Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00528g1.7ON1161163093e-37
NOTE: 18 genes in the same pillar as KLLA0C00528g were not hit in these BLAST results
LIST: Kpol_2002.10 ZYRO0F18436g Skud_3.5 Smik_3.16 YCL058W-A NCAS0B09090 TBLA0A04950 KAFR0D00160 Suva_3.154 KLTH0F00528g AFR743CA Kwal_YGOB_YCL058W-A TDEL0C06950 KNAG0C00240 TPHA0E03990 NDAI0A00160 CAGL0B00374g SAKL0C00506g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00528g
         (116 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...   123   3e-37

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score =  123 bits (309), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 69/116 (59%)

Query: 1   MAKKQDNARSRKNGNSSFNHSDXXXXXXXXXXXXXXXXXXXXXXQVRQLDKLDLSIADIV 60
           MAKKQDNARSRKNGNSSFNHSD                      QVRQLDKLDLSIADIV
Sbjct: 1   MAKKQDNARSRKNGNSSFNHSDNKISKKHSMKNNMKSNKKKNQMQVRQLDKLDLSIADIV 60

Query: 61  PNKAQKKPRSSASLEGQKVRXXXXXXXXXXXXXXXXXXXXXXXXXDQLELISGFSL 116
           PNKAQKKPRSSASLEGQKVR                         DQLELISGFSL
Sbjct: 61  PNKAQKKPRSSASLEGQKVREHYKEDKEVVKKHDKEKKATEKKIEDQLELISGFSL 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.124    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,516,934
Number of extensions: 111709
Number of successful extensions: 220
Number of sequences better than 10.0: 1
Number of HSP's gapped: 218
Number of HSP's successfully gapped: 1
Length of query: 116
Length of database: 53,481,399
Length adjustment: 86
Effective length of query: 30
Effective length of database: 43,620,123
Effective search space: 1308603690
Effective search space used: 1308603690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)