Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00462g1.4ON46046022680.0
SAKL0C00440g1.4ON4624974952e-56
ZYRO0F18502g1.4ON4503733314e-33
TDEL0C069801.4ON4263713191e-31
Kpol_2002.71.4ON4744982928e-28
Suva_3.1511.4ON4213752732e-25
NDAI0A001301.4ON4785302742e-25
Skud_3.21.4ON4263742723e-25
YCL063W (VAC17)1.4ON4233712582e-23
CAGL0B00308g1.4ON4303212554e-23
KNAG0C001901.4ON4423992539e-23
TPHA0E040201.4ON5405702461e-21
Smik_3.131.4ON4253092351e-20
NCAS0B091201.4ON4335142085e-17
Kwal_33.130031.4ON4494782069e-17
KAFR0D001201.4ON3994781596e-11
KLTH0F00462g1.4ON4514981516e-10
TBLA0A075801.4ON5133281010.001
Ecym_10071.4ON462502940.006
AFR746C1.4ON441118790.35
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00462g
         (460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   878   0.0  
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   195   2e-56
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   132   4e-33
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   127   1e-31
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   117   8e-28
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   109   2e-25
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   110   2e-25
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      109   3e-25
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   103   2e-23
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   102   4e-23
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   102   9e-23
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...    99   1e-21
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)    95   1e-20
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...    85   5e-17
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    84   9e-17
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    66   6e-11
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    63   6e-10
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    44   0.001
Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to ...    41   0.006
AFR746C Chr6 complement(1806243..1807568) [1326 bp, 441 aa] {ON}...    35   0.35 

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/460 (92%), Positives = 426/460 (92%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQEYYSFLARLSSLKLR 60
           MEDMRYVAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQEYYSFLARLSSLKLR
Sbjct: 1   MEDMRYVAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQEYYSFLARLSSLKLR 60

Query: 61  AEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKXXXXXXXXX 120
           AEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTK         
Sbjct: 61  AEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKSARSGSSKE 120

Query: 121 XXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILHHL 180
             VIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILHHL
Sbjct: 121 SSVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILHHL 180

Query: 181 HSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNADWEFFKNKNRL 240
           HSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNADWEFFKNKNRL
Sbjct: 181 HSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNADWEFFKNKNRL 240

Query: 241 SLSVFDDVNTDASDEETVISVSPPNISYYLSQNEDQYPSKQVRRCNSHESILSRKILSPS 300
           SLSVFDDVNTDASDEETVISVSPPNISYYLSQNEDQYPSKQVRRCNSHESILSRKILSPS
Sbjct: 241 SLSVFDDVNTDASDEETVISVSPPNISYYLSQNEDQYPSKQVRRCNSHESILSRKILSPS 300

Query: 301 TPANLIMRPTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSPHLSKDMLSQFVTAPPSKK 360
           TPANLIMRPTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSPHLSKDMLSQFVTAPPSKK
Sbjct: 301 TPANLIMRPTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSPHLSKDMLSQFVTAPPSKK 360

Query: 361 YRGWXXXXXXXXXXXXXXQKWFNSDSLVTKEIGNPDNSSPSSGRPIVENRQRHXXXXXXX 420
           YRGW              QKWFNSDSLVTKEIGNPDNSSPSSGRPIVENRQRH       
Sbjct: 361 YRGWFSSSNSTPFASSIFQKWFNSDSLVTKEIGNPDNSSPSSGRPIVENRQRHSSSNSYS 420

Query: 421 XXIVIGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEFNF 460
             IVIGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEFNF
Sbjct: 421 TSIVIGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEFNF 460

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  195 bits (495), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 167/497 (33%), Positives = 249/497 (50%), Gaps = 72/497 (14%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLELSIQR--KMCEFD----PNNSHCFIQVQEYYSFLARL 54
           ME +  ++++L++R  EA++QL+L IQR  ++ E++    P+N     ++QEY + LA+L
Sbjct: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNG-LLTKLQEYQTCLAQL 59

Query: 55  SSLKLRAEHVQE---SLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVA----RAYQ 107
           +SL +R+EH+++   S  H+     D      ++  L+ EFQ IT  LNE+A    RAYQ
Sbjct: 60  NSLHIRSEHLRDRIASTDHRASQDGD------SIGHLVTEFQKITTKLNELAATQDRAYQ 113

Query: 108 SPTKXXXXXXXXXXXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNV 167
           SP                 K LKI+ER +     TSP K+  +  KK       P ++N 
Sbjct: 114 SPGSQSTKSVSSFEP----KPLKILERTKLQH-PTSPTKRVATPPKK-----IAPLRKNP 163

Query: 168 RFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKK 227
            F   D  ++   HS  ++ SLPGSP       S +  ++ +  R AKS D GLN + ++
Sbjct: 164 PF---DKKVMFSGHS--KSTSLPGSP--SMAASSPVSIQQERFPRHAKSCDAGLNKQQRR 216

Query: 228 NADWE----FFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISYYLSQNEDQYPSKQ-V 282
             D +    FFK   RLS+S FDD    +SDE+TVISVSPP  + +       +P  + +
Sbjct: 217 RQDSDNRLNFFKENQRLSISFFDDEIDYSSDEDTVISVSPPETTSF-----KGFPKAEPL 271

Query: 283 RRCNSHESILSRKILSPSTPANLIMRPTYQSVWQKK-----------AIVTKPTISCSTS 331
           RR NSHES+LSRK +    PA L  R  + S+W  +           +I  KP  S +  
Sbjct: 272 RRYNSHESVLSRKEV---LPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAAL 328

Query: 332 NSTASPTIGSPHLSKDMLSQFVTAPPSKKYR--GWXXXXXXXXXXXXXXQKWFNSDSLVT 389
             + S T  +   SKD+L+QFV+A P +K +   W               K FN+  LVT
Sbjct: 329 LRSHSKTTET---SKDLLAQFVSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVT 385

Query: 390 KEIGNPD-NSSPSSGR-----PIVENRQRHXXXXXXXXXIVIGPNGAKFIRGLNDPLVTC 443
            E G  D NS PS+ R     P                 +++GPNG++F+   N+P++  
Sbjct: 386 SETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPPNEPVLNN 445

Query: 444 TVSYNELQEALNTEFNF 460
            VSY+ L EAL TEF  
Sbjct: 446 KVSYDALHEALCTEFRL 462

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  132 bits (331), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 121/373 (32%), Positives = 191/373 (51%), Gaps = 52/373 (13%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQEYYS-FLARLSSLKL 59
           M  +  ++ERL IR  EAV+QLEL I+R+    +  + H   ++ + Y+ ++A+L+SL +
Sbjct: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIADQYNLYMAQLNSLCV 60

Query: 60  RAEHVQESLR---HQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKXXXXX 116
           R+E+V++ L      RK P  +  E   +E L+YEFQDIT+ LNE+A+  +         
Sbjct: 61  RSEYVRDKLNAGYQNRKPP--IVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSSKH 118

Query: 117 XXXXXXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDI 176
                     + LKI ER R  +  T   ++S +++     N  L   +NV F E+ L  
Sbjct: 119 SNGSVNSFQPRPLKITERYRTDIGAT---RQSPTRI-----NGKL---KNVNFVEESLP- 166

Query: 177 LHHLHSVKRANSLPGSPM----PDTLLESQMFSREHKTLRMAKSYDVGLN----GRAKKN 228
              L    +  SLPGSP+    PD L +        + LR+AKSYD GLN     + KK 
Sbjct: 167 --ELFCPSKCTSLPGSPLKMRSPDRLPD--------RPLRVAKSYDTGLNPNSRAKLKKQ 216

Query: 229 ADWEF---FKNKNRLSLSVFDDVN---TDASDEETVISVSPPNISYYLSQNEDQYPSKQV 282
            + E    FK   RLS++  DD++     ASD+ TVIS SP   S+ + Q + Q     +
Sbjct: 217 KEEEMLSVFKENQRLSITFCDDIDEGSDSASDQNTVISTSPIPPSHPI-QYDVQSEKPPL 275

Query: 283 RRCNSHESILSRKILSPSTPANLIMRPTYQSVWQKKAIVTKPTI-SCSTSNSTASPTIGS 341
           RR NSH+S+LS K+     P +    PT+ ++        +P++ S + S++    + G 
Sbjct: 276 RRYNSHDSVLSTKV----QPISSAKCPTFLTI----PTANRPSMKSVTVSSAPIISSTGG 327

Query: 342 PHLSKDMLSQFVT 354
              SKD+LS F++
Sbjct: 328 KASSKDLLSSFIS 340

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  127 bits (319), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 114/371 (30%), Positives = 191/371 (51%), Gaps = 62/371 (16%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQEYYSFLARLSSLKLR 60
           +ED+   +ERL+ R  EA++QLEL IQR+    +  +S       +Y  ++A+L+SL +R
Sbjct: 3   LEDL---SERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGNQYNVYIAQLNSLCVR 59

Query: 61  AEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKXXXXXXXXX 120
           +E+V++ L  +R+    +  + + +E L++EFQDIT+ LNE+A++    +          
Sbjct: 60  SEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQSQSIDSTPSSKSTRSS 119

Query: 121 XXVIPLKTLKIIERNRDSL--IGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILH 178
                 + LK+ ER+  ++  +  SP+K           N+S+   ++V+F       LH
Sbjct: 120 LGSFQPRPLKLTERHGPNVKALRESPLK-----------NKSV--IKSVKFSG-----LH 161

Query: 179 HL--HSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNG----RAKKNADWE 232
                +V +  SLPGSP+          +   +++RMAKSYD GLN     ++K + D++
Sbjct: 162 DSKEEAVSKCLSLPGSPV--------RVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYD 213

Query: 233 ---FFKNKNRLSLSVFDDVNTDA---SDEETVISVSPPNISYYLSQNEDQYPSKQVRRCN 286
               F+   RLS++VFDD + DA   SD++TVIS+ P +    L           +RR N
Sbjct: 214 VPSIFRENQRLSITVFDDFDEDADSTSDQDTVISLVPADDGKGL----------PLRRFN 263

Query: 287 SHESILSRKILSPSTPANLIMRPTYQSVWQKKAIVTKPTI-SCSTSNSTASPTIGSPHLS 345
           SHESILS K+   S+       P + S     +   +P++ S   S++       +P  S
Sbjct: 264 SHESILSTKVQPISS------LPLFSSFLLPSS--NRPSMKSVRVSSAPVFSKTSAPASS 315

Query: 346 KDMLSQFVTAP 356
           +D+LS FVT P
Sbjct: 316 RDLLSTFVTRP 326

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  117 bits (292), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 144/498 (28%), Positives = 232/498 (46%), Gaps = 77/498 (15%)

Query: 7   VAERLVIRCNEAVMQLELSIQRKM--CEFDPNNSHCFIQ--VQEYYSFLARLSSLKLRAE 62
           ++ERL++R  EA++QL+L IQR+    E D N+    ++     Y  ++++L+SL +R++
Sbjct: 9   LSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQLNSLYIRSQ 68

Query: 63  HVQESLRHQRK---------DPNDVCIEYET-LEKLIYEFQDITMSLNEVARAYQSPTKX 112
           +V++ L  ++K          P+ V +  ++ +E LI+EFQDIT  LN +A + +  +  
Sbjct: 69  NVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLASSRRRCSSS 128

Query: 113 XXXXXXXXXXVIPLKTLKIIERNRDSLIGT---SPMKKSLSQLKK-EEHNQSLPAKRNVR 168
                                    S IG+    P+K SL + K  +E N     K+ V 
Sbjct: 129 KSSSSRS------------------SSIGSFQPKPLKISLKRNKSLKEQN-----KKTVT 165

Query: 169 FQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGR---- 224
           F  +++  L+    +    SLPGSP+ +      M    +  LR AKSYD GLN +    
Sbjct: 166 FDVEEVTDLN----INSVISLPGSPLRNEQSSPPM----NHHLRQAKSYDTGLNSKRSIK 217

Query: 225 -AKKNADWEF---FKNKNRLSLSVFD-DVN----TDASDEETVISVSPPNISYYLSQNED 275
             K   D  +   FKN  RLS+S+FD D N    T+ SD+ETVIS S   +   L   +D
Sbjct: 218 PKKSKIDSVYDSTFKNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDD 277

Query: 276 QYPS-KQVRRCNSHESILSRKILSPSTPANLIMRPTYQSVWQKKAIVTKPTISCST---S 331
           Q  + K +RR NSHESILS KI   S      + P ++SV          T + +T   +
Sbjct: 278 QKNNLKPLRRYNSHESILSTKIRPISISKRFQIGP-FRSVSTTTTSTNYDTTASNTDVKA 336

Query: 332 NSTASPTIGSPHLSKDMLSQF-VTAPPSKKYRG-WXXXXXXXXXXXXXXQKW--FNSDSL 387
           +    P + +   SKD+LS + +        RG                 KW  FN   +
Sbjct: 337 DDFYKPNLSNSTTSKDILSMYSIKNDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFPLI 396

Query: 388 VTKEIGNPDNSSPSSGRPIVENRQRHXXX----XXXXXXIVIGPNGAKFIR-GLNDPLVT 442
            + E+G+   ++ ++ +     R++              + IGPNG+ F    + +P  +
Sbjct: 397 ASSEVGSKQENN-TTAKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMFCSPTIYEPTFS 455

Query: 443 CTVSYNELQEALNTEFNF 460
            TVS+ EL +ALNTE + 
Sbjct: 456 NTVSFQELHDALNTELDL 473

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  109 bits (273), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 112/375 (29%), Positives = 182/375 (48%), Gaps = 67/375 (17%)

Query: 7   VAERLVIRCNEAVMQLELSIQRK----MCEFDPNNSHCFIQV-QEYYSFLARLSSLKLRA 61
           + ERL+ R  EA++QL+L IQR+    +CE  P++     ++ Q+Y  ++++L+SL +R+
Sbjct: 9   ITERLLTRSEEAILQLDLWIQRQQRSSVCE--PSDRDSLDKLSQQYNQYMSQLNSLYVRS 66

Query: 62  EHVQESL-RHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKXXXXXXXXX 120
           E V++ L + Q +  N    E++ +E L++EFQDIT+ LN++A      +          
Sbjct: 67  ESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSPQSQSTR 126

Query: 121 XXVIPL--KTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILH 178
             +     + LKIIER R  L   +P K               P K++V F     + ++
Sbjct: 127 SSLDSFQPRPLKIIERQR--LCVVTPSK---------------PPKKSVVF-----NPIN 164

Query: 179 HLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAK---KNADWEFFK 235
            +    + NSLP SP        +   + H TLR AKS+D GLN   K    +A   FFK
Sbjct: 165 DVECPSKTNSLPCSP-------KKQPGKAH-TLRAAKSHDTGLNKSKKPSSTDAYESFFK 216

Query: 236 NKNRLSLSVFDDVNTDASDEETVISVSPPNISY--YLSQNEDQYPSKQVRRCNSHESILS 293
           NK RLSL+ FD+++     +    ++  PNIS   ++         + +RR NSHESILS
Sbjct: 217 NKQRLSLTFFDEMDD-EDLDSDQDTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILS 275

Query: 294 RKILSPSTPANLIM---------RPTYQSVWQKKAIVTKPTISCST---SNSTASPTIGS 341
            K   P+   +L +          PT+ +      +  +P ++ S     N + +PT   
Sbjct: 276 NK---PAPAMSLSLGSFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPT--- 329

Query: 342 PHLSKDMLSQFVTAP 356
              SK +LS F+  P
Sbjct: 330 ---SKALLSSFIAQP 341

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  110 bits (274), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 127/530 (23%), Positives = 219/530 (41%), Gaps = 139/530 (26%)

Query: 7   VAERLVIRCNEAVMQLELSIQRK-----MCEFDPNNSHCFIQV--QEYYSFLARLSSLKL 59
           + ERL+IR  EA++QL+L IQR+     +   + +N+  +  V  Q+Y  +LA+L+SL +
Sbjct: 8   ITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNSLIV 67

Query: 60  RAEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKXXXXXXXX 119
           R +++++   H     +    E + +E L+YEF+ IT+ LN++++  ++ +         
Sbjct: 68  RVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSKKNKTTSSSENSSKTA 127

Query: 120 XXXV----IPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLD 175
                      K LKII+R ++         + +S     +H                 D
Sbjct: 128 SSKSSMESFEPKPLKIIKRTKND--------QKVSNTINNDH-----------------D 162

Query: 176 ILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNADW---- 231
           ++    +++R NSLP SP+  +   +   S+  + LR+ KS D        +N ++    
Sbjct: 163 LIMQDENLQRPNSLPSSPIEKSSYVT--ISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIR 220

Query: 232 --------EFFKNKNRLSLSVFDD--------------------VNTDASDEETVISVSP 263
                   +FFK++ RLS+ +FD+                    +  + SD+ TVIS   
Sbjct: 221 KFENDTINQFFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGT 280

Query: 264 PNISYYLSQNEDQYPSKQVRRCNSHESILSRKILSPSTPA-----NL-----------IM 307
                 + +N+D +    +RR NSHESILS+KI   STP      NL           I 
Sbjct: 281 ------IKRNDDDFTP--LRRYNSHESILSQKI--SSTPLIDNNNNLTFNSKLPLYSSIR 330

Query: 308 RPTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSPHLSKDMLSQFVTAP-PSKKYRGWXX 366
           RP+ QS+     + + P  + S+   T          SKD+LS FVT+  P    R    
Sbjct: 331 RPSMQSI----HVTSNPIFARSSQGKT----------SKDLLSSFVTSSIPRNNNRNIQT 376

Query: 367 XXXXXXXXXXXXQ------------------KWFNSDSLVTKEIGNPDNSSPSSGRPIVE 408
                       Q                   + N  +++T E     N   +   P+V 
Sbjct: 377 RTKTRTQSRRNNQLRDHTINQTSTSSFFGNWNFLNRFNMITSETNTTTNRKRNYNIPLVN 436

Query: 409 NRQRHXXXXXXXXXIVIGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEF 458
             + H           I  N       + +P+   T+S ++L++ALNTE 
Sbjct: 437 QSRAHN----------IDVNDTMDSISIKEPVYDNTISLDDLEDALNTEL 476

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  109 bits (272), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 115/374 (30%), Positives = 182/374 (48%), Gaps = 63/374 (16%)

Query: 7   VAERLVIRCNEAVMQLELSIQRK----MCEFDPNNSHCFIQVQEYYSFLARLSSLKLRAE 62
           + ERL+IR  EA++QL+L IQR+    +C+     S   +  Q+Y  ++++L+SL +R+E
Sbjct: 9   ITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLS-QQYNQYMSQLNSLYVRSE 67

Query: 63  HVQESL-RHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKXXXXXXXXXX 121
            V++ L + Q++       E++ +E L++EFQDIT  LNE+A      +           
Sbjct: 68  SVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSPQSQSTRS 127

Query: 122 XVIPL--KTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQE-DDLDILH 178
                  + LKIIER R  ++  +P K               P K++V F   +D+D   
Sbjct: 128 SSGSFQPRPLKIIERQRVCMV--TPSK---------------PPKKSVGFNPINDVDC-- 168

Query: 179 HLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAK---KNADWEFFK 235
                 + NSLP SP        +    +++TLR AKS+D GLN   K    +A   FFK
Sbjct: 169 ----PSKTNSLPCSP--------KKPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFK 216

Query: 236 NKNRLSLSVFDDVNTDASDEETVISVSPPNISY--YLSQNEDQYPSKQVRRCNSHESILS 293
           NK RLSL+ FD+++     +    ++  PNIS   +++        + +RR NSHESILS
Sbjct: 217 NKQRLSLTFFDEMDD-EDLDSDQDTIILPNISTPPHMNVTAKGAEFEPLRRYNSHESILS 275

Query: 294 RK---ILSPST---PANLIM--RPTYQSVWQKKAIVTKPTISCSTS---NSTASPTIGSP 342
            K   I+S S    P +      PT+ +      +   PTI+ S +   N   +P+    
Sbjct: 276 NKPAPIMSLSLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTITVSMASRRNGCYAPS---- 331

Query: 343 HLSKDMLSQFVTAP 356
             SK +LS F+  P
Sbjct: 332 --SKALLSSFIARP 343

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  103 bits (258), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 116/371 (31%), Positives = 177/371 (47%), Gaps = 63/371 (16%)

Query: 7   VAERLVIRCNEAVMQLELSIQRK----MCEFDPNNSHCFIQVQEYYSFLARLSSLKLRAE 62
           + ERL+IR  EA++QL+L IQR+    +C+     S   +  Q+Y  ++++L+SL +R+E
Sbjct: 9   ITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLS-QQYNQYMSQLNSLYVRSE 67

Query: 63  HVQESL-RHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARA-----YQSPTKXXXXX 116
            V++ L + Q++       E++ +E L+ EFQDIT+ LNE+A         SP       
Sbjct: 68  SVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQSQSTRS 127

Query: 117 XXXXXXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDI 176
                   P   LKIIER R  L   +P K               P K++V F     + 
Sbjct: 128 SLGSFQPRP---LKIIERQR--LCMVTPSK---------------PPKKSVGF-----NP 162

Query: 177 LHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNAD--WE-F 233
           ++ +    + NSLP SP              ++TLR AKS+D GLN   K ++   +E F
Sbjct: 163 INEVDCPSKTNSLPCSPKKQPA--------RNRTLRAAKSHDTGLNKSKKPSSSDTYESF 214

Query: 234 FKNKNRLSLSVFDDVNTDASDEETVISVSPPNISY--YLSQNEDQYPSKQVRRCNSHESI 291
           FKN+ RLSL+   D   D   +    ++  PNIS   ++         + +RR NSHESI
Sbjct: 215 FKNRQRLSLTF-FDEMDDEDFDSDQDTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESI 273

Query: 292 LSRKILSPSTPANL------IMR---PTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSP 342
           LS K  +PS   NL        R   PT+ +      +   PT++ + + S   P I S 
Sbjct: 274 LSNKP-APSKSLNLGSFSASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISS- 331

Query: 343 HLSKDMLSQFV 353
             SK +LS F+
Sbjct: 332 --SKALLSSFI 340

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  102 bits (255), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 102/321 (31%), Positives = 152/321 (47%), Gaps = 61/321 (19%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLE--LSIQRKMCEFDPNNS--HCFIQVQEYYS-FLARLS 55
           M  +  + ERL+ R NEA+ QL+  + +Q K      N S      ++ + Y+ FL +L+
Sbjct: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLN 60

Query: 56  SLKLRAEHVQESLRHQRK---DPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQ----- 107
           SL +R++++++ +R ++          +    +++L+ EF++IT+SLNE+A+        
Sbjct: 61  SLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSK 120

Query: 108 --SPTKXXXXXXXXXXXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKR 165
             SP               PLK L     NR S+I  SP+              S P KR
Sbjct: 121 QLSPASTSTKSSLESFTPKPLKIL-----NRASMIR-SPI-------------NSPPKKR 161

Query: 166 NVRFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRA 225
           N+ F       +H   SV    SLP SP    LLE Q      + L  A+S+  GL    
Sbjct: 162 NISFCP-----IHENLSVTEYESLPSSPNRSNLLEEQ-----EQVLHPARSFQTGLRTEK 211

Query: 226 KKNADW----EFFKNKNRLSLSVF-----DDV----NTDASDEETVISVSPPNISYYLSQ 272
            +  D     ++FK+K RLSL++F     DD     N D SDEETVI  S  NI    + 
Sbjct: 212 ARKPDKNQLDKYFKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETD-AI 270

Query: 273 NEDQYPSKQVRRCNSHESILS 293
            +D  P   +RRCNSHES+LS
Sbjct: 271 TDDMKP---IRRCNSHESVLS 288

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  102 bits (253), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 114/399 (28%), Positives = 179/399 (44%), Gaps = 83/399 (20%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLELSIQR--KMCEFDPNNSHCFIQVQEYYSF-------L 51
           M+ +  V +RL+IR  +A++QLEL +Q+  K+   D    H  +  +++ +        L
Sbjct: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTD----HASVDRKKFEAIAQQRNLHL 56

Query: 52  ARLSSLKLRAEHVQESLRHQRKDPNDVCI----EYETLEKLIYEFQDITMSLNEVARAYQ 107
           ++L+SL LR+ +++E L  +R    ++C         +E L+YEFQDI MSLNE++   +
Sbjct: 57  SQLNSLCLRSRYIKEKLASER----NICSIRKGRRSYIENLVYEFQDIAMSLNELSETNR 112

Query: 108 SPTKXXXXXXXXXXXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNV 167
                              K L+I+ER R +    SP K++ + +K     +        
Sbjct: 113 KNGSPVSQATTNSSDSFEPKPLRILERQR-TCNAKSPTKRNSNHIKIPRETE------KS 165

Query: 168 RFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKK 227
            F E+  D LH        +SLP SP+  +       +   +T+R+ KSY   LNG+   
Sbjct: 166 DFTENVADCLH--------SSLPSSPLRGS-------NGSQQTIRLTKSYHESLNGQKPT 210

Query: 228 NAD--WEFFKNKNRLSLSVFDDVNT--------DASDEETVISVSPPNISYYLSQNEDQY 277
           +       F  KNRLSL +FD+++         D SD+ETV+  SP      +S+     
Sbjct: 211 SHSPLMNPFNAKNRLSLYLFDNIDEKELTPCDDDNSDQETVMYNSP-----VVSKGAAFE 265

Query: 278 PSKQVRRCNSHESILSRKILSP--STPANLIMRPTYQSVWQKKAIVTKPTISCSTSNSTA 335
           P   +RR NSHESILS    +P  S+   L   P+           T  T S  +   ++
Sbjct: 266 P---LRRYNSHESILSVAKKAPIHSSAQKLQFYPS----------ATNGTTSAQSVFVSS 312

Query: 336 SPTIGSP----HLSKDMLSQFVTAPPSKK------YRGW 364
            P    P      SKD+LS    A  SK       + GW
Sbjct: 313 KPVYTKPLSVQSRSKDLLSSIAHAEASKDTKTTSVFNGW 351

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 134/570 (23%), Positives = 234/570 (41%), Gaps = 156/570 (27%)

Query: 3   DMRYVAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQE---------------- 46
           ++  ++E+L+IR  EA++QL+L I R+  +   +N H F    +                
Sbjct: 7   NLEELSEKLLIRSQEAILQLDLWILRQQQQ---HNDHRFGTATDTGNKTKDSNEALNALR 63

Query: 47  --YYSFLARLSSLKLRAEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVAR 104
             Y  ++++L+SL +R+E +++ L  ++ + N   +++  +E+L++EFQ+I   LN++A 
Sbjct: 64  STYDLYMSQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAA 123

Query: 105 AYQ----SPTKXXXXXXXXXXXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQS 160
           + +    SP K            + LK LK++ ++         M K L +LK +E + +
Sbjct: 124 SSKLDKHSPPKTSTRSSSMES--MNLKPLKVVAKHE------KRMSKEL-ELKNKEKSVT 174

Query: 161 LPAKRNVRFQEDDLDILHHLHSVKRANSLPGSPM--PDTLLESQMFSREHKTLRMAKSYD 218
              +  +                   N + G  M   D+    Q+  +++K LR A SYD
Sbjct: 175 FGKETRISLT---------------TNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYD 219

Query: 219 VGLNGRAKKN--ADWEF-----------FKNKNRLSLSVFDD------------------ 247
            GLN ++K N  ++ E+           FKNK R S+S+F+D                  
Sbjct: 220 TGLNSKSKSNKRSNREYRKKNDAAYDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVD 279

Query: 248 --VNTDA----SDEETVISVS-------PPNISYYLSQ----------NEDQYPSKQVRR 284
             +NT+     SD+ETVIS S        P   Y LS             ++     +RR
Sbjct: 280 ASINTELIENNSDQETVISSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRR 339

Query: 285 CNSHESILSRKI---LSPSTPANLIMRPTYQSVWQKKAIVTKPTI-SCSTSNSTASPTIG 340
           CNSHESILS K+      +  +N   R  + S +       +PT+ S ST+++   P + 
Sbjct: 340 CNSHESILSTKLENTFYKNVGSNFYDRFIFSSFY-------RPTVASVSTTSTNIEPFLS 392

Query: 341 -----SPH--------------LSKDMLSQFVTAPPSKK-------------YRGWXXXX 368
                SP+               S+++LS+F   P   K             +  W    
Sbjct: 393 DGKNESPNKNLQLPLTSSTRGVTSRELLSKFADKPEQLKAPTTSNSNSSKYFFENWGLFS 452

Query: 369 XXXXXXXXXXQKWFNSDSLVTKEIGNPDNSSPSSGRPIVENRQRHXXXXXXXXXIVIGPN 428
                     +    S+ +++ E+G       +  +    N Q             I  N
Sbjct: 453 SMSSSSTFHRKNTSGSN-IISSEVGKKLCDRSTGIKVTSINTQN------AYTFPFIRSN 505

Query: 429 GAKFIR-GLNDPLVTCTVSYNELQEALNTE 457
                +  + +P++   VSYNEL +ALNTE
Sbjct: 506 SHDITKQNITNPIIKERVSYNELHDALNTE 535

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 149/309 (48%), Gaps = 60/309 (19%)

Query: 7   VAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQE--------YYSFLARLSSLK 58
           + ERL+IR  EA++QL+L IQR+       +S C    QE        Y  ++++L+SL 
Sbjct: 9   ITERLLIRSQEAILQLDLWIQRQQ-----RSSVCQTTDQELLDKVSKQYNQYMSQLNSLY 63

Query: 59  LRAEHVQESL-RHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVAR-----AYQSPTKX 112
           +R+E V++ L + Q++       E++ +E L+ EFQDIT+ LNE+A      A  SP   
Sbjct: 64  VRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQSQ 123

Query: 113 XXXXXXXXXXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQE- 171
                       P   LKIIER R  L   +P K               P K++V F   
Sbjct: 124 STRSSLESFQPRP---LKIIERQR--LCMVTPSK---------------PPKKSVGFNPI 163

Query: 172 DDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAK---KN 228
           +D+D         + NSLP SP        +  ++ H TLR AKS+D GLN   K    +
Sbjct: 164 NDVDC------PSKTNSLPCSP-------KKQPAKNH-TLRAAKSHDTGLNKSKKPSSAD 209

Query: 229 ADWEFFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISY--YLSQNEDQYPSKQVRRCN 286
           A   FFKN+ RLSL+   D   D   +    +V  PNIS   +++        + +RR N
Sbjct: 210 AYESFFKNRQRLSLTF-FDEMDDEDFDSDQDTVILPNISTPPHVNVTAKGAEFEPLRRYN 268

Query: 287 SHESILSRK 295
           SHESILS K
Sbjct: 269 SHESILSNK 277

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 130/514 (25%), Positives = 218/514 (42%), Gaps = 139/514 (27%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLELSIQRK------------MCEFDPNNSHCFIQ----- 43
           M  ++ ++ERL++R  EA++QL++ IQR+              +    N++  I+     
Sbjct: 1   MSLLQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQ 60

Query: 44  -VQEYYSFLARLSSLKLRAEHVQESL--------RHQRKDPNDVCIEYETLEKLIYEFQD 94
            +++Y +++A+L+SL++R E ++++L        R+Q+ + N+   E + ++ L++EFQD
Sbjct: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120

Query: 95  ITMSLNEVARAYQSPTKXXXXXXXXXXXVIPL--KTLKIIERNRDSLIGTSPMKKSLSQL 152
           IT  L+E++   ++P+            +     K L+II R               S  
Sbjct: 121 ITQKLSELS-TVRNPSTASSRSTSTKSSIESFKPKPLRIISR---------------SNT 164

Query: 153 KKEEHNQSLPAKRNVRFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLR 212
               H Q+   K+ V F ED+ +                S      +ES       K+LR
Sbjct: 165 HSHLHQQTSLDKK-VSFNEDESN---------------SSISHSRSMES--LHENSKSLR 206

Query: 213 MAKSYDVGLNGRAKKNADW-EFFKNKNRLSLSVFDD---VNTDA---------SDEETVI 259
             KS DV      K ++D+ +   ++ RLS+++FDD    N D          SD+ TVI
Sbjct: 207 NTKSMDVLKRSTFKNHSDFSKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVI 266

Query: 260 SVSPPNISYYLSQNEDQYPSKQVRRCNSHESILSRKILSPSTPANLIM------RPTYQS 313
           S   P       +  D   +  +RR NSHESILS +  + S   N I+      +P+ QS
Sbjct: 267 SHGTP------IRGAD---TPLLRRYNSHESILSFRKPTQSRQPNQILPYSSVRQPSMQS 317

Query: 314 VWQKKAIVTKPTISCSTSNSTASPTIGSPHLSKDMLSQFVTAP-PSKKYRGWXXXXXXXX 372
           V    A+ + P  S    N+T          SKD+LS F+  P P++ ++          
Sbjct: 318 V----AVNSNPIFSRMRPNAT----------SKDLLSSFINKPQPNRLHQ-----QKPKP 358

Query: 373 XXXXXXQKW--FNSDSLVTKEIGN------PDNSSPSSGRPIVENRQRHXXXXXXXXXIV 424
                  KW  FN  + VT EIG       P NSS S+                      
Sbjct: 359 NSNSLFGKWNFFNKFNSVTSEIGTTTTQLYPTNSSMSNK--------------------- 397

Query: 425 IGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEF 458
             PN       + +P+   ++   +L +ALNTE 
Sbjct: 398 FNPNDIPSSASIREPVFDDSLHLEDLNDALNTEL 431

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 84.0 bits (206), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 116/478 (24%), Positives = 210/478 (43%), Gaps = 49/478 (10%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLELSI--QRKMCEFDPNNSHCFIQ-----VQEYYSFLAR 53
           ME +  +A+  + R  EA+++LE  +  QR++ E + ++  C  +     + +YYS+L +
Sbjct: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSD-QCLSEESSSTIVQYYSYLGQ 59

Query: 54  LSSLKLRAEHVQESLRHQRKD-PNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKX 112
           L+ L ++A+ +++ + ++    PN      E +E+L ++++ +    NE+    ++    
Sbjct: 60  LNCLYIKAQSLKDMMGNRCGHLPNST---QEAIERLEHDYKALCNHANELGIREKNLEDS 116

Query: 113 XXXXXXXXXXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQED 172
                         K LKIIER R +   TSP K   + +  +   +S    +N  +  D
Sbjct: 117 PSCLSPASVSSFQPKPLKIIER-RLAQTNTSPTKVCTATVMAKSFCRS-GTDKNSDYIPD 174

Query: 173 DLDILHHLHSVKRANSL-PGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNAD- 230
           +         + + NS    SP  +         +E K +R+ KS   GLN  +  + + 
Sbjct: 175 E---------IGKTNSCNTNSPCTNEA------KKEPKFIRVVKSCGTGLNKHSNPHENR 219

Query: 231 WEFFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISYYL---SQNEDQYPSKQV---RR 284
             FF+++ RLS+S  +D +   SDEET+ S SP N S+ L   ++     P++ +   R 
Sbjct: 220 LSFFRDRQRLSISFIED-DEYLSDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRH 278

Query: 285 CNSHESILSRKILSPSTPANLIMRPTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSPHL 344
             ++E       +SP    +L+ + T  +     +I  +P           SP       
Sbjct: 279 VENNERGAQTAAVSPF--VSLVPKKTCTAQIGLTSIDIRPDF-----GPCFSPKKFETTE 331

Query: 345 SKDMLSQFVTAPPSKKYRGWXXXXXXXXXXXXXXQKWFNSDSLVTKEIGNPDNSSPSSGR 404
           SK++LS FV   P  K   W               K FN+  LVT E G  +    +S +
Sbjct: 332 SKEILSHFVIKEPRTKSHSWLKGCDKSVPFLQTF-KIFNNQVLVTSETGCRNVDRTTSTK 390

Query: 405 PIVENRQ---RHXXXXXXXXXIVIGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEFN 459
            I  +R+   +          +V G +G++F+       +   VSY  L+EALNT+ N
Sbjct: 391 LITPSRKHFAQRELSDRTCSILVHGSSGSRFVNAPQQQELHFKVSYEALREALNTDLN 448

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 119/478 (24%), Positives = 197/478 (41%), Gaps = 111/478 (23%)

Query: 7   VAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQEYYSFLARLSSLKLRAEHVQE 66
           V++ L+ R  EAV QLE  ++++             Q+ +  +   +L+SL  +++++  
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQE------------QLHQTTAEYKQLNSLCAKSKYISN 52

Query: 67  SLRHQRKD-PNDVCIEYE---TLEKLIYEFQDITMSLNEVARAYQSPTKXXXXXXXXXXX 122
            L+      P+D+  + E    +E LI+EF +I+  LNE+   + SP             
Sbjct: 53  LLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIV-THTSPQSTIDSFEP---- 107

Query: 123 VIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILHHLHS 182
               K L ++ +N+   I  SP + S             P  R  R +      L  +H+
Sbjct: 108 ----KPLNLLRKNK---ILESPTRSS-------------PVTRG-RLERKISINLFPMHT 146

Query: 183 VKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNADW-EFFKNKNRLS 241
             + NS+P SP   +       +   +TLR  KSY  GLNG      D+   FK  NRLS
Sbjct: 147 TTKCNSVPTSPKCKS-----TSTLNQRTLRNIKSYHYGLNG------DYINPFKENNRLS 195

Query: 242 LSVFDDVNT----------DASDEETVISVSPPNISYYLSQNEDQYPSKQVRRCNSHESI 291
           +S F+  NT          D  D++TV+  SP     +L+      P ++++R NS +S+
Sbjct: 196 ISFFNGDNTFNDNNSDSESDIDDDDTVLVTSP-----FLTN-----PKQKLKRSNSQDSV 245

Query: 292 LSRKILSPSTPANLIMRPTYQSVWQK-KAIVTKPTISCSTSNSTASPT--IGSPHLSKDM 348
              +        N + +P++Q       + +TKPT   S++      T  +GS   SK +
Sbjct: 246 FWNE--------NYLRKPSFQKQLNLFPSTLTKPTAELSSTQVFLKNTGRLGSS--SKAL 295

Query: 349 LSQFVTAPPSKKYRGWXXXXXXXXXXXXXXQKWFNSDSLVTKEIGNPDNSSPSSGRPIVE 408
           L+ FV     ++ R                   FNS   VT EIG     S      I+ 
Sbjct: 296 LTSFVKDNLQQQQR---------THNASSFNNIFNS---VTSEIG----KSKLDKSQIIH 339

Query: 409 NRQRHXXXXXXXXXIVIGPNGAKF--------IRGLNDPLVTCTVSYNELQEALNTEF 458
             +R           +I    ++F        I     P++   V Y++L +ALNTEF
Sbjct: 340 TERRVLSDNSIVISTLITSKKSRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTEF 397

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 117/498 (23%), Positives = 199/498 (39%), Gaps = 86/498 (17%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLELSIQRK----------MCEFDPNNSHCFIQVQEYYSF 50
           ME ++ +A+  +     A+ +L+  ++R+           C  D ++++    + +YY +
Sbjct: 1   MEQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTN----MAQYYEY 56

Query: 51  LARLSSLKLRAEHVQESLRHQRKDPNDVC-IEYETLEKLIYEFQDITMSLNEVARAYQSP 109
           + +L SL  +A+ + +++     D   +  ++   +E LI EFQ+I  + +E   +Y   
Sbjct: 57  IGQLYSLYTKAQKLSDTVI--LSDSKSLSSVQQRAIENLIQEFQEIAKN-DENFISYSMR 113

Query: 110 TKXXXXXXXXXXXVIPLKTLKIIERNRDSLIGTSPMKKS----LSQL--KKEEHNQSLPA 163
                          P K LKI++R +  L   SP K+S    +S L  + +E N +  +
Sbjct: 114 ESPNSMSVQSICSFQP-KPLKILQRRQAQL--ESPTKRSFRPSMSLLDNRGDETNLATAS 170

Query: 164 KRNV-RFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLN 222
            R+  R        +H           P     DTL            +R AKS D GLN
Sbjct: 171 DRSQERLLGSSPSSIHFFR--------PSHTNADTLF-----------IRSAKSCDAGLN 211

Query: 223 GRAKKNAD-WEFFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISYYLSQNEDQYPSKQ 281
            R+  + +   FFK++ RLS+S  +D   D SDE TVIS      +Y    +    P K 
Sbjct: 212 RRSNPHENRLNFFKDRQRLSISFIED-EEDVSDEATVISAGSLQSAYIFETDIKSSPFK- 269

Query: 282 VRRCNSHESILSRKILSPSTPANLIMRPTYQSVWQK--------KAIVTKPTISCSTSNS 333
                    I  ++I  P        +  Y +V +K         A  + P I  +  + 
Sbjct: 270 -------SQIGEKEIRIP--------KAGYLAVGEKSKGFNNLLSATPSAPQIGITEVD- 313

Query: 334 TASPTIGSPH---------LSKDMLSQFVTAPPSKKYRGWXXXXXXXXXXXXXXQKWFNS 384
              P  G  H          SK MLSQ V+     K + W               +  N+
Sbjct: 314 -YKPNFGFSHQPGVEREASQSKKMLSQLVSQGNKTKCKNWFNECDGLGKPISNTLRLLNN 372

Query: 385 DSLVTKEIGNPDNSSPSSGRPIVENRQRHXXXXXXXXXIVI--GPNGAKFIRGLNDPLVT 442
             LVT E G    ++ +S + ++  R+R           +   G + +KF+       + 
Sbjct: 373 LVLVTSETGLRSVNNTTSAKLLMPPRKRKEKQAAHGSCSIFIHGSSRSKFVTAPQQTKLH 432

Query: 443 CTVSYNELQEALNTEFNF 460
             VS+  LQEALNT+ +F
Sbjct: 433 FKVSHGALQEALNTDLDF 450

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 139/328 (42%), Gaps = 67/328 (20%)

Query: 7   VAERLVIRCNEAVMQLELSIQRKMC-----EFDPNNSHCFIQVQ-EYYSFLARLSSLKLR 60
           V+ RL+ +  EAV+QL+L I+ +           + S    Q + +Y  ++ +L+SL LR
Sbjct: 7   VSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLYLR 66

Query: 61  AEHVQESLRHQRK---DPNDVCIE----YETLEKLIYEFQDITMSLNEVARAYQSPTKXX 113
           A+++++ +  Q       +DV       +  +++L+ EF  +++ +NE++   ++ T   
Sbjct: 67  AQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQENVTNGS 126

Query: 114 XXXXXXXXXVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQED- 172
                      PL        +  S I      + L  L++++HN +    +N   Q D 
Sbjct: 127 S----------PLSNKSSHSNDSLSKITDGFQPRPLKILQRQKHNNN----QNTHPQPDL 172

Query: 173 --DLDILHH-----LHSVKRANSLP----------GSPMPDTLLESQMFSREHKTLRMAK 215
              L + H      L S  +  S P           + +   +   ++ S E  T  +A 
Sbjct: 173 ESPLKLKHRSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTFSVA- 231

Query: 216 SYDVGLNGRAKKNAD---WEFFKNKNRLSLSVFDDV-NTDASDEETVIS------VSPPN 265
                 N R K + D   +  FK  NRLS+   D   N D  D+ T IS      VS P 
Sbjct: 232 ------NTRNKNSMDPLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVSTPK 285

Query: 266 ISYYLSQNEDQYPSKQVRRCNSHESILS 293
           I+  +        S+ +R+ NSHESILS
Sbjct: 286 IASSIKNT-----SEPLRKFNSHESILS 308

>Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to
           XP_452214  K. lactis KLLA0C00462g
          Length = 462

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 116/502 (23%), Positives = 195/502 (38%), Gaps = 102/502 (20%)

Query: 6   YVAERLVIRCNEAVMQLELSIQRKMCEFD---------PNNSHCFI-------------- 42
           Y   RL+ RC E+++ L L IQ     F+          N  +C I              
Sbjct: 6   YEIHRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCG 65

Query: 43  -----QVQEYYSFLARLSSLKLRAEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITM 97
                Q++ Y S +A L SL +RA+ + +      K  +   I+ +T++KL  EF+DI+ 
Sbjct: 66  DQRTEQMRRYQSSMAHLMSLSIRAQFLIDKFH---KGGSGYQIDLDTVKKLGSEFEDISH 122

Query: 98  SLNEVARAYQSPTKXXXXXXXXXXXV-----IPLKTLKIIERNRDSLIGTSPMKKSLSQL 152
           +L      +  P K                   L+ LK+++R R+         +S   L
Sbjct: 123 NL-----CFLEPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIRN-----PSENESKDNL 172

Query: 153 KKEEHNQSLPAKRNVRFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLR 212
           +  E   S P + N  F   DL+           +SL G      L+    FS   + L 
Sbjct: 173 RIYE--GSAPQRDNPSF---DLN--------SSLSSLHG------LVVGADFSVIRQGLM 213

Query: 213 MAKSYDV---GLNGRAKKNADWEFFKNKNRLSLSVFDDVNTDASDEETVISVSPPNI--S 267
              S+++    ++    +N +   F+ K+  S   FD +  + SD+ETV+S+S  ++   
Sbjct: 214 NWNSFEMHIPNVDALMPQNLN---FQEKSEFSTPFFDSLECN-SDDETVMSISRLDLDTC 269

Query: 268 YYLSQNEDQYPSKQVRR--CNSHESILSRK---ILSPSTPANLIMRPTYQSVWQKKAIVT 322
            ++S       S Q +R   + ++ I  R    I    TP    +    Q +  + AIV 
Sbjct: 270 SFVS------ASSQSKRFSISDYDRIACRHGSTIEVLGTPPFFNLNHNIQEL-ARTAIVG 322

Query: 323 KPTISCSTSNSTASPTIGSPHLSKDMLSQFV-----TAP-PSKKYRGWXXXXXXXXXXXX 376
              + CS S             S+D+L++FV     T P P+ K                
Sbjct: 323 SSYV-CSFSTRYKMNHFKKAVTSRDLLTKFVEPVTTTKPLPAAKENHLHWWPIINLSGIL 381

Query: 377 XXQKWFNSDSLVTKEIGNPDNSSPSS-------GRPIVENRQRHXXXXXXXXXIVIGPNG 429
              K  N  + VT E    + +S ++       G+  +EN Q H         + + PNG
Sbjct: 382 TKCKIRNHGNPVTSESCPHEETSETANQILKHTGKSTLEN-QAHIRSEVSQCSLFLEPNG 440

Query: 430 AKFIRGLNDPLVTCT-VSYNEL 450
           +KF+       V C+ +SY+ L
Sbjct: 441 SKFVHQFGGEQVVCSEISYSSL 462

>AFR746C Chr6 complement(1806243..1807568) [1326 bp, 441 aa] {ON}
           NOHBY669; No homolog in Saccharomyces cerevisiae
          Length = 441

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 55/118 (46%), Gaps = 20/118 (16%)

Query: 1   MEDMRYVAERLVIRCNEAVMQLELSI----------------QRKMCEFDPNNSHCFIQV 44
           M++++     L  R +E V+QL  S+                +  + E   + + C  + 
Sbjct: 1   MDELQRTVLALQTRSDELVLQLRSSVVECERVGRAEICGCAVRAALAEGICDGAMCEARR 60

Query: 45  QEYYSFLARLSSLKLRAEHVQESLRH--QRKDPNDVCI--EYETLEKLIYEFQDITMS 98
            E+Y+ L +L+SL++R EH+  ++R   +R + N   +  ++E L+ L  E   + M 
Sbjct: 61  WEFYALLMQLTSLRVRVEHISGTVRGMLRRGEWNLQAVRKQFEMLDALSDELDGLVMG 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,340,917
Number of extensions: 1990184
Number of successful extensions: 7417
Number of sequences better than 10.0: 65
Number of HSP's gapped: 7663
Number of HSP's successfully gapped: 65
Length of query: 460
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 347
Effective length of database: 40,524,141
Effective search space: 14061876927
Effective search space used: 14061876927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)