Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00506g1.6ON33033015750.0
SAKL0C00484g1.6ON33932513980.0
NDAI0A001501.6ON31731013830.0
NCAS0B091001.6ON32731013730.0
Ecym_10091.6ON33630913720.0
TPHA0E040001.6ON31631013560.0
CAGL0B00352g1.6ON33731013570.0
Kpol_2002.91.6ON33831013490.0
Kwal_33.130111.6ON33431113380.0
KNAG0C002301.6ON34931013380.0
Smik_3.151.6ON31631113190.0
YCL059C (KRR1)1.6ON31631113190.0
AFR744W1.6ON34330913170.0
Suva_3.1531.6ON31631113120.0
Skud_3.41.6ON31631113090.0
ZYRO0F18458g1.6ON31431012941e-180
TDEL0C069601.6ON35031012951e-180
KLTH0F00506g1.6ON33231112801e-178
TBLA0A049401.6ON31631012401e-172
KAFR0D001501.6ON34430712301e-170
Kpol_543.135.482ON2681461004e-04
SAKL0G03740g5.482ON2661551004e-04
TDEL0A034605.482ON272146996e-04
ZYRO0D11440g5.482ON269155996e-04
Suva_8.1975.482ON274148996e-04
Ecym_45525.482ON271146996e-04
KLTH0G02574g5.482ON271146988e-04
Kwal_47.188645.482ON271155988e-04
NCAS0A119605.482ON270155960.001
Skud_15.3105.482ON276157950.002
KLLA0C06446g5.482ON274146940.002
TPHA0J028205.482ON268155940.002
YOR145C (PNO1)5.482ON274157940.002
AFR390C5.482ON311155930.004
Smik_15.3265.482ON274157930.004
KAFR0E036005.482ON276155920.005
CAGL0K09460g5.482ON261155910.005
NDAI0A043105.482ON274155910.006
KNAG0C046105.482ON277146890.009
TBLA0D018905.482ON271146870.020
AAR002W1.420ON178172800.082
KLLA0D02398g1.290ON120583731.5
AGL183C8.309ON50724703.1
TBLA0H018305.375ON40664703.2
KAFR0B030308.309ON46724703.3
KLTH0E14014g8.798ON48699694.3
KNAG0G023508.309ON49724676.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00506g
         (330 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   611   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   543   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   537   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   533   0.0  
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   533   0.0  
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   526   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   527   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   524   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   520   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   520   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   512   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   512   0.0  
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   511   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   509   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   508   0.0  
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   503   e-180
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   503   e-180
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   497   e-178
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   482   e-172
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   478   e-170
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    43   4e-04
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    43   4e-04
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    43   6e-04
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    43   6e-04
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    43   6e-04
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    43   6e-04
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    42   8e-04
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    42   8e-04
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    42   0.001
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    41   0.002
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    41   0.002
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    41   0.002
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    41   0.002
AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON} ...    40   0.004
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    40   0.004
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    40   0.005
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    40   0.005
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    40   0.006
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    39   0.009
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    38   0.020
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    35   0.082
KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] ...    33   1.5  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   3.1  
TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {O...    32   3.2  
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   3.3  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    31   4.3  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    30   6.1  

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/330 (91%), Positives = 301/330 (91%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAKD 300
                YTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAKD
Sbjct: 241 KEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAKD 300

Query: 301 FIAPKETDYXXXXXXXXXXXLGDRKRQRTD 330
           FIAPKETDY           LGDRKRQRTD
Sbjct: 301 FIAPKETDYKSSISKSTKSSLGDRKRQRTD 330

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/325 (81%), Positives = 280/325 (86%), Gaps = 2/325 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           M STHNKDKPWDT E+DKW IEEFKPEDN SGLPFAEESSFMTLFPKYREAYLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD HHIAC L+LVEGSM+VKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXX--XXXXXXX 238
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 239 XXXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298
                  YTPFPPAQLPRKVDLEIESGEYFLSK+EKEVKKL ERR++QA K A+KE ERA
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 299 KDFIAPKETDYXXXXXXXXXXXLGD 323
           KD++AP+E +Y            GD
Sbjct: 301 KDYVAPEEAEYKSTLKKRSKDNDGD 325

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/310 (83%), Positives = 277/310 (89%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHN+DKPWDT+E++KW IEEFKPEDN SGLPFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+L+ H++AC L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKKPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXX-YTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPPAQLPRKVDLEIESGEYFLSKREKE+KKL+ERREQQA K  EKE+ER K
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 300 DFIAPKETDY 309
           D++AP E  Y
Sbjct: 301 DYVAPSEPTY 310

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/310 (83%), Positives = 277/310 (89%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHN+DKPWDT +VDKW+IEEFKPEDN SGLPFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+L+ H++ C L+LVEGSMTVKTTRKT+DPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP++GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXX-YTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPPAQLPRKVDLEIESGEYFLSKREKE+KKLHERREQQA K AEKE ER K
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 300 DFIAPKETDY 309
           ++IAP+E  Y
Sbjct: 301 NYIAPEEETY 310

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/309 (82%), Positives = 271/309 (87%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHNKDKPWDT ++DKW IEEFKPEDN SGLPFAEESSFMTLFPKYREAYLKS W DV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD HH+ACELNLVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           VACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFKKRNIARKKPKKI 240

Query: 241 XXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAKD 300
                YTPFPPAQLPRKVDLEIE+GEYFLSK EK++KKL E R +Q  K  EK  ERA+D
Sbjct: 241 KEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAED 300

Query: 301 FIAPKETDY 309
           +IAP E +Y
Sbjct: 301 YIAPDEKEY 309

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/310 (80%), Positives = 277/310 (89%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHNK+KPWDT+++DKW +E+FKPEDN SG+PF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           T++LD HH+AC LNLV+GSMTV TTRKTYDP +ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXX-XXXXXXXXXX 239
           KE+RRVVED M+NVHPIYHIKELMIKRELAKKPELA EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 240 XXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPP+QLPRKVDLEIESGEYFLSK+EKEVK+LHERR+QQA K AEK+ ER+K
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 300 DFIAPKETDY 309
           ++IAPKE  Y
Sbjct: 301 NYIAPKEEKY 310

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/310 (80%), Positives = 274/310 (88%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVST+NKDKPWDT+++DKW IEEFKPEDNKSG PFAEESSFMTLFPKYREAYLKS+W DV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD HHI C L+LVEGSMTVKTTRKT+DPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVV DCMKNVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 240 XXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPPAQLPRKVDL+IESGEYFLSK+EKE+KKLHE+RE+QA K   K+ ER K
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 300 DFIAPKETDY 309
           D+IAPKE +Y
Sbjct: 301 DYIAPKEDEY 310

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/310 (80%), Positives = 273/310 (88%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHNKDKPWDT+++DKW +EEFKPEDN SGLPFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           T++LD  HIAC L+LVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KILEDD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXX-XXXXXXXXXX 239
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 240 XXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPPAQ PRKVDLEIESGEYFLSK+EKEVK+L ERRE+Q+ K  EKE ER+K
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 300 DFIAPKETDY 309
           D++AP E +Y
Sbjct: 301 DYVAPMEEEY 310

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/311 (80%), Positives = 272/311 (87%), Gaps = 2/311 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           M STHNKDKPWDT ++DKW IEEFKPEDN SGLPF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+L+ H I+C L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+P+LAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 239 XXXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298
                  YTPFPP Q PRKVDL+IESGEYFLSK+EKE KKL ER+++QA K  EK+ ERA
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 299 KDFIAPKETDY 309
           KD++AP E +Y
Sbjct: 301 KDYVAPSEKEY 311

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/310 (80%), Positives = 270/310 (87%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHNKDKPWDTD++DKW+IEEFKPEDN SG PFAEESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           T++LD+HHIAC L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL++D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXX-XXXXXXXX 239
           KE+RRVVEDCM NVHPIYHIKELMIKRELAKKPELA EDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPPAQLPRKVDLEIESGEYFL+K+EK+ KKL ER+E QA K   K+ ER K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 300 DFIAPKETDY 309
           D+ APKE  Y
Sbjct: 301 DYTAPKEKAY 310

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/311 (80%), Positives = 274/311 (88%), Gaps = 2/311 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHN+DKPWDTD++DKW IEEFK EDN SG PFAEESSFMTLFPKYRE+YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD H+IAC L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298
                  YTPFPPAQLPRKVDLEIESGEYFLSKREK++KKL E++E+Q  +  E++ ERA
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 299 KDFIAPKETDY 309
           KDFIAP+E  Y
Sbjct: 301 KDFIAPEEETY 311

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/311 (80%), Positives = 275/311 (88%), Gaps = 2/311 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHN+DKPWDTD++DKW IEEFK EDN SG PFAEESSFMTLFPKYRE+YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD H+IAC L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298
                  YTPFPPAQLPRKVDLEIESGEYFLSKREK++KKL+E++E+Q  +  E++ ERA
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 299 KDFIAPKETDY 309
           KDFIAP+E  Y
Sbjct: 301 KDFIAPEEEAY 311

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/309 (81%), Positives = 272/309 (88%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVST NKDKPWDT +VDKW IEEF PED+ SGLPFAEESSFMTLFPKYRE YLKS+WK+V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+L+ HHIACELNLVEGSM+VKTTRKTYDPA+ILKARDLIKLLARSVP PQA+KIL+DD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+PELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAKD 300
                YTPFPPAQLPRKVDLEIE+GEYFLSK+EKE KKL  RR QQA K +EKE ERAKD
Sbjct: 241 KEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAKD 300

Query: 301 FIAPKETDY 309
           +IAP E +Y
Sbjct: 301 YIAPAEPEY 309

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/311 (79%), Positives = 274/311 (88%), Gaps = 2/311 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHN+DKPWDTD+VDKW IEEFK EDN SG PFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD H+I+C L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298
                  YTPFPPAQLPRKVDLEIESGEYFLSKREK++KKL+E++E+Q  +  E++ ERA
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 299 KDFIAPKETDY 309
           K+F+AP+E  Y
Sbjct: 301 KNFVAPQEEAY 311

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/311 (79%), Positives = 273/311 (87%), Gaps = 2/311 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHN++KPWDTD++DKW IEEFK EDN SG PFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD H+IAC L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298
                  YTPFPPAQLPRKVDLEIESGEYFLSKR+K+VKKL+E++E+Q  +  E++ ERA
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 299 KDFIAPKETDY 309
           KDF AP+E  Y
Sbjct: 301 KDFTAPEEESY 311

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  503 bits (1294), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 244/310 (78%), Positives = 265/310 (85%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHNKDKPWDT E+DKW+ +EFK EDN SGLPFAEESSFMTLFPKYREAYLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           T++L+ +H+AC L+LVEGSMTVKTTRKT DPA+ILKARDLIKLLARSVPFPQAVKILED+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
            ACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG YKGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED MKN+HPIYHIKELMIKRELAK+PELA EDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 240 XXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPPAQ PRKVDLEIESGEYFL+KREKE KKL ERRE+QA K  E++ ER K
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 300 DFIAPKETDY 309
           DF+ PKE DY
Sbjct: 301 DFLPPKEEDY 310

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  503 bits (1295), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 249/310 (80%), Positives = 272/310 (87%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHN+DKPWDT+++DKW +EEFKPEDN SGLPFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+L+AHHIAC L+L+EGSMTVKTTRKT+DPA+IL+ARDLIKLLARSVPF QAVKILE+D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           VACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED M+NVHPIY IKELMIKRELAK+PELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPPAQ PRK+DLEIESGEYFLSK+EKE+ KL ERRE+QA K  EKE  R+K
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 300 DFIAPKETDY 309
           D+IAPKE  Y
Sbjct: 301 DYIAPKEDVY 310

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  497 bits (1280), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 248/311 (79%), Positives = 270/311 (86%), Gaps = 2/311 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           M STHNKDKPWDT ++DKW IEEFKPEDN SG+PFAEESSFMTLFPKYREAYLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD H+IAC L+LVEGSMTVKTTR+TYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
            ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+P+LAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 239 XXXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298
                  YTPFPPAQ PRK+DL+IESGEYFL+K+EKE KKL ER+ +QA K  EK  ERA
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 299 KDFIAPKETDY 309
           KD++AP E  Y
Sbjct: 301 KDYVAPIEKGY 311

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  482 bits (1240), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 245/310 (79%), Positives = 270/310 (87%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVSTHN+DKPWDT +++KW I+EFKPEDN SGLPF EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           T+SLD +H+AC L+L+EGSMTVKTTRKTYDPA+ILKARDLIKLLARSVP+PQA++IL+DD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXX-XXXXXXXXXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+K+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 240 XXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPPAQLPRKVDLEIESGEYFLSK+EKE+KKL ERRE+Q  K  EKE ER K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 300 DFIAPKETDY 309
           DFIAP E +Y
Sbjct: 301 DFIAPSEKEY 310

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  478 bits (1230), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 253/307 (82%), Positives = 273/307 (88%), Gaps = 1/307 (0%)

Query: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60
           MVST+NK+KPWDT+++DKW  EEFKPEDN SGLPFAEESSFMTLFPKYRE+YLKSVWKDV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120
           T++L+ HHIAC L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQA+KILED+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFXX-XXXXXXXXXX 239
           KEVRRVVEDCM NVHPIYHIKELMIKRELAKKPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299
                 YTPFPP QLPRKVDLEIESGEYFLSK+EKEVKKL ER+E+QA K  EKE ER K
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERKK 300

Query: 300 DFIAPKE 306
           ++IAPKE
Sbjct: 301 NYIAPKE 307

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
             I++  + + ++G +  ++  R  V   +    P
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 248

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKT-TRKTYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ +++  R+T DP  + K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
             I++    + ++G +  ++  R  V   +    P
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAVVSLILGSPP 251

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLI 101
           + P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPYKGLKEVRRVV 187
           T+  I++  + + ++G +  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
             I++  + + ++G +  ++  R  V   +    P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 253

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 98  PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 157

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 158 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 217

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
             I++    + ++G +  ++  R  V   +    P
Sbjct: 218 TRIVLADTKIHILGGFTHIRMAREAVVSLILGSPP 252

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 69/157 (43%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLI 101
           + P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
           T+  I++  + + ++G +  ++  R  V   +    P
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 258

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   LK+ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVSNKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
             I++    + ++G +  ++  R  V   +    P
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAVVSLILGSPP 250

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 69/157 (43%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLI 101
           + P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
           T+  I++  + + ++G +  ++  R  V   +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR145C
           (PNO1)
          Length = 311

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKT-TRKTYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  R T DP  + K  D IK 
Sbjct: 139 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPRHTTDPGALQKGADFIKA 198

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + + +   +   R+ G +G +  A+E  T+
Sbjct: 199 FTLGFDLDDSISLLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKSKFAIENATR 258

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
             I++  + + ++G +  ++  R  V   +    P
Sbjct: 259 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 293

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 69/157 (43%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLI 101
           + P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
           T+  I++  + + ++G +  ++  R  V   +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 68/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
             I++  + + ++G +  ++  R  V   +    P
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 258

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 68/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
             I++  + + ++G +  ++  R  V   +    P
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 243

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHP 196
             I++    + ++G +  ++  R  V   +    P
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESVVSLILGSPP 256

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 105 PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 164

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  + + +   +   R+ G +G T  A+E  T+
Sbjct: 165 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 224

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 225 TRIVLADSKIHILGGFTHIRMARESV 250

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWKDVTRSLDAH-HIACELNLVEGSMTVKTTRK-TYDPAVILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 35.4 bits (80), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 69/172 (40%), Gaps = 37/172 (21%)

Query: 54  KSVWKDVTRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQA 113
           ++VW +V R+L     A    L  GS +V            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILEDDVACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SVMGPYKGLKEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRF 223
              G YK L  +      CM  V  I HI ++  + + A+ P+  E+D S  
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQ--EQDLSEL 140

>KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] {ON}
            similar to uniprot|P06105 Saccharomyces cerevisiae
            YJL080C SCP160 May be required during cell division for
            faithful partitioning of the ER-nuclear envelope
            membranes involved in control of mitotic chromsome
            transmission,
          Length = 1205

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 112  QAVKILEDDVA-CDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQ--- 167
            +A K++ED +A   ++    FV +K+   K+   +VGPNG  ++ +   TK  I V    
Sbjct: 1120 KASKLIEDRIAEAKLVNTEGFVWSKD--AKKFNSIVGPNGRNIREIRNATKTVIHVPRKS 1177

Query: 168  ---GNTVSVMGPYKGLKEVRRVV 187
                N + V+G  +G+K+   ++
Sbjct: 1178 DKVNNVIYVLGSEEGVKKAAELI 1200

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {ON}
           Anc_5.375 YDR331W
          Length = 406

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 79  SMTVKTTRKTYDPAVILKARDLIKLLAR-SVPFPQAVKILEDDVACDVIKI--GNFVSNK 135
           ++ V T+R  ++   +  A  + +   R  VP  Q + +L DDVAC+   +  G+  +NK
Sbjct: 30  AVIVSTSRFWFNYRHMANALSMYRTFKRLGVPDSQIILMLSDDVACNSRNLFPGSVFNNK 89

Query: 136 ERFV 139
           +RF+
Sbjct: 90  DRFL 93

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTL+ L+  +KC I ++G
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG 174

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKKPELAEEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,961,841
Number of extensions: 1348810
Number of successful extensions: 7123
Number of sequences better than 10.0: 61
Number of HSP's gapped: 7240
Number of HSP's successfully gapped: 62
Length of query: 330
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 220
Effective length of database: 40,868,139
Effective search space: 8990990580
Effective search space used: 8990990580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)