Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00550g1.8ON82824119e-54
SAKL0C00528g1.8ON110823304e-41
KLTH0F00550g1.8ON82823042e-37
AFR743W1.8ON82822981e-36
YCL057C-A (MOS1)1.8ON97932913e-35
Ecym_10101.8ON82822894e-35
Skud_3.61.8ON97772896e-35
Kwal_33.130161.8ON82822808e-34
Smik_3.171.8ON97932801e-33
Kpol_2002.111.8ON86832782e-33
Suva_3.1551.8ON97942782e-33
ZYRO0F18414g1.8ON87702712e-32
CAGL0B00396g1.8ON88702703e-32
TBLA0A049601.8ON96672688e-32
TPHA0E039801.8ON86822661e-31
NCAS0B090801.8ON93662627e-31
TDEL0C069401.8ON86862364e-27
NDAI0A001701.8ON96952341e-26
KAFR0D001701.8ON90682244e-25
KNAG0C002501.8ON94732192e-24
SAKL0C10230g3.119ON97147640.81
KLTH0F01012g1.27ON26338640.88
KLLA0C02783g1.104ON79843612.0
KLLA0F03751g2.263ON68343612.7
NCAS0A052701.537ON57726603.5
Smik_15.2315.655ON65362603.6
KLTH0G09856g2.263ON69034593.9
YOR054C (VHS3)5.655ON67462594.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00550g
         (82 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   162   9e-54
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   131   4e-41
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   121   2e-37
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   119   1e-36
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   116   3e-35
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   115   4e-35
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   115   6e-35
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   112   8e-34
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   112   1e-33
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   111   2e-33
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   111   2e-33
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   108   2e-32
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   108   3e-32
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   107   8e-32
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   107   1e-31
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   105   7e-31
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...    96   4e-27
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...    95   1e-26
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...    91   4e-25
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...    89   2e-24
SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} simila...    29   0.81 
KLTH0F01012g Chr6 complement(79475..80266) [792 bp, 263 aa] {ON}...    29   0.88 
KLLA0C02783g Chr3 (250633..253029) [2397 bp, 798 aa] {ON} simila...    28   2.0  
KLLA0F03751g Chr6 (355439..357490) [2052 bp, 683 aa] {ON} simila...    28   2.7  
NCAS0A05270 Chr1 (1042604..1044337) [1734 bp, 577 aa] {ON}             28   3.5  
Smik_15.231 Chr15 complement(394040..396001) [1962 bp, 653 aa] {...    28   3.6  
KLTH0G09856g Chr7 (830050..832122) [2073 bp, 690 aa] {ON} simila...    27   3.9  
YOR054C Chr15 complement(427833..429857) [2025 bp, 674 aa] {ON} ...    27   4.8  

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  162 bits (411), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 82/82 (100%), Positives = 82/82 (100%)

Query: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60
          MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL
Sbjct: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60

Query: 61 GRGYAEGDAIFRTNAGLRKVNA 82
          GRGYAEGDAIFRTNAGLRKVNA
Sbjct: 61 GRGYAEGDAIFRTNAGLRKVNA 82

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  131 bits (330), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (86%)

Query: 1   MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60
           MSEQ+Q +K   SIL+ +WDVVLSNVV KT LG G GIVASVL FKRRAFPVW+GVGFGL
Sbjct: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88

Query: 61  GRGYAEGDAIFRTNAGLRKVNA 82
           GRGYAEGDAIFR++AGLR VNA
Sbjct: 89  GRGYAEGDAIFRSSAGLRTVNA 110

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  121 bits (304), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 58/82 (70%), Positives = 69/82 (84%)

Query: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60
          MSEQ++ +    S+L+ +WDVVLSN+V KT LG G G+VASVL FKRRAFPVW+GVGFGL
Sbjct: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60

Query: 61 GRGYAEGDAIFRTNAGLRKVNA 82
          GRGYAEGDAIFR++AGLR V A
Sbjct: 61 GRGYAEGDAIFRSSAGLRTVKA 82

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  119 bits (298), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 58/82 (70%), Positives = 68/82 (82%)

Query: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60
          MS Q++ +    SIL+ +WDVVLSN+V KT LG G G+ ASVLFFKRRAFPVW+GVGFGL
Sbjct: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60

Query: 61 GRGYAEGDAIFRTNAGLRKVNA 82
          GRGYAEGDAIFR++AGLR V A
Sbjct: 61 GRGYAEGDAIFRSHAGLRAVRA 82

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  116 bits (291), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 15/93 (16%)

Query: 1  MSEQVQT---TKAVPS------------ILDKRWDVVLSNVVAKTALGAGVGIVASVLFF 45
          MSEQ QT    K+ PS            ILD +WD+VLSN++ KTA+G GVG+  SVLFF
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 46 KRRAFPVWVGVGFGLGRGYAEGDAIFRTNAGLR 78
          KRRAFPVW+G+GFG+GRGYAEGDAIFR++AGLR
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLR 93

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  115 bits (289), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 67/82 (81%)

Query: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60
          M E+++      SIL+ +WDVVLSN+V K  LG  VG++ASVLFFKRRAFPVW+G+GFGL
Sbjct: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60

Query: 61 GRGYAEGDAIFRTNAGLRKVNA 82
          GRGYAEGDAIFR++AGLR + A
Sbjct: 61 GRGYAEGDAIFRSHAGLRTMKA 82

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  115 bits (289), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 50/77 (64%), Positives = 67/77 (87%)

Query: 2  SEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLG 61
          ++ ++   AV +ILD +WD+V+SN++ KTA+G GVG+  SVLFFKRRAFPVW+G+GFG+G
Sbjct: 17 NDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVG 76

Query: 62 RGYAEGDAIFRTNAGLR 78
          RGYAEGDAIFR++AGLR
Sbjct: 77 RGYAEGDAIFRSSAGLR 93

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  112 bits (280), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 65/82 (79%)

Query: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60
          MS+Q +      S+L+ +WDVVLSN+V K  LG G G+VASVL FKRRA PVW+GVGFGL
Sbjct: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60

Query: 61 GRGYAEGDAIFRTNAGLRKVNA 82
          GRGY+EGDAIFR++AGLR V A
Sbjct: 61 GRGYSEGDAIFRSSAGLRTVKA 82

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  112 bits (280), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 15/93 (16%)

Query: 1  MSEQVQT---TKAVPS------------ILDKRWDVVLSNVVAKTALGAGVGIVASVLFF 45
          MSEQ Q     K  PS            +LD +WD+VLSN++ KTA+G GVG+  SVLFF
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 46 KRRAFPVWVGVGFGLGRGYAEGDAIFRTNAGLR 78
          KRRAFPVW+G+GFG+GRGYAEGDAIFR++AGLR
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLR 93

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  111 bits (278), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 67/83 (80%), Gaps = 4/83 (4%)

Query: 1  MSEQVQ----TTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGV 56
          MS+Q Q    T+    SIL+ +WDVVLSN + KT+LG G G++ASV+ FKRRAFPVW+G+
Sbjct: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60

Query: 57 GFGLGRGYAEGDAIFRTNAGLRK 79
          GFG+GRGY+EGDAIFR+ AGLRK
Sbjct: 61 GFGIGRGYSEGDAIFRSAAGLRK 83

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  111 bits (278), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 15/94 (15%)

Query: 1  MSEQVQT---TKAVPS------------ILDKRWDVVLSNVVAKTALGAGVGIVASVLFF 45
          MSEQ Q     K+ PS            +LD +WD+VLSN++ KTA+G G+G+  SVLFF
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 46 KRRAFPVWVGVGFGLGRGYAEGDAIFRTNAGLRK 79
          KRRAFP W+G+GFG+GRGYAEGDAIFR++AGLR 
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRS 94

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  108 bits (271), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%)

Query: 13 SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAIFR 72
          SIL+ +WDVVLSN++ K+ LG GVG+VASVL FKRRAFPVW+G+GFGLGRGYAEGDAIFR
Sbjct: 18 SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAIFR 77

Query: 73 TNAGLRKVNA 82
          + AGLR   A
Sbjct: 78 SAAGLRTSKA 87

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  108 bits (270), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 51/70 (72%), Positives = 60/70 (85%)

Query: 11 VPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAI 70
          V SIL+ +WDVVLSN++ K  LG GVG+V SVLFFKRR+FPVW+GVGFG GRGY+EGDAI
Sbjct: 17 VRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDAI 76

Query: 71 FRTNAGLRKV 80
          FR+ AGLR V
Sbjct: 77 FRSTAGLRSV 86

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  107 bits (268), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%)

Query: 13 SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAIFR 72
          SIL+ +WD+V+SN++ KT  G G G++ASV+FFKRRAFPVW+GVGFGLGRGY+EGDAIFR
Sbjct: 27 SILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAIFR 86

Query: 73 TNAGLRK 79
          + AGLR 
Sbjct: 87 STAGLRS 93

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  107 bits (266), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 4/82 (4%)

Query: 1  MSEQVQTTK----AVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGV 56
          MSEQ         +  SIL+ +WDVVLSN++ KT LG GVG+V S+L FKRRAFPVW+G+
Sbjct: 1  MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGI 60

Query: 57 GFGLGRGYAEGDAIFRTNAGLR 78
          GFG+GRGY++GDAIFR+ AGLR
Sbjct: 61 GFGVGRGYSDGDAIFRSAAGLR 82

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  105 bits (262), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 48/66 (72%), Positives = 58/66 (87%)

Query: 13 SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAIFR 72
          SIL+ +WDVVLSN++ K  LG  VG+VASV+FFKRR FPVW+G+GFG+GRGYAEGDAIFR
Sbjct: 24 SILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAIFR 83

Query: 73 TNAGLR 78
          + AGLR
Sbjct: 84 SPAGLR 89

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score = 95.5 bits (236), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/86 (70%), Positives = 69/86 (80%), Gaps = 4/86 (4%)

Query: 1  MSE--QVQTTKAVPS--ILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGV 56
          MSE  Q Q   A PS  IL+ +WDVVLSN++ KT LG GVG+V SVLFFKRRAFPVW+G+
Sbjct: 1  MSEKSQAQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGI 60

Query: 57 GFGLGRGYAEGDAIFRTNAGLRKVNA 82
          GFGLGRGYAEGDAIFR+ AGLR V A
Sbjct: 61 GFGLGRGYAEGDAIFRSAAGLRSVKA 86

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 94.7 bits (234), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/95 (58%), Positives = 68/95 (71%), Gaps = 14/95 (14%)

Query: 1  MSEQVQTTK-----AVP---------SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFK 46
          MSEQV  T+     A P         SIL+ +WD+VLSN + K  LG GVG+V SV+FFK
Sbjct: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFK 60

Query: 47 RRAFPVWVGVGFGLGRGYAEGDAIFRTNAGLRKVN 81
          RR FPVW+G+GFG GRGYAEGDAIFR++AG+R VN
Sbjct: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVN 95

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 90.9 bits (224), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (86%)

Query: 13 SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAIFR 72
          SIL+ +WD+VLSN++ K  LG GVG+V SV+FFKRRAFPVW+G+G+G GR Y+EGDAIFR
Sbjct: 21 SILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPVWLGIGYGFGRAYSEGDAIFR 80

Query: 73 TNAGLRKV 80
          +NAGLR V
Sbjct: 81 SNAGLRSV 88

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score = 89.0 bits (219), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (83%)

Query: 8  TKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEG 67
          TK   S+L+ +WDVVLSN++ K  +G GVG+V SVL F+RRAFPVW+G+GFG+GRGY+EG
Sbjct: 20 TKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVGRGYSEG 79

Query: 68 DAIFRTNAGLRKV 80
          DAIFR+ +G+R V
Sbjct: 80 DAIFRSTSGIRTV 92

>SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} similar
           to uniprot|Q12252 Saccharomyces cerevisiae YOL084W PHM7
           Protein of unknown function expression is regulated by
           phosphate levels green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery and vacuole
          Length = 971

 Score = 29.3 bits (64), Expect = 0.81,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 37  GIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAIFRTNA---GLRKV 80
           G VA+ L+FKRR  P++  V     R YA G+  F   A   GLR++
Sbjct: 680 GTVAAHLYFKRRFIPLFDAVPLSAIR-YARGEPTFLYPARDQGLREI 725

>KLTH0F01012g Chr6 complement(79475..80266) [792 bp, 263 aa] {ON}
           similar to uniprot|P25576 Saccharomyces cerevisiae
           YCL047C Hypothetical ORF
          Length = 263

 Score = 29.3 bits (64), Expect = 0.88,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 12  PSILDKRWDV--VLSNVVAKTALGAGVGIVASVLFFKR 47
           P+ LDKR D+  +++++++K +L   VGI     FF++
Sbjct: 87  PASLDKRMDMMCIMADLLSKNSLPVSVGITKYAKFFEK 124

>KLLA0C02783g Chr3 (250633..253029) [2397 bp, 798 aa] {ON} similar
           to uniprot|P53848 Saccharomyces cerevisiae YNL256W FOL1
           Multifunctional enzyme of the folic acid biosynthesis
           pathway has dihydropteroate synthetase
           dihydro-6-hydroxymethylpterin pyrophosphokinase and
           dihydroneopterin aldolase activities
          Length = 798

 Score = 28.1 bits (61), Expect = 2.0,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 10/43 (23%)

Query: 5   VQTTKAVPSILDKRWDVVLS-----NVVAKTALGAGVGIVASV 42
           V T+K++P  LDK   VV+S     +VVA+ A+ AGVGI+  +
Sbjct: 568 VTTSKSIP--LDK---VVISIDTYRSVVAEAAISAGVGIINDI 605

>KLLA0F03751g Chr6 (355439..357490) [2052 bp, 683 aa] {ON} similar
           to uniprot|P40483 Saccharomyces cerevisiae YIL108W
           Hypothetical ORF
          Length = 683

 Score = 28.1 bits (61), Expect = 2.7,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 20/43 (46%)

Query: 2   SEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLF 44
           ++   T++A    +D  WD  L  + A  ALG G   +   +F
Sbjct: 220 NDNYNTSQAAVMFMDSHWDKKLKLITAHAALGGGTNKIKLAIF 262

>NCAS0A05270 Chr1 (1042604..1044337) [1734 bp, 577 aa] {ON} 
          Length = 577

 Score = 27.7 bits (60), Expect = 3.5,   Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 18/26 (69%), Gaps = 5/26 (19%)

Query: 32  LGAGVGIVASVLFFKRRAFPVWVGVG 57
           +G G+G+V +++     AF VW+G+G
Sbjct: 387 IGTGIGVVVAII-----AFGVWIGIG 407

>Smik_15.231 Chr15 complement(394040..396001) [1962 bp, 653 aa] {ON}
           YOR054C (REAL)
          Length = 653

 Score = 27.7 bits (60), Expect = 3.6,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 6   QTTKAVPSILDKRWDVVL------SNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFG 59
           Q T  V  I  +RW  +L      +N +AK ALG    ++ SV+      FP+++    G
Sbjct: 453 QRTDPVLHIELRRWADILVVAPLTANTLAKIALGLCDNLLTSVIRAWNPTFPIFLAPSMG 512

Query: 60  LG 61
            G
Sbjct: 513 SG 514

>KLTH0G09856g Chr7 (830050..832122) [2073 bp, 690 aa] {ON} similar
           to uniprot|P40483 Saccharomyces cerevisiae YIL108W
           Hypothetical ORF
          Length = 690

 Score = 27.3 bits (59), Expect = 3.9,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 2   SEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAG 35
           S   +  +A   ILD  WD  L+ + A  ALG G
Sbjct: 222 SSSERPVQAAVMILDAHWDAKLNLITAHAALGGG 255

>YOR054C Chr15 complement(427833..429857) [2025 bp, 674 aa] {ON}
           VHS3Negative regulatory subunit of protein phosphatase 1
           Ppz1p and also a subunit of the
           phosphopantothenoylcysteine decarboxylase (PPCDC; Cab3p,
           Sis2p, Vhs3p) complex, which catalyzes the third step of
           coenzyme A biosynthesis
          Length = 674

 Score = 27.3 bits (59), Expect = 4.8,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 6   QTTKAVPSILDKRWDVVL------SNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFG 59
           Q T  V  I  +RW  +L      +N +AK ALG    ++ SV+      FP+++    G
Sbjct: 452 QRTDPVLHIELRRWADILVVAPLTANTLAKIALGLCDNLLTSVIRAWNPTFPIFLAPSMG 511

Query: 60  LG 61
            G
Sbjct: 512 SG 513

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,127,686
Number of extensions: 219705
Number of successful extensions: 484
Number of sequences better than 10.0: 30
Number of HSP's gapped: 484
Number of HSP's successfully gapped: 30
Length of query: 82
Length of database: 53,481,399
Length adjustment: 54
Effective length of query: 28
Effective length of database: 47,289,435
Effective search space: 1324104180
Effective search space used: 1324104180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)