Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00440g1.3ON37737718180.0
SAKL0C00418g1.3ON3643308421e-110
Skud_3.11.3ON3603308341e-109
TPHA0E040401.3ON3573568251e-108
YCL064C (CHA1)1.3ON3603298251e-108
KAFR0D001101.3ON3653498241e-107
NCAS0B091301.3ON3673328251e-107
NDAI0A001201.3ON3773388221e-107
Smik_3.121.3ON3603298201e-107
KNAG0C001801.3ON3593268141e-106
Suva_3.1501.3ON3613298111e-106
Kpol_2002.61.3ON3503258091e-105
CAGL0B00286g1.3ON3603297951e-103
NDAI0K02950singletonON3343307931e-103
TBLA0A049201.3ON3603407941e-103
ZYRO0F15774gsingletonON4103617951e-103
NCAS0A15330singletonON3473407691e-99
KAFR0I00130singletonON3443327682e-99
KLTH0F00440g1.3ON3413337663e-99
KAFR0F04430singletonON3433327561e-97
Ecym_10061.3ON3643387328e-94
SAKL0C13904gsingletonON3393307211e-92
TDEL0D06540singletonON3373317021e-89
ZYRO0F18524g1.3ON3353276951e-88
Skud_9.2na 1ON3393286951e-88
KLLA0E01805gsingletonON3223266913e-88
KNAG0D05380singletonON3343256924e-88
Scer_YGOB_SDL1 (SDL1)na 1ON3373376915e-88
AFR747W1.3ON4263336952e-87
Smik_9.2na 1ON3383286863e-87
KNAG0A01150singletonON2312224661e-55
YIL167W (SDL1)singletonOFF2101974632e-55
YIL168WsingletonOFF1271262321e-22
SAKL0F11858g7.367ON5622951426e-09
Ecym_47087.367ON5703421241e-06
KLLA0E19779g7.367ON5672951203e-06
ZYRO0B02772g7.367ON5692651194e-06
TBLA0C050707.367ON5752951105e-05
Kpol_530.167.367ON5662651062e-04
ACR232C7.367ON5602911052e-04
KAFR0K017007.367ON5793131043e-04
SAKL0A10626gsingletonON3202821024e-04
TPHA0F031307.367ON5682951034e-04
TDEL0C018007.367ON569265960.003
NDAI0A018107.367ON570265930.006
CAGL0I05126g7.367ON571265920.008
YER086W (ILV1)7.367ON576261910.011
Skud_5.2057.367ON576265900.015
KLTH0B04884g7.367ON573295900.016
Smik_5.2257.367ON576261890.017
Suva_5.1997.367ON576265890.018
Skud_11.2na 2ON326303880.022
NCAS0A142307.367ON569265880.027
YKL218C (SRY1)na 2ON326309870.028
KNAG0C036907.367ON577265870.031
Kwal_33.148227.367ON562295830.098
TBLA0F035908.193ON54529721.9
KAFR0F021703.156ON80468686.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00440g
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   704   0.0  
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   328   e-110
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   325   e-109
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   322   e-108
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   322   e-108
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   322   e-107
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    322   e-107
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   321   e-107
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   320   e-107
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   318   e-106
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   317   e-106
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   316   e-105
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   310   e-103
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             310   e-103
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   310   e-103
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   310   e-103
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            300   1e-99
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   300   2e-99
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   299   3e-99
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              295   1e-97
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   286   8e-94
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   282   1e-92
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            275   1e-89
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   272   1e-88
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      272   1e-88
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   270   3e-88
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   271   4e-88
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   270   5e-88
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   272   2e-87
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      268   3e-87
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   184   1e-55
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   182   2e-55
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...    94   1e-22
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    59   6e-09
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    52   1e-06
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    51   3e-06
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    50   4e-06
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    47   5e-05
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    45   2e-04
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    45   2e-04
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    45   3e-04
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    44   4e-04
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    44   4e-04
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    42   0.003
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    40   0.006
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    40   0.008
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    40   0.011
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    39   0.015
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    39   0.016
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    39   0.017
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    39   0.018
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    39   0.022
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    39   0.027
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    38   0.028
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    38   0.031
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    37   0.098
TBLA0F03590 Chr6 (886359..887996) [1638 bp, 545 aa] {ON} Anc_8.1...    32   1.9  
KAFR0F02170 Chr6 complement(423846..426260) [2415 bp, 804 aa] {O...    31   6.2  

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/377 (91%), Positives = 346/377 (91%)

Query: 1   MYVHIFPTSYSQTSINRLIMKAQLFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRG 60
           MYVHIFPTSYSQTSINRLIMKAQLFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRG
Sbjct: 1   MYVHIFPTSYSQTSINRLIMKAQLFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRG 60

Query: 61  IGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIE 120
           IGHLISTKVEEIKKSSPEKIGHVF                  NVPCTVVVSNATRPRIIE
Sbjct: 61  IGHLISTKVEEIKKSSPEKIGHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIE 120

Query: 121 KIRSYGADVVVHGNHWKEADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEI 180
           KIRSYGADVVVHGNHWKEADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEI
Sbjct: 121 KIRSYGADVVVHGNHWKEADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEI 180

Query: 181 MDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASL 240
           MDVLASSKIPITKIKGIVCSF             QRYNLADKIPIVCVETKGTDVLSASL
Sbjct: 181 MDVLASSKIPITKIKGIVCSFGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASL 240

Query: 241 RVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIV 300
           RVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIV
Sbjct: 241 RVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIV 300

Query: 301 AEPGCGATLYFGYNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLKELSSFTNCEFEL 360
           AEPGCGATLYFGYNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLKELSSFTNCEFEL
Sbjct: 301 AEPGCGATLYFGYNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLKELSSFTNCEFEL 360

Query: 361 PSTGVSRLNSHSLHTLQ 377
           PSTGVSRLNSHSLHTLQ
Sbjct: 361 PSTGVSRLNSHSLHTLQ 377

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  328 bits (842), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 217/330 (65%), Gaps = 4/330 (1%)

Query: 24  LFSKTPLLKHQFKRS---KGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKI 80
            +SKTPLL+  F  S     PQ L+KYE  QPSGSFKSRGIGHLI+     I+ S   K 
Sbjct: 4   FYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIE-SEGNKT 62

Query: 81  GHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEAD 140
            HVF                  ++PCTVVV   T  R++ KIR  GADV+VHGNHW +AD
Sbjct: 63  AHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDAD 122

Query: 141 SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCS 200
            ++   +M  +D+ K+EP+Y+HPFDNP+IWEGHS +VDEI++ L   +IP +++KGIVCS
Sbjct: 123 QYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCS 182

Query: 201 FXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGT 260
                         ++++LA  IPI+ VETKG +V   SL+ G P+ F+KI+S ATSLGT
Sbjct: 183 IGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGT 242

Query: 261 ATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQN 320
           ATI     +N  ++ +KS V+SD +V+ TCL F++DTNIV EP CGA+L+FGYN   L++
Sbjct: 243 ATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLLED 302

Query: 321 ILGSDIKDDDYVILIGCGGSSTSLEDLKEL 350
            LG  +  +D +I+I CGGSST+++DL+++
Sbjct: 303 TLGGSLGPEDIIIVIACGGSSTTVQDLQQM 332

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  325 bits (834), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 224/330 (67%), Gaps = 9/330 (2%)

Query: 24  LFSKTPLLKHQFKRSKGP-QVLLKYEFLQPSGSFKSRGIGHLI---STKVEEIKKSSPEK 79
           +++KTPLL+ QF  SK P Q  LKYE LQPSGSFKSRGIG+LI   + ++++  + SP+ 
Sbjct: 4   VYNKTPLLR-QFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQ- 61

Query: 80  IGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEA 139
              VF                  ++PCTVVV  AT+ R++EKIR+ GA V+V+G +WKEA
Sbjct: 62  ---VFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEA 118

Query: 140 DSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVC 199
           D+F+K ++M ++DS   EPIY HPFDNP IWEGHS MVDEI+  L S +I + K+KGIVC
Sbjct: 119 DTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVC 178

Query: 200 SFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLG 259
           S              +RY+LADKIPIV VET G  V + SLR+G PV+F+KI+S ATSLG
Sbjct: 179 SVGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLG 238

Query: 260 TATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQ 319
           TA IS   ++   ++ +KS VI D +VI TCL++++  N+VAEP CGA L+ GY+ + L+
Sbjct: 239 TAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILE 298

Query: 320 NILGSDIKDDDYVILIGCGGSSTSLEDLKE 349
             LGS +  DD VI+I CGGSS +++DL+E
Sbjct: 299 KALGSKLAADDIVIIIACGGSSNTVQDLEE 328

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  322 bits (825), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 160/356 (44%), Positives = 231/356 (64%), Gaps = 7/356 (1%)

Query: 22  AQLFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIG 81
           +Q+++KTPLL+H F     PQV LKYE  QPSGSFKSRGIG+LI +   EI+K+S +K  
Sbjct: 2   SQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNS-KKSP 60

Query: 82  HVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS 141
            VF                  ++PCTVVV  AT+ R++EKI++ GA+V+V GNHWKEAD+
Sbjct: 61  EVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120

Query: 142 FMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSF 201
           ++K +++  +D    EPIY HPFDN  IWEGH+ M+DEI++      IPI K+K IVCS 
Sbjct: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180

Query: 202 XXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTA 261
                        ++++LA KIP+V VET G  V + SL++G  ++FEKI++ ATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240

Query: 262 TISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNI 321
            IS   ++  K++ +KS V+ D +V+ TCL+F+ D+N+VAEP CGA L+ GYN+D L+  
Sbjct: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300

Query: 322 LGSDIKDDDYVILIGCGGSSTSLEDLKELSSFTNCEFELPSTGVSRLNSHSLHTLQ 377
           LG  +  DD V++I CGGSS ++++L+  +S T    EL +    + N    H+L+
Sbjct: 301 LGKKLATDDIVLIIACGGSSNTVQELE--ASLT----ELKNKSNEKENYSIFHSLR 350

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  322 bits (825), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 217/329 (65%), Gaps = 7/329 (2%)

Query: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLI---STKVEEIKKSSPEKI 80
           +++KTPLL+  F      Q  LKYE LQPSGSFKSRGIG+LI   + ++++  K SP+  
Sbjct: 4   VYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQ-- 61

Query: 81  GHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEAD 140
             VF                  ++PCTVVV  AT+ R+++KIR+ GA V+V G +WKEAD
Sbjct: 62  --VFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEAD 119

Query: 141 SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCS 200
           +F+K ++M K+DS   EPIY HPFDNP IWEGHS M+DEI+  L S  I + K+KGIVCS
Sbjct: 120 TFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCS 179

Query: 201 FXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGT 260
                         +RY LAD+IPIV VET G  V + SL++G PV+F+KI+S ATSLGT
Sbjct: 180 VGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGT 239

Query: 261 ATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQN 320
           A IS   ++  +++ ++S VI D +VI TCL++++  N+V EP CGA L+ GYN   L+N
Sbjct: 240 AVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILEN 299

Query: 321 ILGSDIKDDDYVILIGCGGSSTSLEDLKE 349
            LGS +  DD VI+I CGGSS +++DL+E
Sbjct: 300 ALGSKLAADDIVIIIACGGSSNTIKDLEE 328

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  322 bits (824), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/349 (45%), Positives = 224/349 (64%), Gaps = 11/349 (3%)

Query: 24  LFSKTPLLKHQFKRSKG------PQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSP 77
           +++KTPLL+  F  +K       PQ  LKYE LQPSGSFKSRGIG+LI  +  +I K   
Sbjct: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63

Query: 78  EKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWK 137
           ++   VF                  ++PCTVVV  AT+ R+IEKI+  GA+V++ G  WK
Sbjct: 64  KR-PEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWK 122

Query: 138 EADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGI 197
           EAD ++K+ +M K++  + +PIY HPFDNPLIWEGHS +VDEIMD L   K+  + IKGI
Sbjct: 123 EADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGI 182

Query: 198 VCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATS 257
           VCS              +R+ L DKIP+V VET+G  V + SL++G  VEFEKI+S ATS
Sbjct: 183 VCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIATS 242

Query: 258 LGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDK 317
           L TA+IS   ++N  ++G++S ++ D +VI TCL+++ D N+V EP CGA+++  YNID 
Sbjct: 243 LATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNIDI 302

Query: 318 LQNILGSDIKDDDYVILIGCGGSSTSLEDLKE----LSSFTNCEFELPS 362
           L+N LG+ +  DD V++I CGGSS +L+D++E    L S  N    LP+
Sbjct: 303 LENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPN 351

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  322 bits (825), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 217/332 (65%), Gaps = 7/332 (2%)

Query: 24  LFSKTPLLKHQFK------RSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSP 77
           +++KTPLL+  F        +  PQ  LKYE LQPSGSFKSRGIG+LI      IKKS  
Sbjct: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSG- 62

Query: 78  EKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWK 137
            K   VF                  ++PCTVVV  AT+ R++EKIR+ GA+V+++G HWK
Sbjct: 63  NKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWK 122

Query: 138 EADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGI 197
           EAD+++K  +M  +D    EPIY HPFDNP IWEGHS MVDEI+D L    I + KIKGI
Sbjct: 123 EADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGI 182

Query: 198 VCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATS 257
           VCS              +++ LADKIPIV VETKG  V + SL++G  +EF KI+S ATS
Sbjct: 183 VCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATS 242

Query: 258 LGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDK 317
           LGTA+IS+  ++  K++ ++S V+ DT+VI TCL+++ D N+VAEP CGA+L+  YN + 
Sbjct: 243 LGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNTNI 302

Query: 318 LQNILGSDIKDDDYVILIGCGGSSTSLEDLKE 349
           L+N LG  +  DD +++I CGGSS +++DL+E
Sbjct: 303 LENALGHKLSSDDIILVIACGGSSNTVQDLEE 334

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  321 bits (822), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 212/338 (62%), Gaps = 12/338 (3%)

Query: 24  LFSKTPLLKHQFKRSKG-----------PQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           +++KTPLL+  F+ S             PQ  +KYE LQPSGSFKSRGIG+LI      I
Sbjct: 4   VYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSAMNI 63

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
            K   +K   VF                  ++PCTVVV  AT+ R++EKI+S GA+V+++
Sbjct: 64  NKIG-QKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVIIN 122

Query: 133 GNHWKEADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPIT 192
           G HWKEAD F+K  +M K+D+   EPIY HPFDNPLIWEGH+ MVDEIMD L    IPI 
Sbjct: 123 GAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIPIN 182

Query: 193 KIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKIS 252
           K+KGIVCS              Q+YNLADKIPIV VETKG  V + SL++   +EF KI+
Sbjct: 183 KVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSKIT 242

Query: 253 SCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFG 312
           S ATSLGTA IS   ++  +++ ++S VI D  VI TCL+++ D N+V EP CGA+++  
Sbjct: 243 SIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIHLA 302

Query: 313 YNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLKEL 350
           Y+ D L+  LG  +  DD +++I CGGSS +  DL+ L
Sbjct: 303 YHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESL 340

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  320 bits (820), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 216/329 (65%), Gaps = 7/329 (2%)

Query: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLI---STKVEEIKKSSPEKI 80
           +++KTPLL+  F      Q  LKYE LQPSGSFKSRGIG+LI   + ++++  K SP+  
Sbjct: 4   VYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQ-- 61

Query: 81  GHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEAD 140
             +F                  ++PCTVVV  AT+ R++EKIR+ GA V+V G +WKEAD
Sbjct: 62  --IFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEAD 119

Query: 141 SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCS 200
           +F+K  +M+K+D+   EPIY HPFDNP IWEGHS MVDE++  L   +I + K+KGIVCS
Sbjct: 120 TFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCS 179

Query: 201 FXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGT 260
                         +RY LADKIPIV VET G  V + SLR+G PV+F+KI+S ATSLGT
Sbjct: 180 VGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGT 239

Query: 261 ATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQN 320
           A IS   +   +++ ++S VI D +VI TCL++++  N+V EP CGA L+ GYN + L+ 
Sbjct: 240 AVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILER 299

Query: 321 ILGSDIKDDDYVILIGCGGSSTSLEDLKE 349
            LGS +  DD VI+I CGGSS +++DL+E
Sbjct: 300 ALGSKLAADDIVIIIACGGSSNTIQDLEE 328

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  318 bits (814), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 215/326 (65%), Gaps = 1/326 (0%)

Query: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83
           +++KTPLL+  F     PQ+ LKYE LQPSGSFKSRGIG+LI      I+K   E+  HV
Sbjct: 4   VYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIG-ERRAHV 62

Query: 84  FXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143
           F                  ++PCTVVV  AT+ R++EKIR+ GA V+V+G HWKEAD  +
Sbjct: 63  FASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHL 122

Query: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXX 203
           K+ +M ++D    EPIY HPFDNP IWEGH+ +VDEIM+ L S KI    +KGIVCS   
Sbjct: 123 KKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGG 182

Query: 204 XXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263
                      +++ LA+KIPIV VET+G  VL+ SL +   +EFEKI+S ATSLGTA+I
Sbjct: 183 GGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASI 242

Query: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323
           S   ++  K++ ++S V+ D++VI TCL+++ D N+VAEP CGA L+  YN+D L+  LG
Sbjct: 243 SKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALG 302

Query: 324 SDIKDDDYVILIGCGGSSTSLEDLKE 349
             +  +D +++I CGGSS +L+DL++
Sbjct: 303 HSLTPNDVILVIACGGSSNTLKDLED 328

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  317 bits (811), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 217/329 (65%), Gaps = 7/329 (2%)

Query: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLI---STKVEEIKKSSPEKI 80
           +++KTPLL+  F      Q  LKYE LQPSGSFKSRGIG+LI   + ++++  K SP+  
Sbjct: 4   VYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQ-- 61

Query: 81  GHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEAD 140
             VF                  ++PCTVVV  AT+ R++EKIR+ GA V+V+G  WKEAD
Sbjct: 62  --VFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEAD 119

Query: 141 SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCS 200
           +++K ++M  +D    EPIY HPFDNP IWEGHS MVDEI+  L S ++P+ K+KGIVCS
Sbjct: 120 TYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCS 179

Query: 201 FXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGT 260
                         +R+ LADKIPIV VETKG  V + SLR+G PV+F+KI+S ATSLGT
Sbjct: 180 VGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGT 239

Query: 261 ATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQN 320
           A IS   ++  +++ +KS V+ D +VI TCL++S+  N+V EP CGA L+ GY+ D L+ 
Sbjct: 240 ANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILET 299

Query: 321 ILGSDIKDDDYVILIGCGGSSTSLEDLKE 349
            L + +  DD V++I CGGSS +++DL+E
Sbjct: 300 ALDTKLAADDIVLIIACGGSSNTVQDLEE 328

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  316 bits (809), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 218/325 (67%), Gaps = 1/325 (0%)

Query: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83
           +++KTPLLKH F     PQ  LKYE LQPSGSFKSRGIG+LI      IKK + +K  +V
Sbjct: 4   VYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKK-PYV 62

Query: 84  FXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143
           F                  ++PCTVVV  AT+ R+++KIR+ GA+V++ GNHWKEAD+F+
Sbjct: 63  FSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFL 122

Query: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXX 203
           K+++M +++  K EPIY HPFDNPLIWEGHS MVDEIM+  +  K  I  +K IVCS   
Sbjct: 123 KQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVGG 182

Query: 204 XXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263
                      ++YNLADKIP+V VET+G  V + SL++  PVEF KIS+ ATSLGTA I
Sbjct: 183 GGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANI 242

Query: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323
           S   +   K++ +KS V+ D +V+ TCL+F++D N+V EP CGA ++ GY+ D L+  LG
Sbjct: 243 SNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLETALG 302

Query: 324 SDIKDDDYVILIGCGGSSTSLEDLK 348
           + +  DD V+++ CGGSS ++++L+
Sbjct: 303 TKLTCDDAVLIVACGGSSNTVKELE 327

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  310 bits (795), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 154/329 (46%), Positives = 218/329 (66%), Gaps = 4/329 (1%)

Query: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83
           +++KTPL++  F     PQ+ LK+E  QPSGSFKSRGIGHLIS + + I  +   K   V
Sbjct: 3   VYNKTPLIRQIFPSI--PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 84  FXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143
           F                  N+PCTVV+  AT+ R+ +KIR+ GA+V+V GN WKEAD+++
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 144 KEHLMKKLDSF--KYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSF 201
           K++++ KL+      EPIY HPFDNP IWEGH+ MVDEI++   +  IP+ KIK IVCS 
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 202 XXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTA 261
                        ++YNLADKIPIV VETKG  V + SLR+   V F+KI+S ATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 262 TISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNI 321
            IST A++  KR+G+KS V+SD +V+ TCL++++D N+V EP CGA ++  Y+ + L+  
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 322 LGSDIKDDDYVILIGCGGSSTSLEDLKEL 350
           LG+ +  DD V+++ CGGSS ++ED++ +
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESI 329

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  310 bits (793), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/330 (44%), Positives = 221/330 (66%), Gaps = 3/330 (0%)

Query: 24  LFSKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGH 82
           +++KTPLL+  F  +K GP++ LKYE LQPSGSFKSRGIG LI   + ++K+    K  H
Sbjct: 4   IYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDG-NKTAH 62

Query: 83  VFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSF 142
           VF                   VPCTVVV  +T+ R++ KIR  GA V++ G+HWKEAD F
Sbjct: 63  VFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEADDF 122

Query: 143 MKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFX 202
           +++  MK++D+ + +PIY HPFD+P+IWEGHS ++DEI+  L + KI I K+KGI+CS  
Sbjct: 123 LRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIICSVG 181

Query: 203 XXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTAT 262
                       +R+NLA  IP++ VETKG DVL+ SL+ G PV+  KI+S ATSLG+  
Sbjct: 182 GGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLGSTY 241

Query: 263 ISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNIL 322
           IS+TA++N  ++ S+S  ++D +V+ TCL++++D ++  EP CGA+++  YN   +++ L
Sbjct: 242 ISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVESAL 301

Query: 323 GSDIKDDDYVILIGCGGSSTSLEDLKELSS 352
           G+ + + D VI++ CGGSS +L DL+ L+S
Sbjct: 302 GTALSNHDIVIVVLCGGSSCTLHDLESLNS 331

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  310 bits (794), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 149/340 (43%), Positives = 214/340 (62%)

Query: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83
           +++KTPLL+  F+ S  PQ  LKYE +QPSGSFKSRGIG+LI   +++I  S+  K   V
Sbjct: 4   VYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63

Query: 84  FXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143
           F                  ++PCTVVV  AT+ R++ KI+  GA V+V+G HW EAD ++
Sbjct: 64  FSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123

Query: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXX 203
           + H++ K+D  + EPIY HPFDNPLIWEGHS M+DEI++ L    I I  +K I CS   
Sbjct: 124 QNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIGG 183

Query: 204 XXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263
                      ++YNLA KIPI+ VET G  V + SL++   V+F KI++ ATSLGT+TI
Sbjct: 184 GGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTI 243

Query: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323
           S   ++N  ++ +KS V+ + +VI TCL+++ D N VAEP CGA L+  YN   ++N L 
Sbjct: 244 SAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENALD 303

Query: 324 SDIKDDDYVILIGCGGSSTSLEDLKELSSFTNCEFELPST 363
           + +  DD +I+I CGGSS ++++L+E       ++ LP T
Sbjct: 304 TTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQT 343

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  310 bits (795), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 160/361 (44%), Positives = 227/361 (62%), Gaps = 6/361 (1%)

Query: 15  INRLIMKAQ--LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           +N+ + +A   +++KTPLLK  F  +   QV +KYE LQPSGSFKSRGIGHLIS + ++I
Sbjct: 39  MNQAVFQAMPSIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDI 98

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
           +     K  HVF                  N+PCTVV+   T+ R+ +KIR  GA+VVV 
Sbjct: 99  QGDG-RKSPHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQ 157

Query: 133 GNHWKEADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPIT 192
           G+HWKEADS +K  L  +++    EPIY HPFDNP IWEGH+ +VDEI+  L +    + 
Sbjct: 158 GSHWKEADSHLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALN 217

Query: 193 KIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKIS 252
           ++KGIVCS              ++YNLA+KIP++ VETKG  VL+ SL+VG  VEF K++
Sbjct: 218 RVKGIVCSVGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMN 277

Query: 253 SCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFG 312
           S ATSL T+ IS+     V+++GSKS V+ D EV+ TCL+++ + N++ EP CGA+L+ G
Sbjct: 278 SVATSLCTSQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLG 337

Query: 313 YNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLKELSSFTNCEFELPSTGVSRLNSHS 372
           Y+   ++  LG ++  DD +I+I CGGSS ++ DL+E  S    E E P   + R  + S
Sbjct: 338 YHPQLIERALGKNLDKDDVIIVIACGGSSNTILDLEE--SLAKLE-EAPHLSIRRNATPS 394

Query: 373 L 373
           L
Sbjct: 395 L 395

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  300 bits (769), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 146/340 (42%), Positives = 214/340 (62%), Gaps = 10/340 (2%)

Query: 24  LFSKTPLLKHQF----KRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEK 79
           +++KTPLL+  F    K    PQ+ +KYE LQPSGSFKSRGIGHLI      +++   + 
Sbjct: 4   VYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLGGKS 63

Query: 80  IGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEA 139
           + HVF                   +PCTVVV  +T+ R++EKIR+ G +V+V G+HWKEA
Sbjct: 64  L-HVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWKEA 122

Query: 140 DSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVC 199
           DSF+K  ++  +D  + EPIY HPFD+P +WEGHS MVDEI+D   S  + + K+K IVC
Sbjct: 123 DSFLKNSVIPSVDRIE-EPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAIVC 181

Query: 200 SFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLG 259
           S              ++Y+LADKIP++ +ET G +  +A L+    VE  KI+S ATSLG
Sbjct: 182 SVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATSLG 241

Query: 260 TATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQ 319
              ++T A++N +R+ S S V+ D +V++TCL+++ND NI+ EP CGA+L+  YN   ++
Sbjct: 242 ATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKLIE 301

Query: 320 NILGSDIKDDDYVILIGCGGSSTSLEDL----KELSSFTN 355
             LG  +  DD +++I CGGS+ ++EDL    K+LS+  N
Sbjct: 302 KALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAEAN 341

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  300 bits (768), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 212/332 (63%), Gaps = 7/332 (2%)

Query: 24  LFSKTPLLKHQFK----RSKG--PQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSP 77
           +++KTPL+   F     RS    PQVL+KYE+LQPSGSFKSRGIG+L+  K  +I+K+S 
Sbjct: 4   VYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQKNS- 62

Query: 78  EKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWK 137
            K   VF                  ++PCTVVV  AT+ R+IEKIRS GA V +HG  WK
Sbjct: 63  TKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTFWK 122

Query: 138 EADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGI 197
            AD +MK  ++ ++++ K EPIY HP D+PLIWEG+S +VDE+M+ L   KI  +K+K I
Sbjct: 123 GADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVKAI 182

Query: 198 VCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATS 257
           VCS              +RY LADKIPIV VET G+ V +  L+ G  +EFEKIS+ ATS
Sbjct: 183 VCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVATS 242

Query: 258 LGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDK 317
           LG+A+I+   ++   ++  +  ++ D EV+ TCL+++ D N++ EP CGA ++  Y++D 
Sbjct: 243 LGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHVDI 302

Query: 318 LQNILGSDIKDDDYVILIGCGGSSTSLEDLKE 349
           L+  L + +  DD VI+I CGGSS SL D++E
Sbjct: 303 LEKALDTRLDGDDVVIIIACGGSSNSLHDMEE 334

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  299 bits (766), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 211/333 (63%), Gaps = 6/333 (1%)

Query: 25  FSKTPLLKHQFKRSKG-----PQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEK 79
           F KTPLL H F  S       PQ +LK EFLQPSGSFKSRGIG++I+ +  +I+ S   K
Sbjct: 5   FVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIR-SEGNK 63

Query: 80  IGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEA 139
           + HVF                  ++PC+VVV  +T  R+++KI + GA+V V+G +WKEA
Sbjct: 64  LPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEA 123

Query: 140 DSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVC 199
           D F+KE ++   +  + + IY+HPFD+PLIWEGHS +VDEI+D L   KI +  IK IVC
Sbjct: 124 DKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVC 183

Query: 200 SFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLG 259
           S               R+ L  KIPI+ VE+KG +V ++SL++G   EFE I+S ATS+G
Sbjct: 184 SVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIG 243

Query: 260 TATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQ 319
           T +IS    +N  R+ +KS V++D E+ISTCL+F+++TNI+ EP CGA L+ GY  D L 
Sbjct: 244 TNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPDILY 303

Query: 320 NILGSDIKDDDYVILIGCGGSSTSLEDLKELSS 352
             L SD   +D +I+IGCGGS+TS  DL  L S
Sbjct: 304 QALNSDFTPEDVIIMIGCGGSATSYNDLASLFS 336

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  295 bits (756), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 142/332 (42%), Positives = 216/332 (65%), Gaps = 7/332 (2%)

Query: 24  LFSKTPLLKHQF-KRSKG-----PQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSP 77
           +++KTPLL+  F + ++G     PQV  KYE  QP  SFKSRGIG+LI    +++++   
Sbjct: 4   VYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEEEGI 63

Query: 78  EKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWK 137
           + +  VF                  ++PCTVVV ++T+ R++EKIRS GA V+V GN WK
Sbjct: 64  KTL-EVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNFWK 122

Query: 138 EADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGI 197
           EAD +++  ++ K+DS K EP+Y HPFD+PLIWEGHS ++DEI++ L    +  +K+KG+
Sbjct: 123 EADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVKGV 182

Query: 198 VCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATS 257
           VCS              +R+ LADKIP++ VET+G  V +  L +G  VEFEKISS ATS
Sbjct: 183 VCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIATS 242

Query: 258 LGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDK 317
           LG+ +IST  ++  +++ SK  V+ D +V+ TCL++S D+N++ EP C A+++  YN+D 
Sbjct: 243 LGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNVDI 302

Query: 318 LQNILGSDIKDDDYVILIGCGGSSTSLEDLKE 349
           L+  L   +  DD +I+I CGGS+T+L+D+K+
Sbjct: 303 LEEALNKKLSKDDVIIIIACGGSATTLQDIKD 334

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  286 bits (732), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 151/338 (44%), Positives = 212/338 (62%), Gaps = 11/338 (3%)

Query: 22  AQLFSKTPLLKHQFKR-----SKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSS 76
           + L+ KTPLL+  F +     SK PQ L+KYEF QPSGSFKSRGIG+LI  KV EI++  
Sbjct: 2   SSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD- 60

Query: 77  PEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHW 136
           P K  HVF                   +PCTVVV  +TR RIIEKI + GA ++  G+++
Sbjct: 61  PAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120

Query: 137 KEADSFMKEHLM----KKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPIT 192
            EADS++K+ +     K     K  PIY HPF++PLIW GHS++V+EI++ L +  IP +
Sbjct: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180

Query: 193 KIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKIS 252
           ++KGIVCS              +R++LA+ IPI+ VET+G +VL  SL  G  + F+K  
Sbjct: 181 RVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240

Query: 253 SCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFG 312
           S ATSL   TI+    +  +++ +KS V+ + EV+ TCL+F++++NIV EP CGATL+ G
Sbjct: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300

Query: 313 YNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLKEL 350
           Y+   L   LG  +  +D VILI CGGS+T+L DL+EL
Sbjct: 301 YHPAILHKELGP-LSSEDIVILIACGGSATTLADLREL 337

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  282 bits (721), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 206/330 (62%), Gaps = 2/330 (0%)

Query: 20  MKAQLFSKTPLLKHQFKRSKG-PQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPE 78
           ++   ++KTPLL      + G P+  LKYEFLQP GSFKSRGIG+L+    E+ ++   +
Sbjct: 3   LELSFYNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGK 62

Query: 79  KIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKE 138
            +  VF                  ++ CTVVV   T+ R++EKIR  GA+V+V+G HW  
Sbjct: 63  SLA-VFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGM 121

Query: 139 ADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIV 198
           AD +++E +MK++D  K  P+Y HPFDNP+IW+GHS +VDE++  L    + I K+K IV
Sbjct: 122 ADEYLREVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIV 181

Query: 199 CSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSL 258
           CS              + + LAD+IPI+ +ETKG DVL+ SL  G PV  E ++S A+SL
Sbjct: 182 CSVGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSL 241

Query: 259 GTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKL 318
            +  IS  A++N +++ SKS ++ D++VI TCL F++D  IV EP CGA+LY  Y+ + L
Sbjct: 242 ASPYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELL 301

Query: 319 QNILGSDIKDDDYVILIGCGGSSTSLEDLK 348
              +G ++ +DD +++I CGGS+ + +DL+
Sbjct: 302 PLYIGKELTEDDVIVVIACGGSAVTYKDLE 331

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  275 bits (702), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 138/331 (41%), Positives = 203/331 (61%), Gaps = 4/331 (1%)

Query: 27  KTPLLKHQFKRSK--GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVF 84
           K+PLL  +FK S+  GPQ  LKYE LQPSGSFKSRGIG+LI++K +E +      + HVF
Sbjct: 6   KSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDV-HVF 64

Query: 85  XXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFMK 144
                             N+ CTVVV   T+  +I++I++ G+ V+VHG HW  AD+++K
Sbjct: 65  SSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTYLK 124

Query: 145 EHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXX 204
           E +MKK+ S   EP+Y HPFD+PL+WEGHSFM+DEI++ L      +  +KGI+CS    
Sbjct: 125 EVVMKKVPS-NVEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVGGG 183

Query: 205 XXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATIS 264
                     +R+  A KIPI+ VET G D L+ SL  G PV   +++S A+SLG+  I+
Sbjct: 184 GLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPYIA 243

Query: 265 TTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILGS 324
             +++   R+ ++S V +D E + T L+F  +TNI+ EP C A++   Y++D+L  +L  
Sbjct: 244 QDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLLSC 303

Query: 325 DIKDDDYVILIGCGGSSTSLEDLKELSSFTN 355
            +   D VI+I CGGS+T++ DL+ L    N
Sbjct: 304 KLSSKDIVIVIVCGGSATTISDLEMLQRRYN 334

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  272 bits (695), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 136/327 (41%), Positives = 202/327 (61%), Gaps = 10/327 (3%)

Query: 25  FSKTPLLKHQFK---RSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIG 81
           + KTPLL+        ++ PQ+ +KYE LQP GSFKSRGIG+LIS K E     S     
Sbjct: 5   YYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKS----- 59

Query: 82  HVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS 141
           HV                    +PCTVVV  +T+ R+++KI++ GA+V++ G+HWKEAD+
Sbjct: 60  HVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADN 119

Query: 142 FMKEHLMKKL-DSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCS 200
           +++++ ++   +    +P+Y HPFD+P +WEGHS MV EI+D L    I +  ++GIVCS
Sbjct: 120 YLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCS 179

Query: 201 FXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGT 260
                         + + LADKIP++ VET G +VL+ASL  G PV  +KI+S ATSLG+
Sbjct: 180 VGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGS 239

Query: 261 ATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQN 320
             I    ++N  R+G+KS V+ D +VI TCL++ +D   + EP CGA+L+ GY+ + L+N
Sbjct: 240 TYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLEN 299

Query: 321 ILGSDIKDDDYVILIGCGGSSTSLEDL 347
            LG     DD +++I CGGS+T+ +DL
Sbjct: 300 FLGG-FSKDDIIVIIACGGSTTTFKDL 325

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  272 bits (695), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 135/328 (41%), Positives = 199/328 (60%), Gaps = 2/328 (0%)

Query: 25  FSKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83
           + +TPL+   F   + GP++ +K+E LQP GSFKSRGIGHLI+   EE       K+  V
Sbjct: 6   YERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLA-V 64

Query: 84  FXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143
           F                   + CTVVV   T+ R+I+KI++ GA V++HG+HW EAD ++
Sbjct: 65  FSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEYL 124

Query: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXX 203
           ++ LM +      + +Y HPFD+  IWEGHS +VDE++  L    I + +IK +VCS   
Sbjct: 125 RQELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVGG 184

Query: 204 XXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263
                      +R NLA KI ++ VET G DVL+ SL  G+P+  E++SS ATSLG+  I
Sbjct: 185 GGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPYI 244

Query: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323
           +  A+++   +G KS V+SD +V++TCL++++D N + EP CGA+L+  Y+ + L+N L 
Sbjct: 245 APFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENALE 304

Query: 324 SDIKDDDYVILIGCGGSSTSLEDLKELS 351
             + DDD VI+I CGGS  + EDL E S
Sbjct: 305 QKLSDDDIVIIIACGGSCMTYEDLVETS 332

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  270 bits (691), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 146/326 (44%), Positives = 198/326 (60%), Gaps = 9/326 (2%)

Query: 23  QLFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGH 82
           QL  KTPLL  +   + GP  LLKYE LQP GSFKSRGI HLI T ++ I  S PE    
Sbjct: 3   QLTIKTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHLIKTTMDSI--SDPENELA 60

Query: 83  VFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSF 142
           V+                   VPCTV+V  +T+PR+I+KI S GA VV+ G+HWKEAD++
Sbjct: 61  VYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTY 120

Query: 143 MKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFX 202
           ++E++M++  S     +Y HPFDNP+IW+GHS M+DEI++ LA S   I  +KGIVCS  
Sbjct: 121 LREYVMRQ--SSYSNTLYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVG 178

Query: 203 XXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTAT 262
                       +R+ LA  IP+  +ET G DVLS SL  G PV  ++ISS ATSLG+  
Sbjct: 179 GGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTE 238

Query: 263 ISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNIL 322
           I   ++Q   +  SKS V+ D  V+ TCL+F ++T+I+ EP CGA+L+  Y       +L
Sbjct: 239 ICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYR----PELL 294

Query: 323 GSDIKDDDYVILIGCGGSSTSLEDLK 348
           G  +  DD V++I CGGS  + +DLK
Sbjct: 295 GP-LGPDDIVVVILCGGSCNTYDDLK 319

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  271 bits (692), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 135/325 (41%), Positives = 196/325 (60%), Gaps = 3/325 (0%)

Query: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83
           L++KTPLL        GP  L KYE +QP GSFK RG+ HLI  +VE+IK S  +K  HV
Sbjct: 4   LYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIK-SEGKKPPHV 62

Query: 84  FXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143
           F                  ++PCTVVV   T+PR++EKIR   A+V+V G++WKEAD ++
Sbjct: 63  FSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEADDYL 122

Query: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXX 203
           +  ++   ++   +PIY +PFD+PL+WEGHS M+DEI++ L    I +  +KGIVCS   
Sbjct: 123 RGTVIASNNAV--QPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCSVGG 180

Query: 204 XXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263
                      + + LA  IP+V VETKG DVL  SL    PV   KI S ATSLG++ +
Sbjct: 181 GGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGSSYV 240

Query: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323
           S  A+ N  +  S+S V+ D++V++TC ++ +D N + EP CGAT++  Y+   L+  LG
Sbjct: 241 SCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEKALG 300

Query: 324 SDIKDDDYVILIGCGGSSTSLEDLK 348
             +   D +I+I CGGS  +++DL+
Sbjct: 301 QKLTPSDIIIIIVCGGSCVTIQDLE 325

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  270 bits (691), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 138/337 (40%), Positives = 203/337 (60%), Gaps = 3/337 (0%)

Query: 20  MKAQLFSKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPE 78
           M+   + KTPL++      K      +K+E LQP GSFKSRGIGHLI    EE       
Sbjct: 1   MEMTYYEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSG 60

Query: 79  KIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKE 138
           K+  VF                   + C+VVV   T+PR+++KI+S GA V++HG+HW E
Sbjct: 61  KLA-VFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGE 119

Query: 139 ADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIV 198
           AD +++ H M +      + +Y HPFDN  IWEGHS +VDEI++ L  + I + ++K +V
Sbjct: 120 ADEYLR-HEMAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALV 178

Query: 199 CSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSL 258
           CS               R  LA+KIP+V VET G DVL+ SL+ G+PV  EK++S ATSL
Sbjct: 179 CSVGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSL 238

Query: 259 GTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKL 318
            +  I++ A+++  ++G KS V+SD +V++TCL++++D N + EP CGA+L+  Y+ + L
Sbjct: 239 ASPYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEIL 298

Query: 319 QNILGSDIKDDDYVILIGCGGSSTSLEDLKELSSFTN 355
           ++IL   I +DD VI+I CGGS  + EDL + SS  N
Sbjct: 299 EDILEQKIYEDDIVIIIACGGSCMTYEDLVKASSTLN 335

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  272 bits (695), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 140/333 (42%), Positives = 203/333 (60%), Gaps = 8/333 (2%)

Query: 22  AQLFSKTPLLKHQFKR-----SKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSS 76
           A  + KTPL++H F R     +  P+++LKYEF QPSGSFKSRGIG+LI  ++++I+++S
Sbjct: 70  ASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNS 129

Query: 77  PEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHW 136
             +  HVF                   +PCTVVV   TR R++E+IRS GADV+  G+  
Sbjct: 130 SLQ-PHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 137 KEADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKG 196
           KE+D +++  LM  ++  K  PIY+HPFDNPLIWEGH+ MVDE+++ L    + +  +KG
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 197 IVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCAT 256
           IVCS              +++ LAD IP+V VET+G +VL  SL +G  V      S AT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307

Query: 257 SLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNID 316
           SL T+ ++       +++ +KS V+    V+ TCL F+ ++NIV EP CGA L+ GY+ +
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 317 KLQNILGSDIKDDDYVILIGCGGSSTSLEDLKE 349
            L+  LG  +   D VI+I CGGS+ +L DLKE
Sbjct: 368 ILERELGP-LTPQDVVIVIACGGSTMNLADLKE 399

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  268 bits (686), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 198/328 (60%), Gaps = 2/328 (0%)

Query: 25  FSKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83
           + KTPL++  F   K  P   +K++ LQP GSFKSRGIGHLI  K +E       K+  V
Sbjct: 6   YEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKL-VV 64

Query: 84  FXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143
           F                   + CTVVV   T+ R+++KI+S GA V++HG+HW EAD ++
Sbjct: 65  FSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADEYL 124

Query: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXX 203
           K+ +M +      + +Y HPFD+ +IWEGHS +VDEI+  L    I   ++KG+VCS   
Sbjct: 125 KQEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCSVGG 184

Query: 204 XXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263
                      +R  LA KIPIV VET G DVL+ SL+ G+PV  E+++S ATSLG+  I
Sbjct: 185 GGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGSPYI 244

Query: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323
           +  A+++   +G KS V+SD +V+ TCL++++D N + EP CGA+L+  Y+ + L+  LG
Sbjct: 245 APFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEKALG 304

Query: 324 SDIKDDDYVILIGCGGSSTSLEDLKELS 351
             + +DD VI+I CGGS  + EDL + S
Sbjct: 305 QKLSEDDVVIIIACGGSCMTYEDLVKAS 332

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  184 bits (466), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 88/222 (39%), Positives = 141/222 (63%), Gaps = 4/222 (1%)

Query: 128 DVVVHGNHWKEADSFMKEHLMKKLDSFK-YEPIYSHPFDNPLIWEGHSFMVDEIMDVLAS 186
           +V VH  + KEAD +++  +   +D +K  +PIY +PFD+PLIWEGHS ++DEI++ L  
Sbjct: 4   EVFVHVANLKEADYYLQNVV---IDLYKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQ 60

Query: 187 SKIPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPV 246
             I +  +KGI+CSF             ++Y+LA  IP+V VETKG DVL+ SL    PV
Sbjct: 61  ENIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPV 120

Query: 247 EFEKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCG 306
           + + I+S A SLG++ +S   + NV ++ SKS V++D++ + TC ++ +D   V EP CG
Sbjct: 121 QLDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACG 180

Query: 307 ATLYFGYNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLK 348
           A+++  Y+ + L+  L   ++ DD +I+I CGGS  + +DL+
Sbjct: 181 ASVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLE 222

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  182 bits (463), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 88/197 (44%), Positives = 131/197 (66%)

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
           +Y HPFDN  IWEGHS +VDEI++ L  + I + ++K +VCS               R  
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           LA+KIP+V VET G DVL+ SL+ G+PV  EK++S ATSL +  I++ A+++  ++G KS
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 279 AVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILGSDIKDDDYVILIGCG 338
            V+SD +V++TCL++++D N + EP CGA+L+  Y+ + L++IL   I +DD VI+I CG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 339 GSSTSLEDLKELSSFTN 355
           GS  + EDL + SS  N
Sbjct: 192 GSCMTYEDLVKASSTLN 208

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score = 94.0 bits (232), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 68/126 (53%), Gaps = 2/126 (1%)

Query: 20  MKAQLFSKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPE 78
           M+   + KTPL++      K      +K+E LQP GSFKSRGIGHLI    EE       
Sbjct: 1   MEMTYYEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSG 60

Query: 79  KIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKE 138
           K+  VF                   + C+VVV   T+PR+++KI+S GA V++HG+HW E
Sbjct: 61  KLA-VFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGE 119

Query: 139 ADSFMK 144
           AD +++
Sbjct: 120 ADEYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 121/295 (41%), Gaps = 30/295 (10%)

Query: 17  RLIMKAQLF---SKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           RLI+++ ++   S++P+       S+    V LK E L P  SFK RG  ++I+ K++E 
Sbjct: 51  RLILRSSVYDIISESPMTHGVGLSSRLNANVQLKREDLLPVFSFKLRGAYNMIA-KLDES 109

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
           +K+       V                   N+P T+V+  +T     + +   G+ VV++
Sbjct: 110 QKTQ-----GVIACSAGNHAQGVAYASKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLY 164

Query: 133 GNHWKEADS----FMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSK 188
           GN + EA +      +E  +  +           PFD+P +  G   +  EI+  + ++ 
Sbjct: 165 GNDFDEAKAECTKLTEERGLTNIP----------PFDHPYVIAGQGTIAMEILRQVHNA- 213

Query: 189 IPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEF 248
              +KIK + C+              +R  +A  I ++ VET     L  SL+ G  V  
Sbjct: 214 ---SKIKAVFCAVGGGGLITGVGAYLKR--IAPHIKVIGVETYDAATLHTSLKAGKRVPL 268

Query: 249 EKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEP 303
             + + A       I    ++  K    +  +++  E+ +       DT  + EP
Sbjct: 269 PNVGTFADGTSVRMIGEETFRVAKDVVDEVVLVNTDEICAAVKDIFEDTRSIVEP 323

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/342 (21%), Positives = 143/342 (41%), Gaps = 31/342 (9%)

Query: 17  RLIMKAQLF---SKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           RLI+++ ++   +++P+ + +F  S+    V LK E L P  SFK RG  ++IS  ++++
Sbjct: 59  RLILRSNVYDIINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMIS-HLDDV 117

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
           +K    K G V                    +P T+V+  +T     + +   GA+VV++
Sbjct: 118 QK----KCG-VIACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLY 172

Query: 133 GNHWKEAD---SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKI 189
           G+++  A    S + E   K L           PFD+P +  G   +  EI+  + +S  
Sbjct: 173 GDNFDAAKVECSRLSEE--KGLYDIP-------PFDHPYVIAGQGTIAMEILKQIQNS-- 221

Query: 190 PITKIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFE 249
             +KI  + C+              +R   A  I ++ VET     L  S++  A     
Sbjct: 222 --SKIGAVFCAVGGGGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLS 277

Query: 250 KISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATL 309
           ++   A       I   +++  +    +  +++  E+ +       DT  V EP  GA  
Sbjct: 278 QVGGFADGTSVRLIGEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEP-SGALA 336

Query: 310 YFGYNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLKELS 351
             G  + K  N +  +I   +   +    G++ + + L+ +S
Sbjct: 337 VAG--MKKYVNEIHPEIDHSEKTYVPVLSGANMNFDRLRFVS 376

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/295 (21%), Positives = 117/295 (39%), Gaps = 30/295 (10%)

Query: 17  RLIMKAQLFS---KTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           RLI+++ ++    +TP+ +     S+    V LK E L P  SFK RG  ++I+ K++E 
Sbjct: 56  RLILRSSVYEVIEETPISRAVSLSSRLNTNVKLKREDLLPVFSFKLRGAYNMIA-KLDET 114

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
           +K++      V                   N+P T+V+  +T     + +   GA VV++
Sbjct: 115 QKNA-----GVIACSAGNHAQGVAFSSNHMNIPATIVMPVSTPSIKYQNVSRLGAQVVLY 169

Query: 133 GNHWKEAD----SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSK 188
           G+ + EA        +E  M  +           PFD+P +  G   +  EI+  + +  
Sbjct: 170 GDDFDEAKLECARLAEERGMTDIP----------PFDHPYVIAGQGTIAMEILRQVQNG- 218

Query: 189 IPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEF 248
              + I  + C+              +R  +A  I ++ VET     L  SL+ G     
Sbjct: 219 ---SNIGAVFCAVGGGGLISGIGSYLKR--IAPHIKVIGVETYDAATLDVSLKNGKRTPL 273

Query: 249 EKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEP 303
             + + A       I    ++  +    +  +++  E+ +       DT  + EP
Sbjct: 274 PSVGTFADGTSVRLIGEETFRVCQDVVDEVILVNTDEICAAVKDVFEDTRSIVEP 328

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 104/265 (39%), Gaps = 26/265 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V LK E L P  SFK RG  ++I+ K++E +K+       V                   
Sbjct: 88  VQLKREDLLPVFSFKLRGAYNMIA-KLDENQKNQG-----VIACSAGNHAQGVAYAARHM 141

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
           N+P T+V+  +T     + +   G+ VV++GN + EA +      +E  +  +       
Sbjct: 142 NIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP------ 195

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +  EI+  + +S     KI  +                 +R  
Sbjct: 196 ----PFDHPYVIAGQGTVAMEILRQVHNS----LKIGAVFVPVGGGGLIAGIGAYLKR-- 245

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +A  I IV VET     LSAS++ G     + + S A       I    ++  +    + 
Sbjct: 246 IAPHIKIVGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEI 305

Query: 279 AVISDTEVISTCLQFSNDTNIVAEP 303
            +++  E+ +       DT  + EP
Sbjct: 306 VLVNTDEICAAVKDIFEDTRSIIEP 330

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 115/295 (38%), Gaps = 30/295 (10%)

Query: 17  RLIMKAQLF---SKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           RLI+++ ++   +++P+ K     SK   Q+ LK E L P  SFK RG  ++++ K++E 
Sbjct: 59  RLILRSSVYEVINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVA-KLDET 117

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
           ++        V                    +P T+V+  +T     E +   G+ VV++
Sbjct: 118 QRKQ-----GVIACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLY 172

Query: 133 GNHWK----EADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSK 188
           GN +     E +   +E  +  +           PFD+P +  G   +  EI+  + +S 
Sbjct: 173 GNDFDSSKGECERLCEERGLVNIP----------PFDHPYVIAGQGTVAMEILRQVKNS- 221

Query: 189 IPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEF 248
               KI  +                 +R  +A  I IV VET     L  SL  G   E 
Sbjct: 222 ---AKIGAVFVPVGGGGLVAGIGAYLKR--IAPHIKIVGVETYDAATLKTSLDNGKRTEL 276

Query: 249 EKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEP 303
             + + A       I    ++  K    +  +++  E+ +       DT  + EP
Sbjct: 277 NTVGTFADGTAVKMIGEETFRVSKDVVDEIVLVNTDELCAAVKDIFEDTRSIVEP 331

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 98/265 (36%), Gaps = 26/265 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V LK E L P  SFK RG  ++++      K    +K   V                   
Sbjct: 85  VQLKREDLLPVFSFKLRGAYNMMA------KLDDSQKNQGVIACSAGNHAQGIAYAAKHL 138

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
           N+P T+V+  +T     + +   G+ VV++GN + EA +      +E  +  +       
Sbjct: 139 NIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTNIP------ 192

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +  EI+  +  +     KI  +                 +R  
Sbjct: 193 ----PFDHPYVIAGQGTVAMEILRQVHKA----NKIGAVFVPVGGGGLIAGVGAYLKR-- 242

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +A  I I+ VET   + L  SL+ G  V    + + A       I    ++  +    + 
Sbjct: 243 IAPHIKIIGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEV 302

Query: 279 AVISDTEVISTCLQFSNDTNIVAEP 303
            +++  E+ +       DT  + EP
Sbjct: 303 VLVNTDEICAAVKDVFEDTRSIVEP 327

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/291 (19%), Positives = 115/291 (39%), Gaps = 22/291 (7%)

Query: 17  RLIMKAQLFS---KTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           R+I+++ ++    ++P+ + +   +K    V LK E L P  SFK RG  ++IS  ++E 
Sbjct: 50  RMILRSSVYDVIEESPMSEAKLLSAKLDTNVCLKREDLLPVFSFKLRGAYNMISN-LDEY 108

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
           +KS+      V                    +   +V+  +T       + + GA+VV++
Sbjct: 109 QKSA-----GVIACSAGNHAQGVAFSARELGIRAMIVMPTSTPSIKYNSVAAMGAEVVLY 163

Query: 133 GNHWKEADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPIT 192
           G  + EA +      + +L      P    PFD+P +  G   +  EI+  + ++    +
Sbjct: 164 GKDFDEAKAECAR--LAQLHKLTDIP----PFDHPYVIAGQGTIATEILRQVHNA----S 213

Query: 193 KIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKIS 252
           +I  + C               +R  +A  I I+ VET     L  +L+ G       + 
Sbjct: 214 QIGAVFCGVGGGGLIAGIGSYLKR--IAPHIKIIGVETHDAPTLHTALKQGRRTMLPAVG 271

Query: 253 SCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEP 303
             A       +    ++  +    +  +++  E+ +       DT  + EP
Sbjct: 272 CFADGTSVRMMGEETFRVARDVVDEVVLVNTDELCAAIKDIFEDTRAIVEP 322

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/313 (19%), Positives = 119/313 (38%), Gaps = 29/313 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V LK E L P  SFK RG  ++I+   + ++         V                   
Sbjct: 98  VQLKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG------VIACSAGNHAQGVAYAAKKL 151

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
            +P T+V+  +T     + +   G+ VV++GN + EA +      +E  +  +       
Sbjct: 152 GIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLSEERGLTNIP------ 205

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +  EI+  + ++     KI  +                 +R  
Sbjct: 206 ----PFDHPYVIAGQGTVAMEILRQVHNA----NKINAVFVPVGGGGLIAGVGAYLKR-- 255

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +A  I ++ VET     L  SL+ G   E  K+ + A       I    ++  +    + 
Sbjct: 256 IAPHIKVIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEI 315

Query: 279 AVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILGSDIKDDDYVILIGCG 338
            +++  E+ +       DT  + EP  GA    G  + K  ++L  +I    +  +    
Sbjct: 316 VLVNTDELCAAIKDVFEDTRSILEP-SGALSVAG--MKKYISVLHPEIDHSKHTYVPILS 372

Query: 339 GSSTSLEDLKELS 351
           G++ + + L+ +S
Sbjct: 373 GANMNFDRLRFVS 385

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/282 (19%), Positives = 110/282 (39%), Gaps = 23/282 (8%)

Query: 26  SKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVF 84
           +KTP+L  +   ++ G +V  K E  Q  G+FK RG  + +      +K +  ++   V 
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTL------LKLTQEQRAAGVV 74

Query: 85  XXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFMK 144
                              VP T+V+ N      +     YGA++V +  + ++     +
Sbjct: 75  AFSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIVRYDRYTED-----R 129

Query: 145 EHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXX 204
           E + + L   K   +   P+D+P +  G      E+++        + ++  +       
Sbjct: 130 EQIGRALAEEKGLTLVP-PYDHPDVIAGQGTAAKELIE-------EVGELDLLFVPLGGG 181

Query: 205 XXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATIS 264
                     +R  L+ +  I+ VE +  +    SLR G+ V  +   + A    T  + 
Sbjct: 182 GLLSGSALAAKR--LSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHLG 239

Query: 265 TTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEP-GC 305
              ++ +  + +     SD E++ +   F+    IV EP GC
Sbjct: 240 QYTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEPTGC 281

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/295 (20%), Positives = 115/295 (38%), Gaps = 30/295 (10%)

Query: 17  RLIMKAQLFS---KTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           RLI+++ ++    ++P+       SK    V LK + L P  SFK RG  ++++ K+++ 
Sbjct: 57  RLILRSSVYDVMDESPITTGTVLSSKLNTNVQLKRDDLLPVFSFKLRGAYNMMA-KLDDT 115

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
           +K+       V                    +P T+V+  +T     + +   G+ VV++
Sbjct: 116 QKNQG-----VIACSAGNHAQGVAYAAKHLKIPATIVMPVSTPSIKYQNVSRLGSQVVLY 170

Query: 133 GNHWKEADS----FMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSK 188
           GN + EA +      +E  +  +           PFD+P +  G   +  EI+  +  S 
Sbjct: 171 GNDFDEAKAECARLAEERGLTNIP----------PFDHPYVIAGQGTVAMEILRQVHMS- 219

Query: 189 IPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEF 248
              +KI  +                 +R  +A  I I+ VET     L  SL+ G     
Sbjct: 220 ---SKIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKIIGVETYDACALYTSLQSGKRAAL 274

Query: 249 EKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEP 303
           E + S A       +    ++  +    +  +++  E+ +       DT  + EP
Sbjct: 275 ESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDEICAGIKDIFEDTRSIVEP 329

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 101/265 (38%), Gaps = 26/265 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V LK E L P  SFK RG  ++I+ K+++ +K+       V                   
Sbjct: 88  VQLKREDLLPVFSFKLRGAYNMIA-KLDDSQKNQ-----GVIACSAGNHAQGVAFAAKHM 141

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
           ++P T+V+  +T     + +   G+ VV++GN + EA +      +E  +  +       
Sbjct: 142 SIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTRLSEERGLTNIP------ 195

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +  EI+  + +S     KI  +                 +R  
Sbjct: 196 ----PFDHPYVIAGQGTVAMEILRQVRNS----AKIGAVFVPCGGGGLVAGIGAYLKR-- 245

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +A  I I+ VET  +  L  SL+ G       + + A       I    ++  +    + 
Sbjct: 246 IAPHIKIIGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEV 305

Query: 279 AVISDTEVISTCLQFSNDTNIVAEP 303
            ++   E+ +       DT  + EP
Sbjct: 306 VLVGTDEICAAIKDIFEDTRGIVEP 330

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/265 (20%), Positives = 96/265 (36%), Gaps = 26/265 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V LK E L P  SFK RG  ++I+      K    ++   V                   
Sbjct: 89  VQLKREDLLPVFSFKLRGAYNMIA------KLDDSQRNQGVIACSAGNHAQGVAFAAKHL 142

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
           N+P T+V+  +T     + +   G+ VV++GN + EA +      +E  +  +       
Sbjct: 143 NIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP------ 196

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +  EI+  + ++     KI  +                 +R  
Sbjct: 197 ----PFDHPYVIAGQGTVAMEILRQVHNA----NKIGAVFVPVGGGGLVAGVGAYLKR-- 246

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +A  I I+ VET     L  SL+ G       +   A       I    ++  +    + 
Sbjct: 247 IAPHIKIIGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEV 306

Query: 279 AVISDTEVISTCLQFSNDTNIVAEP 303
            +++  E+ +       DT  + EP
Sbjct: 307 VLVNTDEICAAVKDVFEDTRSIVEP 331

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/265 (19%), Positives = 99/265 (37%), Gaps = 26/265 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V LK E L P  SFK RG  ++I+ K+++ +++       V                   
Sbjct: 90  VQLKREDLLPVFSFKLRGAYNMIA-KLDDTQRNQ-----GVIACSAGNHAQGVAYAARHL 143

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
           ++P T+V+  +T     + +   G+ VV++GN + EA +      +E  +  +       
Sbjct: 144 DIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP------ 197

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +  EI+  + +S     KI  +                 +R  
Sbjct: 198 ----PFDHPYVIAGQGTVAMEILRQVYNS----NKIGAVFVPVGGGGLIAGVGAYLKR-- 247

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +   I I+ VET     L  SL+         + + A       I    ++  +    + 
Sbjct: 248 VTPHIKIIGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEI 307

Query: 279 AVISDTEVISTCLQFSNDTNIVAEP 303
            +++  E+ +       DT  + EP
Sbjct: 308 VLVNTDEICAAVKDVFEDTRSIVEP 332

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 54/261 (20%), Positives = 95/261 (36%), Gaps = 18/261 (6%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V+LK E L P  SFK RG  ++I+      K    ++   V                   
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIA------KLDDSQRNQGVIACSAGNHAQGVAFAAKHL 148

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFMKEHLMKKLDSFKYEPIYSH 162
            +P T+V+   T     + +   G+ VV++GN + EA    K    K  +      I   
Sbjct: 149 KIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--P 202

Query: 163 PFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADK 222
           PFD+P +  G   +  EI+  + ++     KI  +                 +R  +A  
Sbjct: 203 PFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVFVPVGGGGLIAGIGAYLKR--VAPH 256

Query: 223 IPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKSAVIS 282
           I I+ VET     L  SL+         + + A       I    ++  ++   +  +++
Sbjct: 257 IKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVN 316

Query: 283 DTEVISTCLQFSNDTNIVAEP 303
             E+ +       DT  + EP
Sbjct: 317 TDEICAAVKDIFEDTRSIVEP 337

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 52/265 (19%), Positives = 96/265 (36%), Gaps = 26/265 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V+LK E L P  SFK RG  ++I+      K    ++   V                   
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIA------KLDDSQRNQGVIACSAGNHAQGVAFAAKHL 148

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
            +P T+V+   T     + +   G+ VV++GN + EA +      +E  +  +       
Sbjct: 149 KIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP------ 202

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +  EI+  + ++     KI  +                 +R  
Sbjct: 203 ----PFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVFVPVGGGGLIAGIGAYLKR-- 252

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +A  I ++ VET     L  SL+         + S A       I    ++  ++   + 
Sbjct: 253 VAPHIKVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEV 312

Query: 279 AVISDTEVISTCLQFSNDTNIVAEP 303
            +++  E+ +       DT  + EP
Sbjct: 313 VLVNTDEICAAVKDVFEDTRSIVEP 337

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 59/295 (20%), Positives = 109/295 (36%), Gaps = 30/295 (10%)

Query: 17  RLIMKAQLFS---KTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           RLI+++ ++    ++P+ +     S+    V LK E L P  SFK RG  ++++      
Sbjct: 62  RLILRSSVYDVIEESPITRGVGLSSRLNTNVQLKREDLLPVFSFKLRGAYNMMA------ 115

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
           K S  +K   V                   N+P  +V+   T     + +   G  VV++
Sbjct: 116 KLSEAQKNQGVIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLY 175

Query: 133 GNHWKEADS----FMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSK 188
           GN + EA +      +E  +  +           PFD+P +  G   +  EI+  + ++ 
Sbjct: 176 GNDFDEAKTECTRISEERGLTNIP----------PFDHPYVIAGQGTVAMEILRQVHNA- 224

Query: 189 IPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEF 248
               KI  +                 +R  +A  I I+ VET  +  L  SL  G     
Sbjct: 225 ---AKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKIIGVETYDSATLKTSLEAGTRTPL 279

Query: 249 EKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEP 303
             + + A       I    ++  +       +++  E+ +       DT  + EP
Sbjct: 280 STVGTFADGTSVRMIGEETFRICQDLVDDVILVNTDEICAAVKDIFEDTRSIVEP 334

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 53/261 (20%), Positives = 95/261 (36%), Gaps = 18/261 (6%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V+LK E L P  SFK RG  ++I+      K    ++   V                   
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIA------KLDDSQRNQGVIACSAGNHAQGVAFAAKHL 148

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFMKEHLMKKLDSFKYEPIYSH 162
            +P T+V+   T     + +   G+ VV++GN + EA    K    K  +      I   
Sbjct: 149 KIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--P 202

Query: 163 PFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADK 222
           PFD+P +  G   +  EI+  + ++     KI  +                 +R  +A  
Sbjct: 203 PFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVFVPVGGGGLIAGIGAYLKR--VAPH 256

Query: 223 IPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKSAVIS 282
           I ++ VET     L  SL+         + + A       I    ++  ++   +  +++
Sbjct: 257 IKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVN 316

Query: 283 DTEVISTCLQFSNDTNIVAEP 303
             E+ +       DT  + EP
Sbjct: 317 TDEICAAVKDIFEDTRSIVEP 337

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 51/265 (19%), Positives = 99/265 (37%), Gaps = 26/265 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V+LK E L P  SFK RG  ++I+ K+++ +++       V                   
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIA-KLDDSQRNQ-----GVIACSAGNHAQGVAFAAKHL 148

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
            +P T+V+   T     + +   G+ VV+ GN + EA +      +E  +  +       
Sbjct: 149 KIPATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAKAECTKLAEERGLTNIP------ 202

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +  EI+  + +    + KI  +                 +R  
Sbjct: 203 ----PFDHPYVIAGQGTVAMEILRQVRT----VNKIGAVFVPVGGGGLIAGIGAYLKR-- 252

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +A  I ++ VET     L  SL+         + + A       I    ++  ++   + 
Sbjct: 253 IAPHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEV 312

Query: 279 AVISDTEVISTCLQFSNDTNIVAEP 303
            +++  E+ +       DT  + EP
Sbjct: 313 VLVNTDEICAAVKDVFEDTRSIVEP 337

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 57/303 (18%), Positives = 117/303 (38%), Gaps = 26/303 (8%)

Query: 26  SKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVF 84
           +KTP+L  +    +   +V  K E  Q  G+FK RG  + +S      K S  E+   V 
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVS------KLSDKERKKGVI 74

Query: 85  XXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFMK 144
                             NVP T+++        +     YGA ++ +  + ++     +
Sbjct: 75  AFSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHIIKYNRYTED-----R 129

Query: 145 EHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXX 204
           EH+ ++L + K+  +   P+D+P +  G      E+ +        + ++  +       
Sbjct: 130 EHIGRQL-AAKHGYVLIPPYDHPDVIAGQGTSAKELFE-------EVGELDALFVPLGGG 181

Query: 205 XXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATIS 264
                     +  +L+    +  VE +  +    S + G+ V  +  S+ A    T  + 
Sbjct: 182 GLLSGSALAAR--SLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQTQHLG 239

Query: 265 TTAYQNVKRHGSKSAVISDTEVISTCLQF-SNDTNIVAEPGCGATLYFGYNIDKLQNILG 323
              Y  ++ +      +SD E++  C+ F +    +V EP   A L F   + K + ++G
Sbjct: 240 EYTYAVIRENVDDILTVSDEELVE-CMHFLAERMKLVVEP--TACLGFAGALLKKRELVG 296

Query: 324 SDI 326
             +
Sbjct: 297 KKV 299

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 51/265 (19%), Positives = 100/265 (37%), Gaps = 26/265 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V LK E L P  SFK RG  ++I+ K+++ +++       V                   
Sbjct: 88  VQLKREDLLPVFSFKLRGAYNMIA-KLDDSQRNQ-----GVIACSAGNHAQGVAYAAKHL 141

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
            +P T+V+  +T     + +   G+ VV++GN + EA +      +E  +  +       
Sbjct: 142 GIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP------ 195

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +  EI+  + ++     KI  +                 +R  
Sbjct: 196 ----PFDHPYVIAGQGTVAMEILRQVHNA----NKIGAVFVPVGGGGFIAGVGAYLKR-- 245

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +A  I ++ VET     L  SL+         + + A       I    ++  ++   + 
Sbjct: 246 IAPHIKVIGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEV 305

Query: 279 AVISDTEVISTCLQFSNDTNIVAEP 303
            +++  E+ +       DT  + EP
Sbjct: 306 VLVNTDEICAAVKDIFEDTRSIVEP 330

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 59/309 (19%), Positives = 118/309 (38%), Gaps = 32/309 (10%)

Query: 23  QLFSKTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIG 81
           +  +KTP+L  +    + G Q+  K E  Q  G+FK RG  + +S K+ + K+S      
Sbjct: 18  EYVNKTPVLTSRMLNDRLGAQIYFKGENFQRVGAFKFRGAMNAVS-KLSDEKRSK----- 71

Query: 82  HVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS 141
            V                   NVP T+V+        +     YGA ++ +  + ++   
Sbjct: 72  GVIAFSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTED--- 128

Query: 142 FMKEHLMKKLDS---FKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIV 198
             +E + ++L +   F   P    P+D+P +  G      E+++        + ++  + 
Sbjct: 129 --REQIGRQLAAEHGFALIP----PYDHPDVIAGQGTSAKELLE-------EVGQLDALF 175

Query: 199 CSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSL 258
                           +  +L+    I  VE +  +    S R G+ V      + A   
Sbjct: 176 VPLGGGGLLSGSALAAR--SLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGA 233

Query: 259 GTATISTTAYQNVKRHGSKSAVISDTEVISTCLQF-SNDTNIVAEPGCGATLYFGYNIDK 317
            T  +    +  ++ +      +SD E++  C+ F +    +V EP   A L F   + K
Sbjct: 234 QTQHLGEYTFAIIRENVDDILTVSDQELVK-CMHFLAERMKVVVEP--TACLGFAGALLK 290

Query: 318 LQNILGSDI 326
            + ++G  +
Sbjct: 291 KEELVGKKV 299

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 100/265 (37%), Gaps = 26/265 (9%)

Query: 43  VLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFXXXXXXXXXXXXXXXXXX 102
           V LK E L P  SFK RG  ++++ K+++ +K+       V                   
Sbjct: 96  VQLKREDLLPVFSFKLRGAYNMMA-KLDDTQKNQ-----GVIACSAGNHAQGVAFAAKHL 149

Query: 103 NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS----FMKEHLMKKLDSFKYEP 158
           ++P T+V+  +T     + +   G+ VV++GN + EA +      KE  +  +       
Sbjct: 150 DIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLSKERGLTNIP------ 203

Query: 159 IYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFXXXXXXXXXXXXXQRYN 218
               PFD+P +  G   +    M++L    I   KI  +                 +R  
Sbjct: 204 ----PFDHPYVIAGQGTVA---MEILRQVHIA-NKIGAVFVPVGGGGLVAGVGAYLKR-- 253

Query: 219 LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGSKS 278
           +A  I I+ VET     L  SL+ G       + + A       I    ++  +    + 
Sbjct: 254 IAPHIKIIGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEV 313

Query: 279 AVISDTEVISTCLQFSNDTNIVAEP 303
            +++  E+ +       DT  + EP
Sbjct: 314 VLVNTDEICAAVKDIFEDTRSIVEP 338

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 58/295 (19%), Positives = 109/295 (36%), Gaps = 30/295 (10%)

Query: 17  RLIMKAQLFS---KTPLLKHQFKRSK-GPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72
           RLI+++ ++    ++P+ +     S+    V LK E L P  SFK RG  ++++      
Sbjct: 51  RLILRSSVYDVIEESPITRGVGLSSRLNTNVQLKREDLLPVFSFKLRGAYNMMA------ 104

Query: 73  KKSSPEKIGHVFXXXXXXXXXXXXXXXXXXNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132
           K +  +    V                   N+P  +V+   T     + +   G  VV++
Sbjct: 105 KLAEGQGNKGVIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLY 164

Query: 133 GNHWKEAD----SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSK 188
           GN + EA        +E  +  +           PFD+P +  G   +  EI+  + ++ 
Sbjct: 165 GNDFDEAKIECARISEERGLTNIP----------PFDHPYVIAGQGTVAMEILRQVHNA- 213

Query: 189 IPITKIKGIVCSFXXXXXXXXXXXXXQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEF 248
              +KI  +                 +R  +A  I IV VET  +  L  SL  G     
Sbjct: 214 ---SKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKIVGVETYDSATLKTSLDAGCRTPL 268

Query: 249 EKISSCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEP 303
             + + A       I    ++  +    +  +++  E+ +       DT  + EP
Sbjct: 269 TSVGTFADGTSVRMIGEETFRICEDFVDEVVLVNTDEICAAVKDIFEDTRSIVEP 323

>TBLA0F03590 Chr6 (886359..887996) [1638 bp, 545 aa] {ON} Anc_8.193
           YDR072C
          Length = 545

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 110 VSNATRPRIIEKIRSYGADVVVHGNHWKE 138
           + N  RP+I  KI S+ AD+ + G+HWKE
Sbjct: 53  IPNDIRPKINSKI-SFYADMYLFGDHWKE 80

>KAFR0F02170 Chr6 complement(423846..426260) [2415 bp, 804 aa] {ON}
           Anc_3.156 YDL035C
          Length = 804

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 8/68 (11%)

Query: 136 WKEADSFMKEHL------MKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKI 189
           WK   +F K  L      ++ + SFK++  Y+ PFDN   W    F  D  +  L++   
Sbjct: 574 WKYERNFFKRSLWYLGRFLRNIFSFKWD--YTSPFDNEEFWNNKYFTKDNRITSLSTLSP 631

Query: 190 PITKIKGI 197
            +   KGI
Sbjct: 632 FVNTDKGI 639

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,811,090
Number of extensions: 1495123
Number of successful extensions: 4271
Number of sequences better than 10.0: 60
Number of HSP's gapped: 4294
Number of HSP's successfully gapped: 60
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)