Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00484g1.5ON92592542400.0
SAKL0C00462g1.5ON11773816956e-76
Smik_3.141.5ON11134526936e-76
Ecym_10081.5ON11183456273e-67
NDAI0A001401.5ON10914656104e-65
ZYRO0F18480g1.5ON9603605986e-64
Suva_3.1521.5ON11404105964e-63
NCAS0B091101.5ON10204455855e-62
YCL061C (MRC1)1.5ON10964545813e-61
KAFR0D001401.5ON10414425793e-61
KLTH0F00484g1.5ON9933595784e-61
AFR745W1.5ON10183295751e-60
TBLA0A075701.5ON12524625781e-60
Skud_3.31.5ON11523825682e-59
KNAG0C002201.5ON11613775477e-57
TDEL0C069701.5ON9414165412e-56
Kpol_2002.81.5ON9854445412e-56
CAGL0B00330g1.5ON11363685397e-56
Kwal_33.130051.5ON9704345287e-55
TPHA0E040101.5ON9653824993e-51
SAKL0E07370g2.296ON26659810.41
TPHA0D031703.476ON41938743.4
KAFR0G031904.234ON41374734.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00484g
         (925 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...  1637   0.0  
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   272   6e-76
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   271   6e-76
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   246   3e-67
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   239   4e-65
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   234   6e-64
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   234   4e-63
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   229   5e-62
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   228   3e-61
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   227   3e-61
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   227   4e-61
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   226   1e-60
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   227   1e-60
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   223   2e-59
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   215   7e-57
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   213   2e-56
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   213   2e-56
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   212   7e-56
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   207   7e-55
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   196   3e-51
SAKL0E07370g Chr5 complement(601465..602265) [801 bp, 266 aa] {O...    36   0.41 
TPHA0D03170 Chr4 (655096..656355) [1260 bp, 419 aa] {ON} Anc_3.4...    33   3.4  
KAFR0G03190 Chr7 (662346..663587) [1242 bp, 413 aa] {ON} Anc_4.2...    33   4.5  

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 925

 Score = 1637 bits (4240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 845/925 (91%), Positives = 845/925 (91%)

Query: 1   MDLLDDLNVGIHKKKGKTYSKANDAEDEELNVGEHKFLAENLLERVKKRLNGDSDDSTAS 60
           MDLLDDLNVGIHKKKGKTYSKANDAEDEELNVGEHKFLAENLLERVKKRLNGDSDDSTAS
Sbjct: 1   MDLLDDLNVGIHKKKGKTYSKANDAEDEELNVGEHKFLAENLLERVKKRLNGDSDDSTAS 60

Query: 61  AIDNSKKSTFFYSDTDLYEGKELDDEFEAMRETAAVPKQREVEIQQKKHPISQTQLIPTF 120
           AIDNSKKSTFFYSDTDLYEGKELDDEFEAMRETAAVPKQREVEIQQKKHPISQTQLIPTF
Sbjct: 61  AIDNSKKSTFFYSDTDLYEGKELDDEFEAMRETAAVPKQREVEIQQKKHPISQTQLIPTF 120

Query: 121 SSSWLAKTQVNTQALEGTNRTIDRQQQDLDTQLNNEEITQTTPDEHTLDKAATESKLLHS 180
           SSSWLAKTQVNTQALEGTNRTIDRQQQDLDTQLNNEEITQTTPDEHTLDKAATESKLLHS
Sbjct: 121 SSSWLAKTQVNTQALEGTNRTIDRQQQDLDTQLNNEEITQTTPDEHTLDKAATESKLLHS 180

Query: 181 KETSFRNTSFTFKLTTNNNEGLLATKPNGTQIENEQKVVATQLDVAEKEKAVPLIKDTIE 240
           KETSFRNTSFTFKLTTNNNEGLLATKPNGTQIENEQKVVATQLDVAEKEKAVPLIKDTIE
Sbjct: 181 KETSFRNTSFTFKLTTNNNEGLLATKPNGTQIENEQKVVATQLDVAEKEKAVPLIKDTIE 240

Query: 241 EPHLPVAPLKAVRKKYLPEQFIAAFDDSESSNAEDLSDEENDADELKDMASTQELVTKQK 300
           EPHLPVAPLKAVRKKYLPEQFIAAFDDSESSNAEDLSDEENDADELKDMASTQELVTKQK
Sbjct: 241 EPHLPVAPLKAVRKKYLPEQFIAAFDDSESSNAEDLSDEENDADELKDMASTQELVTKQK 300

Query: 301 SVVTNMNGIIAITMKNSPQNVIELNSSSESEDDYKSQSSKAALLLIKAKRSRNKATKAKN 360
           SVVTNMNGIIAITMKNSPQNVIELNSSSESEDDYKSQSSKAALLLIKAKRSRNKATKAKN
Sbjct: 301 SVVTNMNGIIAITMKNSPQNVIELNSSSESEDDYKSQSSKAALLLIKAKRSRNKATKAKN 360

Query: 361 MHVSTVDSLKELFTSLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQXXXXX 420
           MHVSTVDSLKELFTSLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQ     
Sbjct: 361 MHVSTVDSLKELFTSLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQELERN 420

Query: 421 XXXXXXXXXXXXXSKDTSKAASSGSASDVPXXXXXXXXXXXXXXXXXQHLGLHGSTGSDE 480
                        SKDTSKAASSGSASDVP                 QHLGLHGSTGSDE
Sbjct: 421 RRVKLREKREREKSKDTSKAASSGSASDVPDSDVMESDLSLSDSDVEQHLGLHGSTGSDE 480

Query: 481 DSADTSAAHKNNNPIIXXXXXXXXXXXNEVTQEPIGINLGHYGDNLTSSNVTENDGADQS 540
           DSADTSAAHKNNNPII           NEVTQEPIGINLGHYGDNLTSSNVTENDGADQS
Sbjct: 481 DSADTSAAHKNNNPIIDDDESSSSSDDNEVTQEPIGINLGHYGDNLTSSNVTENDGADQS 540

Query: 541 DRNVPSNSELKMNRSHSAKLLVGXXXXXXXXXXXXXXXXXXXXXRNRLQERAKMRRRMEI 600
           DRNVPSNSELKMNRSHSAKLLVG                     RNRLQERAKMRRRMEI
Sbjct: 541 DRNVPSNSELKMNRSHSAKLLVGELSSDSSVDSDSSEDELDEVERNRLQERAKMRRRMEI 600

Query: 601 EAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKF 660
           EAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKF
Sbjct: 601 EAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKF 660

Query: 661 DTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGAXXXXXXXXXXXXXRQFREKR 720
           DTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGA             RQFREKR
Sbjct: 661 DTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGALDLELSDDEDELLRQFREKR 720

Query: 721 REIMKQKLLENVDGVVNNSKSKAFFDSMVEDITRKSIPAVTSFSNTRDEMGKKKIVISEE 780
           REIMKQKLLENVDGVVNNSKSKAFFDSMVEDITRKSIPAVTSFSNTRDEMGKKKIVISEE
Sbjct: 721 REIMKQKLLENVDGVVNNSKSKAFFDSMVEDITRKSIPAVTSFSNTRDEMGKKKIVISEE 780

Query: 781 FVQSSLSFLSAKDDDINEFEVTEAAHDATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVD 840
           FVQSSLSFLSAKDDDINEFEVTEAAHDATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVD
Sbjct: 781 FVQSSLSFLSAKDDDINEFEVTEAAHDATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVD 840

Query: 841 GTSLDFKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAP 900
           GTSLDFKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAP
Sbjct: 841 GTSLDFKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAP 900

Query: 901 QGRKSTPLVRKPTSSLFDSNSDSFT 925
           QGRKSTPLVRKPTSSLFDSNSDSFT
Sbjct: 901 QGRKSTPLVRKPTSSLFDSNSDSFT 925

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  272 bits (695), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 237/381 (62%), Gaps = 51/381 (13%)

Query: 595  RRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDD 654
            R+R +    +++++ +K  G++K+ EMEAEESEDEWHGVGGADGE SD+YDS+L+ M+DD
Sbjct: 795  RKREQEHKIRQKRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDD 854

Query: 655  FSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGAXXXXXXXXXXXXXR 714
            ++K+ FD A IR+ LA E+KE DE+++NKILHDI  GGFR+RG+GA             +
Sbjct: 855  YTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDDEDDELQ 914

Query: 715  QFREKRREIMKQKLLENVDG--VVNNSKSKAFFDSMVEDITRKSIP------------AV 760
            ++  KRRE+++QK+LEN +   +V+N KS AFF+SMVED+     P            A+
Sbjct: 915  RYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPDSGAI 974

Query: 761  T--------SFSNTRDEMG-------KKKIVISEEFVQSSLSFLSAKDDDINEFEVTE-- 803
            +        S   T+ + G       +K+I IS+EFVQ SLSFL++KD+  NEFE+    
Sbjct: 975  SENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRL 1034

Query: 804  AAH---------DATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVDGTSL--DFKLPSIV 852
            A H         D  EDL +LKQ S IK+L +P R  +     +VDG S    FKLPS++
Sbjct: 1035 AKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVDGNSPANGFKLPSVI 1094

Query: 853  KSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQ----GRKSTPL 908
             SFSS  D+N+KFK G KTV +SKSY+   GSR++IT+LGK RKL AP+    GRK    
Sbjct: 1095 SSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAPKRKESGRKPVFG 1154

Query: 909  VRKPTSS-----LFDSNSDSF 924
             R P ++     LF  N DSF
Sbjct: 1155 HRHPEAAPKRAGLFADNDDSF 1175

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 322 IELNSSSESEDDY--KSQSSKAALLLIKAKRSRNKATKAKNMHVST--VDSLKELFTSLK 377
           I+L+SSS+ +++    S+ SKAA+L IKA+ S+ +  K      ST    SLKELF+SLK
Sbjct: 429 IDLDSSSDEDENSVPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLKELFSSLK 488

Query: 378 TKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
             N+ QIL+ RREI+ K+G++LE IE EK +VE LLEQ
Sbjct: 489 KANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQ 526

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 60/136 (44%), Gaps = 25/136 (18%)

Query: 1   MDLLDDLNVGIHKKKGKT-YSK---------ANDAEDEELNVGEHKFLAEN--LLERVKK 48
           MD LD L    H KK KT Y K          ND E ++  +    FL  N  ++++VK 
Sbjct: 1   MDFLDALGDLKHPKKKKTTYVKDIEVYATQEENDEEKKQPQLSSASFLFGNSTIVDKVKS 60

Query: 49  RLNGDSDDSTASAIDNSKKSTFFYSDTDLYEGKELDDEFEAMRETAAVPKQREVEIQQKK 108
           RLNG S++ T     ++   T      + Y+G++L+ +F       + PK R V      
Sbjct: 61  RLNGVSNEETDGERGDALPQTQVIP--NYYDGEDLEQDF------VSPPKPRRVSNTGHG 112

Query: 109 HPI-----SQTQLIPT 119
                    QTQL+PT
Sbjct: 113 QDCDCDSEEQTQLMPT 128

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  271 bits (693), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 186/452 (41%), Positives = 250/452 (55%), Gaps = 68/452 (15%)

Query: 515  IGINLGHYGDNLTSSNVTENDGADQSDRNVPSNSELKMNRSHSAKLLVGXXXXXXXXXXX 574
            I INLGHYGDN+       N   + +D N     ++ M R+      +            
Sbjct: 643  IAINLGHYGDNIEEE---VNKFQETNDMNTQQTDKITMERNIVENKAI--LEDTAVVDED 697

Query: 575  XXXXXXXXXXRNRLQERAKMR-RRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGV 633
                      R  L ++ K++ R+ E+E A K K+ LK  G+    EMEAEES+DEWHG+
Sbjct: 698  NINEEADEAIRRELIDKEKLQLRQKELEKAIKLKE-LKHKGVTNFFEMEAEESDDEWHGI 756

Query: 634  GGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGF 693
            GGADGE SD+YDSD++ MIDD+SK+ F++  IRE LA ENKEMD +MINKIL+DI  GGF
Sbjct: 757  GGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGF 816

Query: 694  R-KRGRGAXXXXXXXXXXXXXRQFREKRREIMKQKLLENVDG--VVNNSKSKAFFDSMVE 750
            R KR + +             +Q+R KRRE+M+++ LE  DG  +V N KSKAFF+SMVE
Sbjct: 817  RNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDGTKLVKNPKSKAFFESMVE 876

Query: 751  DITRKSIPA---------VTSFS-----------NTRD-----EMGK-----KKIVISEE 780
            DI     P          +TS +           N RD     E G      KKI+ISE+
Sbjct: 877  DIMEYKNPFRAEEESNQDITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISED 936

Query: 781  FVQSSLSFLSAKDDDINEF----EVTEAAH----DATEDLESLKQRSNIKSLDSPQRN-- 830
            FVQ SLSFL  K ++ NEF    E+ +  H    +  EDL +LKQ S+IKS  + Q +  
Sbjct: 937  FVQKSLSFL--KSNNYNEFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSF 994

Query: 831  --RNSAFFDDVDGTSLD--------------FKLPSIVKSFSSNSDVNDKFKTGIKTVTI 874
              R      D++  + D              FK PSIVKSF+S +D+NDKFK G KTV I
Sbjct: 995  TSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKI 1054

Query: 875  SKSYRVASGSRSAITFLGKKRKLKAPQGRKST 906
            SKSY++   S+++IT++GK RKL AP+ +  T
Sbjct: 1055 SKSYKMVGSSKASITYMGKTRKLMAPKRKAGT 1086

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 49/83 (59%), Gaps = 4/83 (4%)

Query: 336 SQSSKAALLLIKAKRSR-NKATKAKNMHV--STVDSLKELFTSLKTKNRDQILEFRREIS 392
           SQ SKA +L +KA+ S+ N+    + +    + +D  K LF +L+  +R QIL+ +RE+ 
Sbjct: 450 SQLSKATILNLKARLSKQNQDISQRPLEGRDARLDHNK-LFNTLRKASRKQILDHQREVI 508

Query: 393 GKKGISLEAIEDEKIQVEKLLEQ 415
             KG  LE +  EK  VE LLEQ
Sbjct: 509 ETKGFKLEDMVKEKELVENLLEQ 531

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  246 bits (627), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 206/345 (59%), Gaps = 40/345 (11%)

Query: 587  RLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDS 646
            RLQE+ K +++ E          ++  G+NK++E+EA+ESEDEWHGVGG D E SD+YDS
Sbjct: 764  RLQEKIKRQKQKE----------MRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDS 813

Query: 647  DLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGAXXXXXX 706
            DLD MIDD++K++FD   IR+ LA E+ + D+ M+NKILHDI TGGFRKRGRG       
Sbjct: 814  DLDKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGELDLELS 873

Query: 707  XXXXXXXRQFREKRREIMKQKLL--ENVDGVVNNSKSKAFFDSMVEDI---------TRK 755
                   + +R KR    KQK+L  E+   V +N KS  FF+SMV++          T  
Sbjct: 874  EDEDGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPD 933

Query: 756  SIPAVTSFSNTRDEMGKKKIVISEEFVQSSLSFLSAKDDDIN---EFEVTEAAHD----- 807
            S PA ++      +  K+KIVISE FV+ +LSFL++ ++  N   E  V +  +D     
Sbjct: 934  SPPAQSTNVLELKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYS 993

Query: 808  -ATEDLESLKQRSNIKSLDS----PQRNRNSAFFDDVDGTSLDFKLPSIVKSFSSNSDVN 862
               EDL +LK+ S IK L++    P  N      +D DG    FK PS++++F S +DVN
Sbjct: 994  SEVEDLYTLKETSTIKVLNTYSGKPIVN------EDEDGAEFGFKAPSVMQTFGSRNDVN 1047

Query: 863  DKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTP 907
            DKFK G K+V IS  Y+    SR+AITFLGKKRKL  P+    +P
Sbjct: 1048 DKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSP 1092

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 313 TMKNSPQNVIELNSSSESEDDYK----SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDS 368
           +MKN+    I L+SSS+ E        S   KAALL IKAK S+N              +
Sbjct: 412 SMKNTVGQDIILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQSINSPT 471

Query: 369 LKELFTSLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
           LK+LF SLK  N+ QIL+ RREI+ K+GISLE +E E+ +VE LLEQ
Sbjct: 472 LKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQ 518

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  239 bits (610), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 180/465 (38%), Positives = 243/465 (52%), Gaps = 81/465 (17%)

Query: 516  GINLGHYGDNLTSSNVTENDGADQSDRNVPSNSELKMNRSHSAKLLVGXXXXXXXXXXXX 575
             I+LG YGDNLT++NV       +S  +     +   N +   + L              
Sbjct: 650  AIDLGAYGDNLTTANV-------KSQDDDDLEVDDDKNENLDTQPL-------------- 688

Query: 576  XXXXXXXXXRNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGG 635
                     R  + E  K + +M+ E  + +++ +   G+ K  EMEAEESEDEWHG+GG
Sbjct: 689  ---ELTEQERIDIIEAEKTKIKMQQEKMRHKEKEMMKKGVTKFFEMEAEESEDEWHGIGG 745

Query: 636  ADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRK 695
             DGE SD+YDSD++ MIDD+SK+ FD   IRE LA ENKEMD  MINKIL+DI  GGFRK
Sbjct: 746  IDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIKNGGFRK 805

Query: 696  RGRGA-XXXXXXXXXXXXXRQFREKRREIMKQKLLENVDG---VVNNSKSKAFFDSMVED 751
            R RG               R++  KR+E+M+++ LE  D    +V N KSKAFF+SMVED
Sbjct: 806  RKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELGDDEKKLVKNPKSKAFFESMVED 865

Query: 752  ITRK---------SIPAVTSFSNTRDEMGKKKIVI-----------------SEEFVQSS 785
            IT              +    +NT+D+M ++   +                 SEEFVQ +
Sbjct: 866  ITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKENGDSKRIKKKKTIISEEFVQRT 925

Query: 786  LSFLSAKDDD----INEFEVTEAAHDATEDLESLKQRSNIKSLDSPQRNRNSAF------ 835
            LSFL +  +D    +NE    E      E+L SLKQ+S+IK   SP  N +         
Sbjct: 926  LSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLDDIN 985

Query: 836  ----FDDVDGTSLDFKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFL 891
                 D+    +L FK+PSI+KSF S +D+N+KF+ G KTVTISKSYR    S+++IT+L
Sbjct: 986  NDDDDDEDSPIAL-FKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYL 1044

Query: 892  GKKRKLKAPQGRKSTPLVRKPT------------SSLFDSNSDSF 924
            GK RKL AP   K  PL  + T             SLF +  DSF
Sbjct: 1045 GKSRKLMAPTHSKMKPLRSRVTDNNKITKGERNIGSLFSTGDDSF 1089

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 62/102 (60%), Gaps = 5/102 (4%)

Query: 319 QNVIELNSSSESEDDYK-----SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELF 373
           +N ++L S  ES DD +     S++SKA +L IKA+ S+ K+ K      +   +L +LF
Sbjct: 425 KNQLQLGSDDESSDDTENSLPVSRTSKATILTIKARLSKQKSKKNVQKDGTVNTNLNKLF 484

Query: 374 TSLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
            +LK  +R QILE +RE+   KG++ E IE EK  VE LLEQ
Sbjct: 485 ENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQ 526

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
           similar to uniprot|P25588 Saccharomyces cerevisiae
           YCL061C MRC1 S-phase checkpoint protein found at
           replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 960

 Score =  234 bits (598), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 157/360 (43%), Positives = 216/360 (60%), Gaps = 36/360 (10%)

Query: 596 RRMEIEAAKKRKQV--LKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMID 653
           R++E+   KK +++  +K+ GLNK+LEMEAEESEDEW GVGG DG+ SD++DSDL+ MID
Sbjct: 604 RKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDSDLEEMID 663

Query: 654 DFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGAXXXXXXXXXXXXX 713
           DF+KS  +   +R+ LA ENKE+DE+M+NKIL+DI  GGFRKRGR A             
Sbjct: 664 DFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNALDLELSDDEDEDL 723

Query: 714 RQFREKRREIMKQKLLENVD--GVVNNSKSKAFFDSMVEDITRKSIPAVTSFSNTRDEM- 770
           R +R KRRE+MK+  +E  D      N+KSKAF +SMV+DI     P      +  D   
Sbjct: 724 RNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVEDNTD 783

Query: 771 ----------GKKKIVISEEFVQSSLSFLSAKDDDINEFEVTE--AAHDATEDLESLKQR 818
                      K+K  +S+EFVQ SLSFLS  ++   EFE+ E     D  +D+ SLK+ 
Sbjct: 784 VDTQENDYPKNKEKNTLSQEFVQRSLSFLS-NNNSSREFELGEQITLGDEEQDVSSLKRN 842

Query: 819 SNIKSLDSPQRNRNSAFFDDVDGTSLD--------FKLPSIVKSFSSNSDVNDKFKTGIK 870
           S+I +L     N +S   +D++  + D        FK PS++KS +   D N+KF++G K
Sbjct: 843 SSIHAL----HNSSSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKK 898

Query: 871 TVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKST------PLVRKPTSSLFDSNSDSF 924
           TVT+SKSYR   GSRS+IT+ GK RKL  P+ R ST      P  +     L++S  +SF
Sbjct: 899 TVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASKPTMGKLWESQQNSF 958

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 336 SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREISGKK 395
           S+ SKA +L IKA+RS+ +         +T   L +L  +LK  ++ QI + + E+   +
Sbjct: 362 SRVSKATVLDIKARRSKQEPLSKIKQKKTT---LNDLICTLKKASKKQITDHQNELMKSR 418

Query: 396 GISLEAIEDEKIQVEKLLEQ 415
           G  LE IE +K ++E LLEQ
Sbjct: 419 GYKLEDIEKQKEEIENLLEQ 438

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  234 bits (596), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 180/410 (43%), Positives = 236/410 (57%), Gaps = 75/410 (18%)

Query: 585  RNRLQERAKM-RRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDD 643
            R  L +R K  RR+ E E A K K+ LKS G+    EMEAEESEDEWHGVGGADGE SD+
Sbjct: 734  RRELIDREKSERRQKEKEQATKLKE-LKSKGVTNFFEMEAEESEDEWHGVGGADGEGSDE 792

Query: 644  YDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFR-KRGRGAXX 702
            YDS+++ MIDD+SK+KF++  IRE LA ENKEMD +MINKIL+DI  GGFR KR + +  
Sbjct: 793  YDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLE 852

Query: 703  XXXXXXXXXXXRQFREKRREIMKQKLLENVDG--VVNNSKSKAFFDSMVEDITRKSIPA- 759
                       +Q+R KRRE+M+++ LE  D   +V N KSKAFF+SMVEDI     P  
Sbjct: 853  LELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFG 912

Query: 760  --------VTSFS---------NTR-------DEMGK------KKIVISEEFVQSSLSFL 789
                    VTS +         NT+       +E  K      KK++ISE+FVQ SLSFL
Sbjct: 913  AEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFL 972

Query: 790  SAKDDDINEF----EVTEAAHDATE----DLESLKQRSNIKSLDSPQRNR-NSAFFDDV- 839
              K ++ +EF    E+    H   E    DL +LKQ S+IKS  + Q N  +S   + V 
Sbjct: 973  --KSNNYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVI 1030

Query: 840  ----------DGTSLD------FKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASG 883
                      +G + D      FK PS++KSF+S +D+NDKFK G KTV ISKSY+    
Sbjct: 1031 NLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGS 1090

Query: 884  SRSAITFLGKKRKLKAPQGRKSTPLVRKPT---------SSLFDSNSDSF 924
            S+++IT++GK RKL AP  ++ T     P          S LF++  DSF
Sbjct: 1091 SKASITYMGKTRKLMAP--KRKTEENHHPNHIKKSKTQKSKLFENGQDSF 1138

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 336 SQSSKAALLLIKAKRSRN--KATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREISG 393
           SQ SKA +  +KA+ S+   K  +  N +        +L  +L+  +R QIL+ +REI  
Sbjct: 463 SQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVE 522

Query: 394 KKGISLEAIEDEKIQVEKLLEQ 415
            KG  LE +  EK  VE LLEQ
Sbjct: 523 TKGFKLEDMVKEKEIVEDLLEQ 544

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  229 bits (585), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 178/445 (40%), Positives = 246/445 (55%), Gaps = 68/445 (15%)

Query: 517  INLGHYGDNLTSSNV----TENDGADQSDRNVPSNSELKMNRSHSAKLLVGXXXXXXXXX 572
            I+LG YG NL + N     TE +  D+ +++   N E+     H+  L            
Sbjct: 604  IDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALIL------------ 651

Query: 573  XXXXXXXXXXXXRNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHG 632
                        R +L E+    R  E          +K  G+NK+ EMEAEESEDEWHG
Sbjct: 652  --------AEKKRIQLIEKKNAARTKE----------MKKKGVNKLFEMEAEESEDEWHG 693

Query: 633  VGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDI--NT 690
            +GGADGE SD+YDS+++ MIDD+SKS F+   IR+ LALENKEMD  MI KIL+DI    
Sbjct: 694  IGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNGG 753

Query: 691  GGFRKRGRGAXXXXXXXXXXXXXRQFREKRREIMKQKLLENVDG--VVNNSKSKAFFDSM 748
               R+RG                R++ +++RE+MK+++LE  D   ++ N KSKAFF+SM
Sbjct: 754  FRKRRRGGLDLELSDDDEDDEELREYHKRKRELMKKRMLEIGDDKKLIKNPKSKAFFESM 813

Query: 749  VEDITR--------KSIPAVTSFSNTRDE--------MGKKKIVISEEFVQSSLSFLSAK 792
            VEDI          +SI   ++  +T++E        + KKK VISEEFVQ +LSFL + 
Sbjct: 814  VEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRS- 872

Query: 793  DDDINEFEV-----TEAAHDATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVDGTSLD-- 845
              D+ EF +      E   +  EDL SLKQRS IK   +P +       ++V+       
Sbjct: 873  GRDLEEFNIEEDLAKEQHGENVEDLFSLKQRSTIKEFRNPSQTNTIDLINNVENVESSPL 932

Query: 846  --FKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGR 903
              FK PS++KSFSS +D+N+KFK G KTVTISK Y+    S+++IT+LGK RKL  P+  
Sbjct: 933  GGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKN 992

Query: 904  KSTPLVR---KPT-SSLFDSNSDSF 924
            K+   +    KPT SSLF S+ +SF
Sbjct: 993  KNREKIGSKIKPTRSSLFSSHDESF 1017

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (63%), Gaps = 3/80 (3%)

Query: 336 SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREISGKK 395
           S++SKA LL +KA+ S+ K  K+   + ST  SL  LF +LK  +R QIL+ +RE+   +
Sbjct: 398 SRTSKATLLNLKARLSKKKPVKS---NKSTNTSLDVLFQNLKQASRKQILDHQRELVENR 454

Query: 396 GISLEAIEDEKIQVEKLLEQ 415
           G  LE IE EK  VE LLE+
Sbjct: 455 GFKLEDIEKEKEIVENLLEE 474

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  228 bits (581), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 179/454 (39%), Positives = 243/454 (53%), Gaps = 90/454 (19%)

Query: 515  IGINLGHYGDNL-------TSSNV--TENDGADQSDRNVPSNSELKMNRSHSAKLLVGXX 565
            I INLGHYGDN+         +NV  T+N     ++RN   N E+K              
Sbjct: 627  IAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVMAERNTIEN-EVK-------------- 671

Query: 566  XXXXXXXXXXXXXXXXXXXRNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEE 625
                               R +L ++ K++ + + +  + + + LK  G+    EMEAEE
Sbjct: 672  ------DDVYVNEEADEAIRRQLIDKEKLQLKQKEKEHEAKIKELKKRGVTNFFEMEAEE 725

Query: 626  SEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKIL 685
            SEDEWHG+GGADGE SDDYDSDL+ MIDD+SK+ F+   IRE LA ENKEMD +MINKIL
Sbjct: 726  SEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKIL 785

Query: 686  HDINTGGFR-KRGRGAXXXXXXXXXXXXX-RQFREKRREIMKQKLLENVDG--VVNNSKS 741
            +DI  GGFR KR + +              +Q+R KRRE+M+++ LE  D   +V N KS
Sbjct: 786  YDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEIGDDAKLVKNPKS 845

Query: 742  KAFFDSMVEDITRKSIPA---------VTSFS----------NTRDEMG----------K 772
             AFF+SMVEDI     P          +TS +          N  D  G           
Sbjct: 846  SAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKN 905

Query: 773  KKIVISEEFVQSSLSFLSAKDDDINEFE-------VTEAAHDATEDLESLKQRSNIKSLD 825
            KK++ISE+FVQ SLSFL  K ++  +FE       +     +A EDL +LKQ S+IKS  
Sbjct: 906  KKVIISEDFVQKSLSFL--KSNNYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIKSFT 963

Query: 826  SPQRNRNSAFF--------------DDVDG--TSL--DFKLPSIVKSFSSNSDVNDKFKT 867
            + Q +  ++                D+V+   TSL   FK PSI+KSF+S +D+NDKFK 
Sbjct: 964  NSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKE 1023

Query: 868  GIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQ 901
            G KTV I KSY+    S+++IT++GK RKL AP+
Sbjct: 1024 GNKTVKILKSYKTVGSSKASITYMGKTRKLIAPK 1057

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  227 bits (579), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 162/442 (36%), Positives = 237/442 (53%), Gaps = 97/442 (21%)

Query: 516  GINLGHYGDNLTSSNV-------------TENDGADQSDRNVPSNSELKMNRSHSAKLLV 562
             INLG YGDNL+ + +                +  D+ D  +P    +++          
Sbjct: 614  AINLGPYGDNLSLAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDRIRL---------- 663

Query: 563  GXXXXXXXXXXXXXXXXXXXXXRNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEME 622
                                    +  E  + R++M     KKRK+ +K+ G+   LE E
Sbjct: 664  --------------------IEEKKQHELERQRKQM-----KKRKE-MKAKGITNFLEEE 697

Query: 623  AEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMIN 682
            AEESEDEWHG+GG DGE SD+YDS+++ MIDD+SK+ F+   IR+ LA ENKE D +M+ 
Sbjct: 698  AEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVE 757

Query: 683  KILHDINTGGFRKRGRGAXXXXXXXXXXXXXRQFREKRREIMKQKLLE--NVDGVVNNSK 740
            KIL+DI  GGFRKR +GA             +Q+R KRRE+M+QK LE    + +V N K
Sbjct: 758  KILYDIKNGGFRKRRKGAMDLELSDEEDDELKQYRLKRRELMRQKRLEVGEAETLVKNPK 817

Query: 741  SKAFFDSMVEDITRKSIP----------AVTSFSNTRDEMG----------KKKIVISEE 780
            SKAFF+SMV+DI     P           +T+   T++              KK+++SEE
Sbjct: 818  SKAFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEE 877

Query: 781  FVQSSLSFLSAKDDDINEFEV-----TEAAHDATEDLESLKQRSNIKSLDSPQRN----- 830
            FVQ +LSFL++   D+++F        EA  +  EDL +LK++S+IKS  + + +     
Sbjct: 878  FVQRTLSFLNSS-KDMDQFAPARSMRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEP 936

Query: 831  -----RNSAFFDDV----DGTSLDFKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVA 881
                  N   FDD+     GTS      SI+K+FS+  D+NDKF+ G+KTV +SK+Y+  
Sbjct: 937  TDFDKENDDSFDDLLNSRVGTS------SIMKTFSATVDINDKFQEGVKTVKVSKAYKSV 990

Query: 882  SGSRSAITFLGKKRKLKAPQGR 903
            S S+++IT++GK RKL APQ +
Sbjct: 991  SSSKASITYMGKMRKLVAPQKK 1012

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 75/153 (49%), Gaps = 24/153 (15%)

Query: 277 SDEENDADELKDMASTQELVTKQKSVVTNMNGIIAITMK-----NSPQNVIELNSSSESE 331
           SD+ ND   L D   T        S    ++G+    +K     NS Q  I+LN  S+ E
Sbjct: 367 SDKSNDGKRLPDKTRTS------PSFKPKLHGLNNYELKLKRQLNSDQQ-IDLNLDSDDE 419

Query: 332 DDYK--------SQSSKAALLLIKAKRSRNKA-TKAKNMHVSTVDSLKELFTSLKTKNRD 382
           D           SQ SKA +  IKA+ S+ +   K  N   +T   L  LF  L+  +R 
Sbjct: 420 DGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTT---LHTLFNKLQKASRQ 476

Query: 383 QILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
           QI+E ++E+  KKG++LE IE EK  VE LLEQ
Sbjct: 477 QIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQ 509

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 993

 Score =  227 bits (578), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 205/359 (57%), Gaps = 39/359 (10%)

Query: 605 KRKQVLKSTGLNK--------ILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFS 656
           KRK++L+   L K        I++ EAEES+DEWHG+GG DGE  DD+DSDL+ MIDD+S
Sbjct: 633 KRKELLREAKLEKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYS 692

Query: 657 KSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGAXXXXXXXXXXXXXRQF 716
            S+FD++ +R+R   E    D+ M+NKILHDI TGGFRKRGR A              ++
Sbjct: 693 NSRFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNALDLELSDDDDEELLKY 752

Query: 717 REKRREIMKQKLLENVDG--VVNNSKSKAFFDSMVEDITRKSI------PAVTSFS---- 764
             +R+E+++QK+    +   +  N KSKAFF+++VEDI  K        P V  FS    
Sbjct: 753 HSRRKELLRQKVSAQGEAKLLAENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNA 812

Query: 765 ----NTRDEMGKKKIVISEEFVQSSLSFLSA--------KDDDINEF--EVTEAAHDATE 810
               N+  +   KK V+SE FVQ +LSFL++         ++++      V     + T+
Sbjct: 813 PEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQ 872

Query: 811 DLESLKQRSNIKSLDSPQRNRNSAFFDDVDGTSLDFKLPSIVKSFSSNSDVNDKFKTGIK 870
           D+ +LKQ S+IKSL +P RN ++   DD +      +  S    F+   D N+KF+ G K
Sbjct: 873 DIFALKQNSSIKSLSAPTRNSSNMLIDDQEDLLSRKRACSFFARFTKRVDANEKFEEGKK 932

Query: 871 TVTISKSYRVASGSRSAITFLGKKRKLKAPQ---GRKSTPLVRKPTS--SLFDSNSDSF 924
           TV    SY+VA  S+++IT+LGK RKL AP+    ++S     KP +   +F SNS+SF
Sbjct: 933 TVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSRKRGHKPAAGFGIFASNSESF 991

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 116/471 (24%), Positives = 191/471 (40%), Gaps = 90/471 (19%)

Query: 1   MDLLDDLNVGIHKKKGKTYSKANDAEDEELNVGEHKFLAENLLERVKKRLNGDSD---DS 57
           MDL+D+L             K    +   L  G       ++L RVK RL  D +   DS
Sbjct: 1   MDLIDNLRARNRGSGTAKKVKERGCDSLPLVTGTGFLFGNSVLRRVKSRLGDDENHEADS 60

Query: 58  TASAIDNSKKSTFFYSDTDL----YEGKELDDEF-----EAMRETAAVPKQREVEIQQKK 108
           T S IDN        S T +    Y+G++L+ +F         ++ A P  +    + K+
Sbjct: 61  TKSPIDNG---CCDLSQTQVVGLAYDGEDLEQDFADSTARIEGKSWAGPTNKPNYPKDKR 117

Query: 109 HPISQTQLIPT-FSSSWLAKTQVNTQALEGTN-RTIDRQQQDLDTQLNNEEITQTTPDEH 166
              S    +      S L  T+VNTQ +     + ID    +L+TQL         PD  
Sbjct: 118 RVSSNNSTVERRIPRSELESTEVNTQLISPHQVKEID----ELETQL-------LLPD-- 164

Query: 167 TLDKAATESKLLHSKETSFRNTSFTFKLTTNNNEGLLATKPNGTQIENEQKVVATQLDVA 226
            +D        LH    S  NT     +T  +  G         +  ++  + AT  DV+
Sbjct: 165 -VD--------LHPTNQSSNNTILDGTITQISGFG---------ETCHDNAIQATSKDVS 206

Query: 227 EKEKAVPLIKDT----------IEEPH-----LPVAPLKA------VRKKYLPEQFIAAF 265
           +    VP+   T            +P      + ++P  A      +RK++  + FI +F
Sbjct: 207 DTSTFVPITTKTKYSNSSLSFNANDPEEESNTIAMSPADATERDRTIRKRFDAQSFIESF 266

Query: 266 DD-------SESSNAED--------LSDEENDADELKDM----ASTQELVTKQKSVVTNM 306
           DD         +SNA +        L D E +A+ LK      ++ +    K  S +   
Sbjct: 267 DDETDELQSCAASNASETEAPVLKQLEDGEKNANNLKKPTHFESNRENNPNKDSSSIKIF 326

Query: 307 NGIIAITMKNSPQNVIELNSSSESEDDYKSQSSKAALLLIKAKRSRNKATK--AKNMHVS 364
             +      ++   ++  +S  E + + K  S KAA+L +KA+ S+   +    ++   S
Sbjct: 327 PTMFEENKADASAIILSSSSEEEEDYESKKPSFKAAILDLKARLSKKSQSLLIPRSKVTS 386

Query: 365 TVDSLKELFTSLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
              S + LF SL+  N+ QIL++R+E    KGI  + I +EK  +E LLE+
Sbjct: 387 NFSSHQILFASLRKANKSQILDYRKEKYQSKGIDYDKITEEKNSIESLLER 437

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  226 bits (575), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 147/329 (44%), Positives = 207/329 (62%), Gaps = 29/329 (8%)

Query: 595 RRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDD 654
           R R   E  K R++ +K  G+ K+LEMEAEESEDEWHG+GG+D E S+DYDS+++ MIDD
Sbjct: 666 RNRKRAERNKLRRREMKKKGITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDD 725

Query: 655 FSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGAXXXXXXXXXXXXXR 714
           +S    +   +R  LA   ++ DE ++NKILHDI+TGGFR+RG+GA             +
Sbjct: 726 YSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQ 785

Query: 715 QFREKRREIMKQKLLENVDG--VVNNSKSKAFFDSMVEDITRKSIPAVTSFSNTRD---- 768
           QFR+KRRE++KQK+LEN D   +V+N KS AFF +MV+D+T        SF NT D    
Sbjct: 786 QFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTE------ASFGNTFDANID 839

Query: 769 -----EMGKKKIVISEEFVQSSLSFLSAKDDDINEFEVTEAAHDAT------EDLESLKQ 817
                    +KIVISE+FV+ +LSFLS+K  D      T++   +T      +DL +LKQ
Sbjct: 840 EKTDPSAAGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQ 899

Query: 818 RSNIK----SLDSPQRNRNSAFFDDVD-GTSLDFKLPSIVKSFSSNSDVNDKFKTGIKTV 872
            SNIK    SL+ P +    +  D+ D G SLD +  S  KSF++ ++V+DKFK+G K V
Sbjct: 900 NSNIKHLKGSLELPAQMAELSSGDEGDYGFSLD-RFRSAAKSFNNGTNVDDKFKSGTKAV 958

Query: 873 TISKSYRVASGSRSAITFLGKKRKLKAPQ 901
            I K+ +   GS++AITF+G+KR+L  P+
Sbjct: 959 RILKANKTIGGSKAAITFIGRKRRLIPPK 987

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 143/346 (41%), Gaps = 67/346 (19%)

Query: 82  ELDDEFEAMRETAAVPKQREVEIQQKKHPISQTQLIPTFSSSWLAKTQVNTQALEGTNRT 141
           EL DE E       V     + + Q +  +S T   PT     +  TQ ++    GT   
Sbjct: 169 ELQDELET-----GVAVDGRISLSQTQVIVSGTNYGPTRVDDEVVATQQDSM---GTADA 220

Query: 142 IDRQQQDLDTQLNNEEITQTTPDEHTLDKAATESKLLHSKETSFRNTSFTFKLTTNNNEG 201
                Q LD  L ++    T PD  TL  A  E   +H                      
Sbjct: 221 QCWDTQTLDCALADD-FQATIPDAQTLATARHEKLFIH---------------------- 257

Query: 202 LLATKPNGTQIENEQKVVATQLDVAEKEKAVPLIKDTIEEPHLPVAPLKAVRKKYLPEQF 261
                    QIE E   +AT+      +K +P++    E P++P   L      +  + F
Sbjct: 258 ---------QIEEE---IATK-----TQKELPMMTQAKEAPYIPKQKLV-----FTKDNF 295

Query: 262 IAAFDD---SESSNAEDLSDEE---NDADELKDMASTQELVTKQ---KSVVTNMNGIIAI 312
           + +FDD   +E     D SD +   ND +  +    + +  T +     V+      ++I
Sbjct: 296 LDSFDDDSETEIHGGLDGSDRQVSYNDREHTETGPQSSQPATGEGQDTQVLYPALQSLSI 355

Query: 313 TMKNSPQ-NVIELNSSSESEDD--YKSQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSL 369
           T K+  +   I L+ SSE + D    S  SKAA+L IKA+ S  K    + +  +     
Sbjct: 356 TSKSYQEARQIILDESSEDDTDVNLSSAVSKAAVLAIKARNS--KFITPQKIDETKSSKS 413

Query: 370 KELFTSLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
            ELF  L+  NR+Q+LE RR    ++GI+++ +E E+ Q+  LLEQ
Sbjct: 414 NELFAKLRKANREQLLEQRRNAIERRGINMQNLEQEREQLGNLLEQ 459

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  227 bits (578), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 174/462 (37%), Positives = 233/462 (50%), Gaps = 109/462 (23%)

Query: 514  PIGINLGHYGDNLTSSNVTENDG------------ADQSDRNVPSNSELKMNRSHSAKLL 561
            P  INLGHYGDNL S +   N+             AD S  N  SN+EL           
Sbjct: 792  PNIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFEADNSTEN--SNNEL----------- 838

Query: 562  VGXXXXXXXXXXXXXXXXXXXXXRNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEM 621
                                   R+  QE  K + +   + AK R+  LK  G +K+ +M
Sbjct: 839  -----------------NELEYKRHIKQELEKQKLKEAKKKAKLRE--LKKVGASKMFDM 879

Query: 622  EAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMI 681
            EAEESEDEW G+GGADGE SD+YDS+++ +IDD+S+  F+   IR +L  ENKEMD +M+
Sbjct: 880  EAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMV 939

Query: 682  NKILHDINTGGFRKRGRGAXXXXXXXXXXXXXRQFREKRREIMKQKLLE--NVDGVVNNS 739
            N+IL+DI  GGFRKR R               R++R KRREIMK+K LE  N D ++  S
Sbjct: 940  NRILYDIKNGGFRKRNRNNIDLELSDDEDDELREYRIKRREIMKKKRLEVTNTDKILKTS 999

Query: 740  KSKAFFDSMVEDITRKSIPAVTS--------------FSN-----------------TRD 768
            KSKAFF SMV+DI   S P + +               SN                 T D
Sbjct: 1000 KSKAFFMSMVDDIVETSNPFMITQPSDDDSDDNNMDSISNKNHKDANNAKKDKKDKRTDD 1059

Query: 769  -----EMGKKKIVISEEFVQSSLSFLSAKDDDINEFEVTEAAHDA----TEDLESLKQRS 819
                 +  +KK V+SE+FV  +LSFL+ K  ++NEF+     + +      D++SLKQ+S
Sbjct: 1060 HARLSQSSRKKFVMSEDFVHKTLSFLT-KSKEVNEFQHVNEHYKSQIGTINDIQSLKQKS 1118

Query: 820  NIK-----SLDSPQRN--------------RNSAFFDDV--DGTSLDFKLPSIVKSFSSN 858
            +IK     S+ S   N               ++  FD+   D  S   K PSI+K F S 
Sbjct: 1119 SIKTMHVLSMMSQDTNVDLDASDKDDDDMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGST 1178

Query: 859  SDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAP 900
             D+NDKFK G KTVTIS SY+   G +++IT  G +RKL AP
Sbjct: 1179 HDINDKFKDGNKTVTISNSYKTVGGMKTSITSFG-RRKLVAP 1219

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 52/99 (52%), Gaps = 6/99 (6%)

Query: 320 NVIELNSSSE---SEDDYKSQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSL 376
           N I+L S SE     D   S +SKA +L I+ K S+ K    K    + +D   +LF  L
Sbjct: 595 NSIDLYSDSEENTQSDILFSTASKAQILDIRHKLSKKKPQVKKKTIQTNLD---QLFNKL 651

Query: 377 KTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
           K  ++ QI + ++     KG+ LE ++ EK  VE LLEQ
Sbjct: 652 KKASKKQIFDHQKNAIESKGLKLEDLKKEKEIVENLLEQ 690

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  223 bits (568), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 160/382 (41%), Positives = 219/382 (57%), Gaps = 69/382 (18%)

Query: 610  LKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERL 669
             KS G+    EMEAEESEDEWHGVGGADGE S++YDS+++ MIDD+SK+ F++  IRE L
Sbjct: 771  FKSKGITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREML 830

Query: 670  ALENKEMDERMINKILHDINTGGFR-KRGRGAXXXXXXXXXXXXXRQFREKRREIMKQKL 728
            A ENKEMD +MIN+IL+DI  GGFR KR + +             +Q+R KRRE+M+++ 
Sbjct: 831  AAENKEMDVKMINRILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRR 890

Query: 729  LENVDG--VVNNSKSKAFFDSMVEDI------------TRKSIPAVTSFSNTRD----EM 770
            LE  D   +V N KSKAFF+SMVEDI            + + + +  +  +T+D    ++
Sbjct: 891  LEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQI 950

Query: 771  G--------------KKKIVISEEFVQSSLSFLSAKDDDINEFEV----TEAAHD----A 808
            G               KK +ISE+FVQ SLSFL + + D  EFE+        HD     
Sbjct: 951  GDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYD--EFEMDKERARIQHDIGDEG 1008

Query: 809  TEDLESLKQRSNIKSL-----DSPQRNRNSAFFD-----------DVDGTSL--DFKLPS 850
             EDL +LKQ S+IKS      DS    R ++  D           + +  SL   FK PS
Sbjct: 1009 VEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPS 1068

Query: 851  IVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGR------- 903
            I+KSF+S +D+NDKFK G KTV ISK+Y+    S+++IT++GK RKL AP+ +       
Sbjct: 1069 IIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHH 1128

Query: 904  -KSTPLVRKPTSSLFDSNSDSF 924
               +   +   S LF+S  DSF
Sbjct: 1129 NHHSKAWKTQKSKLFESGQDSF 1150

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 336 SQSSKAALLLIKA---KRSRNKATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREIS 392
           S+ SKAA+L +KA   K+S+N          + VD  K LF  L+  +R QIL+ +RE+ 
Sbjct: 492 SRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNK-LFNILRKASRKQILDHQREVI 550

Query: 393 GKKGISLEAIEDEKIQVEKLLEQ 415
             KG  LE +  EK  VE LLEQ
Sbjct: 551 ETKGFKLEDMAKEKEIVENLLEQ 573

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  215 bits (547), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 157/377 (41%), Positives = 214/377 (56%), Gaps = 53/377 (14%)

Query: 588  LQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSD 647
            ++E+  M +R E          LK  G++   E EAEESEDEWHG+GG DGE SD+YDS+
Sbjct: 793  MKEKKLMLKRAE----------LKEKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSE 842

Query: 648  LDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGAXXXXXXX 707
            ++ MIDD+S++  D   IR+ L  ENKEMD +M+NKIL DI  G FRKRGR         
Sbjct: 843  VEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTLELELSD 902

Query: 708  XXXXXXRQFREKRREIMKQKLLENVDG--VVNNSKSKAFFDSMVEDITRKSIPAVT---- 761
                  RQ+R+KR E+MKQ+LL+  D   +V N K+KAFFDS+VEDI     P       
Sbjct: 903  EEDDDLRQYRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMSDN 962

Query: 762  -----------------SFSNTRDEMGK---KKIVISEEFVQSSLSFLSAKDDDINEFE- 800
                             S SN  ++  +   KK V+SEEFVQ SLSFL++ + ++ EFE 
Sbjct: 963  ETQDTDETTTIDTQTRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNS-NRNLTEFEQ 1021

Query: 801  ---VTEAAH-DATEDLESLKQRSNIKSLDSPQRNRNSAFFD--DVDGTSL---DFKLPSI 851
               +    H D   DL +LK++S++KS  S          D  D  GT++    F+ PSI
Sbjct: 1022 NQDLARLQHDDDVSDLYTLKKQSSVKSFKSVGSKNEIINVDANDNSGTAVATATFRPPSI 1081

Query: 852  VKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRK---STPL 908
            +KSF+S  +V+DKF+ G KTV   KSY+   GS++++T++ K RKL AP+  K   ST  
Sbjct: 1082 IKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTGG 1141

Query: 909  VRK---PTSSLFDSNSD 922
             RK    TS  F SNS+
Sbjct: 1142 ERKISAQTSHSFKSNSN 1158

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 102/189 (53%), Gaps = 36/189 (19%)

Query: 252 VRKKYLPEQFIAAFDDSESSNAEDLSDEENDADELKDMASTQELVTKQKS---------- 301
           V  ++  E F+A F++S+S+     SD E+D+D++ D  +T E  + Q S          
Sbjct: 449 VEVRFTKESFMADFEESDSA-----SDMESDSDQIND--TTPETGSSQNSDSNKARKPTE 501

Query: 302 -----VVTNMNGIIAITMKNSPQN--VIELNS----SSESEDDYKS---QSSKAALLLIK 347
                 VT ++    I ++N   +   ++L S    SSE E D +S   Q+SKAA+L IK
Sbjct: 502 APKTKRVTGLSSYETI-LRNKVNDDECLDLGSDDTYSSEEEYDKESKVSQASKAAVLNIK 560

Query: 348 AKRSRNKATKAK-NMHVSTVDSLKELFTSLKTKNRDQILEFRREISGKKGISLEAIEDEK 406
           AK  + KA     N + +T+DSL   F+ LK KNR QIL  + EI G KGI+ + +E EK
Sbjct: 561 AKALKKKAIVKAANTNKTTLDSL---FSDLKKKNRQQILSHQAEIIGTKGINHKDLEREK 617

Query: 407 IQVEKLLEQ 415
             VE LLEQ
Sbjct: 618 EIVEDLLEQ 626

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
           YCL061C
          Length = 941

 Score =  213 bits (541), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 158/416 (37%), Positives = 222/416 (53%), Gaps = 60/416 (14%)

Query: 516 GINLGHYGDNLTSSNVTENDGADQSDRNVPSNSELKMNRSHSAKLLVGXXXXXXXXXXXX 575
            INLG YGDNL +   T  D A  S               H+ +L+              
Sbjct: 542 AINLGAYGDNLIT---TTKDEAHTS------------AEEHTTQLV-------------- 572

Query: 576 XXXXXXXXXRNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGG 635
                    R   +E++K+R + E    K+R + +K +G+  + +MEAEES+DEW GVGG
Sbjct: 573 -NEISESQYRTMEKEKSKIRAQEE----KQRLKQMKESGVTNMFDMEAEESDDEWRGVGG 627

Query: 636 ADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRK 695
            DGE  DDYDSDL+ MIDDFS +  +   IR+ L  ENKE D + +NKILHDI  GGFRK
Sbjct: 628 VDGETIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRK 687

Query: 696 RGRGAXXXXXXXXXXXXXRQFREKRREIMKQKLLE---NVDGVVNNSKSKAFFDSMVEDI 752
           R +                 +++++ E+M+++ L+   +   ++ NS+SKAFF+SMVEDI
Sbjct: 688 RRQNNLQLELSDDEDDELLNYKKRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDI 747

Query: 753 TRKSIP----AVTSFSNTR-----DEMGKKKIVISEEFVQSSLSFLSAKDDDINEFEVTE 803
                P    A TS  + +     D   K+K  IS EFVQ SLS   +   D +EFEV  
Sbjct: 748 IDLKDPFSNQAETSEKDKKSEGLVDASNKQKDTISHEFVQQSLS-FLSSSRDFSEFEVAR 806

Query: 804 AAHDATE--DLESLKQRSNIKSLDSP-------QRNRNSAFFDDVDGTSLDFKLPSIVKS 854
            + +     DL SLKQ S +K+L +P       +R  +  F + V    ++    S+VKS
Sbjct: 807 VSQEGERNTDLNSLKQDSTVKTLYAPSNIISESERADHEEFDNSV--LPVESSYSSVVKS 864

Query: 855 FSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTPLVR 910
           F  + + NDK K G KTVT+SKSYR   G++++IT+LGK RKL AP  +KS   VR
Sbjct: 865 FGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAP--KKSNAEVR 918

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 109/453 (24%), Positives = 187/453 (41%), Gaps = 86/453 (18%)

Query: 13  KKKGKTYSKANDAEDEELN---------VGEHKFLAENLLERVKKRLNGDSDDSTASAID 63
           KK+  TY KA   ED+E           +G       + L++VK RLN D +  T  AID
Sbjct: 13  KKRRATYQKAVQNEDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNRLNKDQEQGT-QAID 71

Query: 64  NSKKSTFFYSDTDLYEGKELDDEFEAMRETAAVPKQREVEIQQKKHPISQTQLIPTFSSS 123
            ++  +  Y D     G++L+ E  ++             +Q K  PI  T LIP+    
Sbjct: 72  TTQVLSNLYED-----GEDLEKEVPSI-------------LQSKSKPIP-TILIPSIERE 112

Query: 124 WLAKTQVNTQALEGTNRTIDRQQ---QDLDTQ-LNNEEI--TQTTPDEHTLDKAATESKL 177
            L +         G    I +     ++LD + L + EI  TQ  PD    D   T++++
Sbjct: 113 ILKQPFNENHNFTGVTVPIAKSSAITKNLDREDLESPEIPETQPIPDFSASD-VPTQTQV 171

Query: 178 LHSKETSFRNTSFTFKLTTNNNEGLLATKPNGTQIENEQKVVA----TQLDVAEKEKA-- 231
           L       + TS T   T       +A + + TQ+E  ++       +Q D+ ++  A  
Sbjct: 172 L-------KTTSETAADTGTVATAAIAYEESLTQVEVSEQTYPDQRNSQEDIIQQTAADA 224

Query: 232 VPLIKDTIEE------------------PHLPVAPLKAVRKKYLPEQFIAAFDDSESSNA 273
           VP+ +  I E                   +    PLK   K+   + F  + D       
Sbjct: 225 VPITRLKIHEIEEMWSREVQTETKEHKVKYRAPRPLKVFTKEAFMQDFDKSSDSDSDVFD 284

Query: 274 EDL---SDEENDADELKDMASTQELVTKQKSVVTNMNGIIAITMKNSPQNV-----IELN 325
           +++   S    + D + ++ ++   V K KS     +G +    +   +       + L 
Sbjct: 285 QEIKATSPIGRNNDSISEVGTSDVKVLKDKS-----SGALTAYQRELKEKAEIAKGVMLL 339

Query: 326 SSSESEDDYK---SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSLKTKNRD 382
           S S+ E+D     S  +KA +L +KA+ S+ +    ++ H     SL  L  +L+   + 
Sbjct: 340 SESDDEEDLAVSTSHEAKATVLKLKARLSKRRPP-VESQHGKA--SLSALMKNLRNSTKR 396

Query: 383 QILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
           QIL+ ++E   ++G+  E +E EK  VE LLEQ
Sbjct: 397 QILDRQKEGIERQGLKFEDVEKEKEIVENLLEQ 429

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
           complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  213 bits (541), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 171/444 (38%), Positives = 238/444 (53%), Gaps = 76/444 (17%)

Query: 517 INLGHYGDNLTSSNVTENDGADQSDRNVPSNSELKMNRSHSAKLLVGXXXXXXXXXXXXX 576
           INLGHYGDNL+  N  E +  D  +     + EL        K +V              
Sbjct: 580 INLGHYGDNLSQENNNERNNIDSDE---SEDEEL-------YKEMV-------------- 615

Query: 577 XXXXXXXXRNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGA 636
                   R R QER K R+++         + LK  G+  + E+EAEESEDEWHG+GG 
Sbjct: 616 ---KKEIDRRRDQER-KQRQKL---------RELKDKGITDMFEVEAEESEDEWHGIGGV 662

Query: 637 DGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKR 696
           DGE SD+YDS+++ MIDD+SK  F+   IRE+LA ENK+MD +M+N+IL+DI  GGFRKR
Sbjct: 663 DGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKR 722

Query: 697 GRGAXXXXXXXXXXXXXRQFREKRREIMKQKLLE--NVDGVVNNSKSKAFFDSMVEDITR 754
            R A             + +R KRR++MK+K LE  +   ++ N KS AF +SMV+DI  
Sbjct: 723 -RNALEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIVE 781

Query: 755 KSIPAVTSFSNTRDEM----------------GKKKIVISEEFVQSSLSFLSAKDDDINE 798
              P      N  D+                  KKK ++SE FVQ SLSFLS+   ++ E
Sbjct: 782 VKNPFDERDDNIMDDTPETDAEGDVNSNELLNKKKKFILSEAFVQKSLSFLSSS-RNLEE 840

Query: 799 FEVT------EAAHDATEDLESLKQRSNIKSLDS-PQRNRNSA------FFDDVDGTSLD 845
           FE+       + +H AT D+ +LK   +IKSL+S P  + NS         +++  T   
Sbjct: 841 FEMNNNLAKEQHSHAAT-DMFALKSHCSIKSLESLPGSHNNSISSKLDLLHEEIVSTPFS 899

Query: 846 -FKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRK 904
             K  S++KSFSS+ D++ KFK G KTV +SKSYR    ++++IT+LGK RKL  P+ ++
Sbjct: 900 GLKQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYRTVGSAKASITYLGKARKLVPPKKKE 959

Query: 905 STPLVRK----PTSSLFDSNSDSF 924
             P   K      S LFD   +SF
Sbjct: 960 HKPHSHKSKTASASRLFDEQDNSF 983

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 117/461 (25%), Positives = 201/461 (43%), Gaps = 72/461 (15%)

Query: 1   MDLLDDLNVGIHKKKGKTYSKANDA--EDE----ELNV-----GEHKFLAENLLERVKKR 49
           MD + D    +  KK  TY K  D   EDE    E N+     G+      + L++++ R
Sbjct: 1   MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNR 60

Query: 50  LNGDSDDSTASAIDNSKKSTFFYSDT----DLYEGKELDDEFEAMRETAAVPKQREVEIQ 105
           L G+++DS     D+S+  T   +DT    +LYEG E   + E   E   + + + VE  
Sbjct: 61  LEGNNNDSEN---DSSQAETQVIADTQIISNLYEGGE---DLEEKEERRFLQRTQIVEDH 114

Query: 106 QKKHPISQTQLIPTFSSSWLAKTQ--VN--------------------TQALEGTNRTID 143
            +    S T    T  S+ +  TQ  +N                    T  L+   + +D
Sbjct: 115 TQIIDASVTYSSKTIESNKMDNTQKYINASDSEPTQIQISKVDKLLKITDNLDSQKKVLD 174

Query: 144 R--QQQDLDTQLNNEEITQTTPDEHTLDKAATESKLLHSKETSFRNTSF-TFKLTTNNNE 200
              + Q+L+TQ    ++ +T  D+  +DK      L+   E    +T+  T    T++N 
Sbjct: 175 TTLETQELETQYGKTQVDKTQVDKTQVDKTQIFPTLVADDEIKHSSTAVQTVDDNTHSNS 234

Query: 201 GLLATKPNGTQIENEQKVVATQLDVAEKEKAVPLIKDTIEEPHLPVAPLKAVRKKYLPEQ 260
            L   +      E +Q +    +    K    P++           + +K  +  +L E 
Sbjct: 235 ELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVM-----------SKVKFSKNDFL-EH 282

Query: 261 FIAAFDDSESSNAEDLSDEENDADELKDMASTQELVTKQKSV-VTNMNGIIAITMKNSPQ 319
           F ++  + +      LS  E +   +    S  +   + K + ++N   I+   +  + Q
Sbjct: 283 FDSSSSEEDEEGVVKLSSTEPETAAMNLENSLPQFSKESKFIGLSNYENILKKDI--NKQ 340

Query: 320 NVIELNSSSESEDDYK-----SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFT 374
           N IE    S+SED+ +     S++SKA +L IKA  SR+K  ++    ++  ++L  LF+
Sbjct: 341 NCIEF---SDSEDETEVTSKVSRASKATILSIKANLSRHKPAQSS---INNKNALGNLFS 394

Query: 375 SLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
            LK   + QIL+ ++EI  +KG  +E IE EK  VE LLEQ
Sbjct: 395 DLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQ 435

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  212 bits (539), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 215/368 (58%), Gaps = 44/368 (11%)

Query: 591  RAKMRRRMEIEAAKKRK-QVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLD 649
            + +++R+ E E  +++K Q L + G+N+  E EAEES+DEW G+GG DG++  +YDS+++
Sbjct: 778  KQQVKRQQEREVKERKKLQELANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVE 837

Query: 650  TMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGAXXXXXXXXX 709
             MIDD+SK++ D  S+R+++  ENKEMD +++NKIL+DI  GGFRKRGR           
Sbjct: 838  KMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDE 897

Query: 710  XXXXRQFREKRREIMKQKLLEN--VDGVVNNSKSKAFFDSMVEDITRKSIPAVTSFSNTR 767
                ++FR KRRE+MKQ++LEN   D +  N KSKAFF+SM+ D+    +    +F +  
Sbjct: 898  DAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDL----VEDKNNFDDLS 953

Query: 768  DEMGKK----------------------KIVISEEFVQSSLSFLSAKDDDINEFE--VTE 803
            D++  K                      KI ISE+FVQ +LSFL   D+   EF+     
Sbjct: 954  DQIELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFL-HNDESTQEFQPSFIM 1012

Query: 804  AAHDATEDLESLKQRSNI---KSLDSPQRNRNSAFFDDVDGTSLDFKLPSIVKSFSSNSD 860
            +      D+ +LK  S++     L + ++  N    +DV      FK PSI++SFSS   
Sbjct: 1013 SKEKGIGDMNALKSNSSLSFCSKLSTSRKIINDE--EDVIEEFESFKRPSIIQSFSSKFT 1070

Query: 861  VNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTPLVRKP----TSSL 916
            ++DKFK G K+V +S SY+   GS+++IT+LGK RKL  P   K+ P VRK     TS L
Sbjct: 1071 IDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPP---KNGPTVRKRNSNNTSRL 1127

Query: 917  FDSNSDSF 924
            F+  +D F
Sbjct: 1128 FNIQNDPF 1135

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 4/83 (4%)

Query: 334 YK-SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREIS 392
           YK S  SKA LL +K + S+ K  K   +H +  DS   LF +L+   + QI+  R+E+ 
Sbjct: 530 YKLSNKSKATLLNLKVRLSKKKPVKK--VH-NEKDSTNLLFNNLRKATKQQIMLHRKELM 586

Query: 393 GKKGISLEAIEDEKIQVEKLLEQ 415
             +G++ E +E +K+ VE LLE+
Sbjct: 587 ESRGLNFEDLEKQKVMVEDLLEK 609

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
           YCL061C (MRC1) - protein involved in replication
           checkpoint [contig 123] FULL
          Length = 970

 Score =  207 bits (528), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 149/434 (34%), Positives = 223/434 (51%), Gaps = 34/434 (7%)

Query: 517 INLGHYGDNLTSSNVTENDGADQSDRNVPSNSELKMNRSHSAKLLVGXXXXXXXXXXXXX 576
           I+LG YG+N+  +   +     Q      S  E K+ R+ +   +               
Sbjct: 543 IDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPV------RILNRPCEE 596

Query: 577 XXXXXXXXRNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGA 636
                   RN + +    +R+++    + + + L  +  N +++ EAEES+DEW GVGGA
Sbjct: 597 KIDQDEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGA 656

Query: 637 DGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKR 696
           DGENSD YDS+LD MIDD+S +K D   +R++L  E K  D+ M+++ILHDI  GGFRKR
Sbjct: 657 DGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKR 716

Query: 697 GRGAXXXXXXXXXXXXXRQFREKRREIMKQKLLEN--VDGVVNNSKSKAFFDSMVEDITR 754
           GR A              ++  +R+E++ ++   N  +  +  N KSKAFFDS+ ED  +
Sbjct: 717 GRYAMDLTLSDDEDDDLLRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLK 776

Query: 755 KSIPAVTSFSN-------TRDEM-GKKKIVISEEFVQSSLSFLSAKDDDINEFEVTEAAH 806
             I  +  + +        +DE+ GK++  ISE+FVQ +LSFL +K+D+  + E    A 
Sbjct: 777 GGIANLKEYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVA- 835

Query: 807 DATE----------DLESLKQRSNIKSLDSPQRNRNSAFFDDVDGTSLDFKLPSIVKSFS 856
           D  E          D   LKQ S IKS  +P R+       + DG        ++V+ F 
Sbjct: 836 DTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGVLSGKANTTLVERFV 895

Query: 857 SNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKA----PQGRKSTPLVRKP 912
            + D N+KF+ G KTV    SY++A  SR++ITFLGK R LKA    P  R S P  +K 
Sbjct: 896 RSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHAR-SAPHGQKI 954

Query: 913 TSS--LFDSNSDSF 924
            +S   F S+  SF
Sbjct: 955 MTSHQFFASDGQSF 968

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 113/445 (25%), Positives = 200/445 (44%), Gaps = 59/445 (13%)

Query: 1   MDLLDDLNVGIHKKKGKTYSKANDAEDEEL-NVGEHKFLAEN-LLERVKKRLNGDSDDST 58
           MDL+D L+    K+ G    K +  +DE    VG   FL EN +  +VKKR+   +DD+ 
Sbjct: 1   MDLIDQLSNPRTKRSG-FVKKLHLFDDESCPTVGGTGFLFENSIFNQVKKRIKA-TDDNE 58

Query: 59  ASAIDNSKKSTFFYSDTD-------LYEGKELDDEFEAMRETAAVPKQREVEIQQKKHPI 111
            +    +  ST    DT         Y+G+EL+ +F  + +  + PK  EV   Q    +
Sbjct: 59  INHNAPTTASTEILKDTCETQAIERPYDGEELETDF-VLAKAPSEPKDNEVRASQSSSRL 117

Query: 112 SQTQLIPTFSSSWLAKTQ-------VNTQALEGTNRTIDRQQQDLDTQ--LNNEEITQTT 162
            + Q    F++S   +          NTQ +  +  +     +DL+TQ   +N+ IT  T
Sbjct: 118 -KFQAQQEFTASGETRLDNHKEADIANTQLIGDSISSTSICDEDLETQKTSSNDMITSLT 176

Query: 163 PDEHTLDKAATESKLLHSKETSFRNTSFTFKLTTNN--NEGLLATKPNGTQIENEQKVVA 220
             +  L  +  +  L    + + R+ +       +   +EG++ T     +IE++   + 
Sbjct: 177 TQKIDLSHSPIKGTL----QATSRDDNLEPPTVDDREKSEGIMHTNEAHIEIEDDHSNI- 231

Query: 221 TQLDVAEKEKAVPLIKDTIEEPHLPVAPLKAVRKKYLPEQFIAAFD-DSESSNAE-DLSD 278
               +++  K+ P++ D                +KY  ++F+  FD DS+ S  E + S+
Sbjct: 232 ----ISKSSKSKPMVLD----------------EKYGAQKFVDEFDEDSDVSECEKEASN 271

Query: 279 EENDADELKDMASTQELVTKQKSVVTNMNGIIAITMKNSPQNVIELNS------SSESED 332
            E +   L++ +  + L       ++     + +      Q + + NS        E   
Sbjct: 272 PEAEKSNLRETSERRNLSLNVLPSISEGFAPLQLYHTILKQRLTDANSVEFSSSDDEKSS 331

Query: 333 DYKSQSSKAALLLIKAKRSRNKATKAKNMHVSTVDS--LKELFTSLKTKNRDQILEFRRE 390
           + +S SSKAA+L +KA+ S+ K + A      T+ S  L+ LF+SL+  NRDQ++E R  
Sbjct: 332 EARSLSSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNG 391

Query: 391 ISGKKGISLEAIEDEKIQVEKLLEQ 415
           +   +G+ L  I  EK  VE LLE+
Sbjct: 392 LLLLRGVDLAEIAKEKESVESLLER 416

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
           YCL061C
          Length = 965

 Score =  196 bits (499), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 146/382 (38%), Positives = 215/382 (56%), Gaps = 62/382 (16%)

Query: 594 MRRRMEIEAAK-KRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMI 652
           +R++ E+E  + KR + +K++G++K+ E+EAEESEDEWHG+GG D + SD YDS+++ MI
Sbjct: 594 IRKQKELEKREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMI 653

Query: 653 DDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGAXXXXXXXXXXXX 712
           DD+S+  F+ + IRE LA ENKE D  ++NKIL+DI  GGFR R R              
Sbjct: 654 DDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDD 713

Query: 713 XRQFREKRREIMKQKLLENVDG---VVNNSKSKAFFDSMVED-----------------I 752
            + +R KRR +M++K L+ ++G   +V N KSKAFF+S+V+D                 I
Sbjct: 714 LKAYRAKRRALMREKRLD-IEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQI 772

Query: 753 TRKSIPAVTSFSN----TRDEMGKKKIVISEEFVQSSLSFL-SAKDDDINEFEVTEAAHD 807
             K  P V   ++    T     KKKIVISEEFVQ SLSFL S ++ D  EFE+    + 
Sbjct: 773 VEKETPTVDIDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSCREQD--EFEINNQHNG 830

Query: 808 -----ATEDLESLKQRSNIKSL----------------DSPQRNRNSAFFDDVDGTSLDF 846
                +T DL +LK+ S+IK+L                + P ++  S F         D 
Sbjct: 831 GEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSGSLFN--------DL 882

Query: 847 KLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKST 906
           +  S++ SFSS+ D+N KFK G K+V +S +Y+    +R++IT++G  R+L AP+  + T
Sbjct: 883 RKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLT 942

Query: 907 PL----VRKPTSSLFDSNSDSF 924
                  R   S LFD+   SF
Sbjct: 943 TSSKANSRTTPSRLFDNQEGSF 964

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 59/99 (59%), Gaps = 5/99 (5%)

Query: 319 QNVIELNSSSESEDDYKSQS--SKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSL 376
           + +IE + S E  D   S S  SKA +L I+A +S+ +   ++    +T   L  L+ +L
Sbjct: 337 EQIIEFSESDEDSDTNISPSYASKAVILNIRANKSKQQPKVSQKSDQTT---LLMLYNNL 393

Query: 377 KTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQ 415
           K  +++QI+ +++E+  KKGI+LE +E E   VE LLEQ
Sbjct: 394 KRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQ 432

>SAKL0E07370g Chr5 complement(601465..602265) [801 bp, 266 aa] {ON}
           similar to uniprot|P53965 Saccharomyces cerevisiae
           YNL032W SIW14 Tyrosine phosphatase that plays a role in
           actin filament organization and endocytosis localized to
           the cytoplasm
          Length = 266

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 745 FDSMVEDITRKSIPAVTSFSNTRDEMGKKKI--VISEEFVQSSLSFLSAKDDDINEFEV 801
           F  +V DI R S P + +FS  RD +  K I  +I E++ Q +L F+     DI  F+V
Sbjct: 107 FSHIVGDIYRSSFPRLENFSFLRDRIRLKSILVLIPEDYPQENLEFMEQA--DIKLFQV 163

>TPHA0D03170 Chr4 (655096..656355) [1260 bp, 419 aa] {ON} Anc_3.476
           YGR122W
          Length = 419

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%)

Query: 218 VVATQLDVAEKEKAVPLIKDTIEEPHLPVAPLKAVRKK 255
           ++  QL + +KEK  PL+++TI++  LP++ L   R K
Sbjct: 321 ILQRQLPIMQKEKLSPLLENTIDDFLLPLSTLLYYRYK 358

>KAFR0G03190 Chr7 (662346..663587) [1242 bp, 413 aa] {ON} Anc_4.234
           YLR380W
          Length = 413

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 10  GIHKKKGKTY-SKANDAEDEELNVGEHKFLAENLLERVKKRLNGDSDDSTASA----IDN 64
           GI +K  ++Y  K  D E  ++ + + K L EN LE  +K +  D DD +A      I+ 
Sbjct: 325 GIFEKPDESYDEKMQDHETLDILLVKRKELIENFLEITRKWIESDGDDESAQLLKERIEA 384

Query: 65  SKKSTFFYSDTDLY 78
            +K T  Y D D Y
Sbjct: 385 GRKLTRNYIDLDPY 398

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.326 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,066,791
Number of extensions: 4194661
Number of successful extensions: 25685
Number of sequences better than 10.0: 555
Number of HSP's gapped: 27064
Number of HSP's successfully gapped: 646
Length of query: 925
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 806
Effective length of database: 39,836,145
Effective search space: 32107932870
Effective search space used: 32107932870
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)