 548 ELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHT--TKDISKLN 605
            L  +S+HY + E I   +L+  +       A     Q    L D ++H      +  ++
Sbjct: 604 VLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYSQGKMALLDQRLHAENANSLDNID 663

Query: 606 VTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLE 665
           V E++++L +E+ ++   D ++     FGH+    Y A YY Y++    A+ ++ + F  
Sbjct: 664 VVEIYHNLEKELSVLP--DTESNWCGRFGHLY--GYGALYYCYLFDRAIATKIWESLFQN 719

Query: 666 DPLNSDVGVQYRDIILARGG 685
           DP +   G  +++ +L  GG
Sbjct: 720 DPFSRKGGNIFKEQLLKWGG 739

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  162 bits (411), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 158/630 (25%), Positives = 277/630 (43%), Gaps = 59/630 (9%)

Query: 95  NTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDD 154
           +T+  + +   F++    D E    S +  EL+  F    +   +L      +   L+D+
Sbjct: 149 DTLCRVIDLCEFIRSAHPDDEYLKVSQECYELMFEFMNTLNTDVQLCYTLKHI---LEDE 205

Query: 155 AQFKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEF 214
               K   E YK  +   +DF +SG+ +    R+K  E+ ++IS    +F  N     + 
Sbjct: 206 KICSKLTDEEYKVGKILLEDFEKSGIYMEPNTREKFIELSQEISLVGQEFISNTDYVTKN 265

Query: 215 ITFTKEELIGVSENVMKQFETVDEDGITK-YKVTFKYPDIFPVLKSAKNAETRKRAFIGD 273
                 E + +SE  +     +  D   K YK+    P  + +L +  N   RK+ +   
Sbjct: 266 NILIDRESLNLSELELPFTYQLKTDITGKHYKIPTTGPIPYSILTNCSNETIRKKIWTEL 325

Query: 274 QNKVPQNEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPX 333
            +   +      + + LR  LA+LL   S+A+Y L  KMAK  E V  F++ L +  KP 
Sbjct: 326 HSCSQEQIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFISTLLDFTKPL 385

Query: 334 XXXXXXXXXXXXXXX-----------XXXXNTPYDRRYYIWDNRYYDNQYLKKNFQIDEE 382
                                           P+DR YY   NRY + Q ++     D  
Sbjct: 386 AIKELTSLAEVKAADLGLAFKNDSNFIVNLIRPWDRNYYSKINRYENKQTME-----DLN 440

Query: 383 KIAEYFPLESTIKGMLQIYETVLKLKF------IEEDNGDTWHPDVKKLSVWKMDDNFPS 436
           ++  YF L + I G+  ++  +  ++F      +EE    TW P+V+KL+V    +    
Sbjct: 441 ELPYYFSLGNVIAGLSNLFHNIYGIRFELAVPKLEE----TWLPEVRKLNVISESE---G 493

Query: 437 FVGWIYFDLHPREGKYGHAANFGISSSF--------------LKSDGSR-SYPVTALVCN 481
            +G +Y DL  R  K  +AA+F I  S               + S G+    P+ +L+CN
Sbjct: 494 LIGIVYCDLFERPSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICN 553

Query: 482 FSKP---TKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQM 538
           FSK     ++ P  L+  E+ T FHE+GH +H ++G   +   +G      DFVE PS +
Sbjct: 554 FSKSHLFEENGPCFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSIL 612

Query: 539 LEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTT 598
           +E +  + + ++S+S HY ++E     LL + + +      L    Q    + D  +H+ 
Sbjct: 613 MEHFAKDVRVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLDQILHSN 672

Query: 599 ---KDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFA 655
              +D   +NV + +N L +++ L    D Q+     FGH+    Y A YY Y++    A
Sbjct: 673 EIFEDQKDINVVKSYNDLEKKLELF--SDDQSNWCGKFGHLF--GYGASYYSYLFDRAIA 728

Query: 656 SDMYYTKFLEDPLNSDVGVQYRDIILARGG 685
           S ++ + F ++P +   G++++D +L  GG
Sbjct: 729 SKVWESLFKQNPFSRTSGLKFKDSVLRWGG 758

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  147 bits (371), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 140/559 (25%), Positives = 242/559 (43%), Gaps = 65/559 (11%)

Query: 173 KDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQ 232
           +DF +SG+ +  E R+K  ++ ++IS     F  N             EL+    N M  
Sbjct: 205 EDFEKSGIYMKPEIREKFIQLSQEISVIGQDFINNTEYVRSNYIKISCELMDAHVNKMVC 264

Query: 233 FETVDEDGITKYKV-TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLR 291
            +   +     YKV T+ Y     +L++  +   R + +    +          + + LR
Sbjct: 265 SQMKKDITGEYYKVPTYGYIP-HTLLRTCSDEVIRMKIWTEMHSCSDAQIERLTKLISLR 323

Query: 292 NDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDL--------KNKLKPXXXXXXXXXXX 343
            +LA+LL   ++A Y L  KMAK  E V  FL  L         ++LKP           
Sbjct: 324 VELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASELKPLAVLKSELTGT 383

Query: 344 XXXXXXXXXNTPYDRRYYI-----WDNRYYDN-QYL--KKNFQIDE-EKIAEYFPLESTI 394
                     TP+     +     WD  YY + Q L  +++  +D  E I+  F L   +
Sbjct: 384 ---------QTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSSLDNGESISSSFSLGVVM 434

Query: 395 KGMLQIYETVLKLKFIEE--DNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKY 452
           +G+  ++E +  +K +      G+TW PDV+++ V    D     +G +Y DL  REGK 
Sbjct: 435 QGLSDLFEKIYGIKLVPATPKTGETWSPDVRRIDVV---DEHDGLIGVMYCDLFEREGKT 491

Query: 453 GHAANFGISSS---------------FLKSDGSR-SYPVTALVCNF-------SKPTKDK 489
            + A+F +  S                + S+G +   PV +LVC+F             +
Sbjct: 492 PNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMGDGKHQQ 551

Query: 490 PALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKEL 549
             LL+ +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  + + L
Sbjct: 552 MCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPSILMEHFARDTRVL 610

Query: 550 KSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHT---TKDISKLNV 606
            S+S HY+T + +   +L +               Q+     D ++H    T D S ++V
Sbjct: 611 SSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQELHNLDHTTDGS-IDV 669

Query: 607 TELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLED 666
             +++ L   + ++   D Q+     FGH+    Y A YY Y++    AS ++   F +D
Sbjct: 670 IAIYHRLERRLAVLP--DDQSNWCGKFGHLFG--YGASYYSYLFDRAIASKIWDHLFEQD 725

Query: 667 PLNSDVGVQYRDIILARGG 685
           P N   G ++++ +L  GG
Sbjct: 726 PFNRTNGTKFKEGLLQWGG 744

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 48/116 (41%), Gaps = 30/116 (25%)

Query: 525 SATPWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTK 574
           S  PW    +  Q +  W W N+KEL  L+ H         +QTE+ +  + LD  VR  
Sbjct: 105 SELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVW 164

Query: 575 HINGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDN--GDIQTK 628
            I+G    LR+ H              S   VT   +SL  +  L+D   GD + K
Sbjct: 165 DISG----LRKKH--------------SAPGVTSYEDSLASQQNLLDGAFGDCKVK 202

>Skud_4.409 Chr4 (728373..733340) [4968 bp, 1655 aa] {ON} YDR150W
            (REAL)
          Length = 1655

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 7/75 (9%)

Query: 174  DFLRSGLNL---PEEQRDKVKEIKKKISNNSL---QFSKNLGEQNEFITFTKEELIGVSE 227
            D +R   NL   P E R K++EIK ++++ +    Q  K+ G++NE +T   + L+   +
Sbjct: 1185 DVIREAANLGLVPVE-RQKLEEIKYELAHPTFSKEQLKKHAGDRNELLTSRDKTLLPRDD 1243

Query: 228  NVMKQFETVDEDGIT 242
            N M Q E V +D I+
Sbjct: 1244 NTMSQGEVVYDDNIS 1258

>Skud_4.408 Chr4 (727248..733340) [6093 bp, 2030 aa] {ON} YDR150W
            (REAL)
          Length = 2030

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 7/75 (9%)

Query: 174  DFLRSGLNL---PEEQRDKVKEIKKKISNNSL---QFSKNLGEQNEFITFTKEELIGVSE 227
            D +R   NL   P E R K++EIK ++++ +    Q  K+ G++NE +T   + L+   +
Sbjct: 1560 DVIREAANLGLVPVE-RQKLEEIKYELAHPTFSKEQLKKHAGDRNELLTSRDKTLLPRDD 1618

Query: 228  NVMKQFETVDEDGIT 242
            N M Q E V +D I+
Sbjct: 1619 NTMSQGEVVYDDNIS 1633

>KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1209

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         + TE+ +  + LD  VR   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKRH 173

>Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON}
           YDL145C (COP1) - alpha subunit of the coatamer complex;
           gamma-alpha-COP [contig 161] FULL
          Length = 1210

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         + TE+ +  + LD  VR   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKRH 173

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KEL  L+ H         + TE+ +  + LD  +R   I 
Sbjct: 108 PWIISASDDQTIRIWNWQNRKELACLTGHNHFVMCAQFHPTEDLVVSASLDETIRVWDIA 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKRH 173

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         + TE+ +  + LD  VR   I+
Sbjct: 108 PWLISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRVWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKKH 173

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 14/75 (18%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KEL  ++ H         + TE+ +  + LD  VR   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKELACITGHNHFVMCAQFHPTEDLVVSASLDETVRVWDIS 167

Query: 578 GALFALRQLHFGLFD 592
               ALR+ H    D
Sbjct: 168 ----ALRKKHSAPVD 178

>TPHA0D02450 Chr4 (505488..507056) [1569 bp, 522 aa] {ON} Anc_5.545
           YDR434W
          Length = 522

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 362 IWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGML 398
           + +N ++DN+ +++NF  DE K A YFP    I  +L
Sbjct: 467 VCENAFFDNEMVQQNFFPDEHKTAVYFPFLGPIAMVL 503

>ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         + TE+ +  + LD  +R   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMSAQFHPTEDLVVSASLDETIRVWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKKH 173

>ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL145C
           (COP1)
          Length = 1204

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N++E+  L+ H         + TE+ +  + LD  VR   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKRH 173

>TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7.322
           YDL145C
          Length = 1216

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+ +L  H         + TE+ +  + LD  VR   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKEIANLIGHNHFVMCAQFHPTEDLVVSASLDETVRVWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKKH 173

>KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1212

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         +  E+ +  + LD  VR   I+
Sbjct: 108 PWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKRH 173

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         + T++ I  + LD  +R   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKRH 173

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         + T++ I  + LD  +R   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKRH 173

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 386 EYFPLESTIKGMLQIYETVLKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDL 445
           EY  LE  ++ +  IYE  LK+  I E+    +  +VK+ SV    D F   VG    DL
Sbjct: 66  EYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKE-SV----DEFSKLVGGKLHDL 120

Query: 446 HPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNFSKPTKDK 489
                +   A N  +SS  +K   + +Y ++ +    S+  +D+
Sbjct: 121 SKVTNR-EQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHVEDE 163

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         + T++ I  + LD  +R   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKRH 173

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 32.0 bits (71), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         + T++ I  + LD  +R   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKRH 173

>NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON}
           Anc_7.322
          Length = 1205

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 528 PWDFVEAPSQMLEFWTW-NKKELKSLSKH---------YQTEEKIPDSLLDSLVRTKHIN 577
           PW    +  Q +  W W N+KE+  L+ H         + T++ +  + LD  +R   I+
Sbjct: 108 PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDIS 167

Query: 578 GALFALRQLH 587
           G    LR+ H
Sbjct: 168 G----LRKKH 173

>KAFR0B04950 Chr2 complement(1027783..1029645) [1863 bp, 620 aa]
           {ON} Anc_2.363 YMR155W
          Length = 620

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 600 DISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMY 659
           D SKL++    N+L    C +  G      F +F  I++DS+    Y  +W+      ++
Sbjct: 478 DGSKLHMMANVNNL--SFCSVIFGYAFGVMFGTFPSIIADSFGTEEYSTIWSLCTTGGLF 535

Query: 660 YTKFLEDPLNSDVG 673
             KF    L SD+G
Sbjct: 536 TVKFFTSVLASDIG 549

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,247,206
Number of extensions: 3704772
Number of successful extensions: 12180
Number of sequences better than 10.0: 119
Number of HSP's gapped: 12414
Number of HSP's successfully gapped: 125
Length of query: 712
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 595
Effective length of database: 40,065,477
Effective search space: 23838958815
Effective search space used: 23838958815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)