Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00396gsingletonON89789746900.0
TBLA0D02000singletonON10324481391e-07
Ecym_3010na 1ON2871001162e-05
ACR019Wna 1ON288941118e-05
TDEL0C024607.301ON20978698.2
KNAG0K009503.133ON128463718.2
NCAS0B064302.253ON146879719.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00396g
         (897 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00396g Chr3 complement(26146..28839) [2694 bp, 897 aa] {ON...  1811   0.0  
TBLA0D02000 Chr4 (494168..497266) [3099 bp, 1032 aa] {ON}              58   1e-07
Ecym_3010 Chr3 complement(21352..22215) [864 bp, 287 aa] {ON} si...    49   2e-05
ACR019W Chr3 (390552..391418) [867 bp, 288 aa] {ON} NOHBY317; No...    47   8e-05
TDEL0C02460 Chr3 (430625..431254) [630 bp, 209 aa] {ON} Anc_7.30...    31   8.2  
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    32   8.2  
NCAS0B06430 Chr2 (1214203..1218609) [4407 bp, 1468 aa] {ON} Anc_...    32   9.3  

>KLLA0C00396g Chr3 complement(26146..28839) [2694 bp, 897 aa] {ON}
           uniprot|Q9HDS6 Kluyveromyces lactis HMLALPHA3 Mating-
           type protein ALPHA3
          Length = 897

 Score = 1811 bits (4690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 875/897 (97%), Positives = 875/897 (97%)

Query: 1   MAQVDVTRWVIHPSGSYXXXXXXXXXXXXXXXXXXXXXXASLVLNDSDFKNFEHWLVTSK 60
           MAQVDVTRWVIHPSGSY                      ASLVLNDSDFKNFEHWLVTSK
Sbjct: 1   MAQVDVTRWVIHPSGSYESETRKRKLREEKRRKLNEIKRASLVLNDSDFKNFEHWLVTSK 60

Query: 61  GVGEYEQVFDFNFDAYTTRGKPAVDSSTSYSDNIFIDGDKNCKIDTKTISFLDRKYQSNN 120
           GVGEYEQVFDFNFDAYTTRGKPAVDSSTSYSDNIFIDGDKNCKIDTKTISFLDRKYQSNN
Sbjct: 61  GVGEYEQVFDFNFDAYTTRGKPAVDSSTSYSDNIFIDGDKNCKIDTKTISFLDRKYQSNN 120

Query: 121 QTKIESEKQMHVITLKNEQLIEECKNIRERLLELIREGTGYIFVRGWTGYRVNTIILKCH 180
           QTKIESEKQMHVITLKNEQLIEECKNIRERLLELIREGTGYIFVRGWTGYRVNTIILKCH
Sbjct: 121 QTKIESEKQMHVITLKNEQLIEECKNIRERLLELIREGTGYIFVRGWTGYRVNTIILKCH 180

Query: 181 CKQDKCHQILKPRCNVKKHHDPDNLKQFNCFSSFSVHFNVKLNTIKICFCHKSKHETLPI 240
           CKQDKCHQILKPRCNVKKHHDPDNLKQFNCFSSFSVHFNVKLNTIKICFCHKSKHETLPI
Sbjct: 181 CKQDKCHQILKPRCNVKKHHDPDNLKQFNCFSSFSVHFNVKLNTIKICFCHKSKHETLPI 240

Query: 241 TIIPASLRQYISTNLCFTARECFECLKRTPVYLEFTKSFDAKAIVRKIWKEISESQWNLD 300
           TIIPASLRQYISTNLCFTARECFECLKRTPVYLEFTKSFDAKAIVRKIWKEISESQWNLD
Sbjct: 241 TIIPASLRQYISTNLCFTARECFECLKRTPVYLEFTKSFDAKAIVRKIWKEISESQWNLD 300

Query: 301 PDSKRSASKILKRFQNTGDVALLPVDNCSADLNISLQKAKPIAFIYERIISEIQHDVTEI 360
           PDSKRSASKILKRFQNTGDVALLPVDNCSADLNISLQKAKPIAFIYERIISEIQHDVTEI
Sbjct: 301 PDSKRSASKILKRFQNTGDVALLPVDNCSADLNISLQKAKPIAFIYERIISEIQHDVTEI 360

Query: 361 VIDSTFCLSTDYKQYFVVVASFFGKGVPVGFMATETNNVDHLTILWFLRSVLQKLPKVKC 420
           VIDSTFCLSTDYKQYFVVVASFFGKGVPVGFMATETNNVDHLTILWFLRSVLQKLPKVKC
Sbjct: 361 VIDSTFCLSTDYKQYFVVVASFFGKGVPVGFMATETNNVDHLTILWFLRSVLQKLPKVKC 420

Query: 421 INSDWSLAEIKAINLLKCSNQICLFHTLTAIRCKRLASKKNMTESLFHQQFQSLLNYEWV 480
           INSDWSLAEIKAINLLKCSNQICLFHTLTAIRCKRLASKKNMTESLFHQQFQSLLNYEWV
Sbjct: 421 INSDWSLAEIKAINLLKCSNQICLFHTLTAIRCKRLASKKNMTESLFHQQFQSLLNYEWV 480

Query: 481 DDNIFDPTRYEEKYQEKVSEYQIREIVRLVRIAICDHILLHSAGLNKVFQDSDSENVKVL 540
           DDNIFDPTRYEEKYQEKVSEYQIREIVRLVRIAICDHILLHSAGLNKVFQDSDSENVKVL
Sbjct: 481 DDNIFDPTRYEEKYQEKVSEYQIREIVRLVRIAICDHILLHSAGLNKVFQDSDSENVKVL 540

Query: 541 KLYEYHLKQLYVITVQKFSLPCYFCYLFNQYYNFTSFQIMSRVGKPTFFSVLRTSMMCES 600
           KLYEYHLKQLYVITVQKFSLPCYFCYLFNQYYNFTSFQIMSRVGKPTFFSVLRTSMMCES
Sbjct: 541 KLYEYHLKQLYVITVQKFSLPCYFCYLFNQYYNFTSFQIMSRVGKPTFFSVLRTSMMCES 600

Query: 601 YFNQLKSWNLSGSRNYRFDTLIYILLNKEVAKIKESIRITKKFEKEYDSNCLVQNHRKHL 660
           YFNQLKSWNLSGSRNYRFDTLIYILLNKEVAKIKESIRITKKFEKEYDSNCLVQNHRKHL
Sbjct: 601 YFNQLKSWNLSGSRNYRFDTLIYILLNKEVAKIKESIRITKKFEKEYDSNCLVQNHRKHL 660

Query: 661 PTWRKQWIIEWKNILQELNCLQEKDVFNECQQYGTNMTTWICGCNDAKVSPSSTCIHLVS 720
           PTWRKQWIIEWKNILQELNCLQEKDVFNECQQYGTNMTTWICGCNDAKVSPSSTCIHLVS
Sbjct: 661 PTWRKQWIIEWKNILQELNCLQEKDVFNECQQYGTNMTTWICGCNDAKVSPSSTCIHLVS 720

Query: 721 LYKQKFPFYHGYTLQRFGKRNNGVPLVQHESLQSDTKIESTENMSFEISDVTINGVCNTT 780
           LYKQKFPFYHGYTLQRFGKRNNGVPLVQHESLQSDTKIESTENMSFEISDVTINGVCNTT
Sbjct: 721 LYKQKFPFYHGYTLQRFGKRNNGVPLVQHESLQSDTKIESTENMSFEISDVTINGVCNTT 780

Query: 781 KQMSDANCRKLDYETEIDMISENKHSEIDDESEGKLRIFNFFLADEETRLLITQCPSFKS 840
           KQMSDANCRKLDYETEIDMISENKHSEIDDESEGKLRIFNFFLADEETRLLITQCPSFKS
Sbjct: 781 KQMSDANCRKLDYETEIDMISENKHSEIDDESEGKLRIFNFFLADEETRLLITQCPSFKS 840

Query: 841 IIEEMTYIKQRTQSEPQWKAKTNKPEKGFKYDSWIRCLKYYQCYADVKANGNFPLPF 897
           IIEEMTYIKQRTQSEPQWKAKTNKPEKGFKYDSWIRCLKYYQCYADVKANGNFPLPF
Sbjct: 841 IIEEMTYIKQRTQSEPQWKAKTNKPEKGFKYDSWIRCLKYYQCYADVKANGNFPLPF 897

>TBLA0D02000 Chr4 (494168..497266) [3099 bp, 1032 aa] {ON} 
          Length = 1032

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 93/448 (20%), Positives = 178/448 (39%), Gaps = 52/448 (11%)

Query: 207 QFNCFSSFSVHFNVKLNTIKICFCHKSKHETLPITIIPASLRQYISTNLCFTARECFECL 266
           +F+C S+F +  N     I++   H       P+ I P  L  +I ++      E    L
Sbjct: 267 RFDCKSNFILESNTDFGFIQLTMKHDEHIPYHPLNI-PEGLNSFIRSHYLLLRSELINNL 325

Query: 267 KRTPVYLEFTKSFD--AKAIVRKIWKEISESQWNLDPDSKRSASKILK--RFQNTGDVAL 322
           K+   Y  F  ++   A++ +  +W + + S W     +  SA  ++   ++ N      
Sbjct: 326 KKNNEYNRFITTYKERARSYIENVWADETASTWRRHKVAFLSAIDLISTSKWSNYIQRIT 385

Query: 323 LPVDNCSADLNISLQKAKPIAFIYERIISEIQHDVTEIVIDSTFCLSTDYKQYFVVVASF 382
           LP    +    +S +   P    +++I            + S   +S  +    +VV  +
Sbjct: 386 LPSSLINNSSYVSFEFKYPG---FDKIF------FGSAALTSVQNISKTFNNCHIVVGDY 436

Query: 383 FGKGVPVGFMATETNNVDHLTILWFLRSVLQKLPKVKCINSDWSLAEIKAINLLKCSN-- 440
            G+  P+  +     +     I  FL  +  K      I +D  L    AI+ +  SN  
Sbjct: 437 KGREFPIAVLFLAIEDTSQCIIESFLEVLKVKGYTFNYITTDLQLIHRNAIDKIFGSNTA 496

Query: 441 QICLFHTLTAIR-------CKRLASKKNMTESLFHQQFQSLLNYEWVDDNIFDPTRYEEK 493
           Q+CL++ L  IR        K L  +K  T  L    F                  Y + 
Sbjct: 497 QLCLWNVLKTIREVPSWDEYKVLLQEKKATNYLRRYPF------------------YSQN 538

Query: 494 YQEKVSEYQIREIVRLVR-IAICDHILLHSAGLNK-VFQDSDSENVKV-LKLYEYHLKQL 550
           Y + +  Y    +   V  I I  +++   + ++K  F + + EN K+ LK  E    +L
Sbjct: 539 YDKCIVPYLNSFMCPSVEEIEIVQNLMRQVSKIHKYFFNEINFENEKIYLKFVEDVFNEL 598

Query: 551 YVITVQKFSLPCYFCYLFNQYYNFTSFQIMSRVGKPTFFSVLRTSMMCESYFNQLKSWNL 610
               + K     YF YL++ +   + F++  ++     F +  T+++ + +F++L+    
Sbjct: 599 ----ILKRKQIKYFFYLWSTFIQPSRFKLWVKMSHENIFPLRNTNLIIDLFFHKLEHIYP 654

Query: 611 SGSRNYRFDTLIYI----LLNKEVAKIK 634
               + R DT+IY+    L++K + KIK
Sbjct: 655 KRPSSVRIDTVIYVMIETLIDKYIPKIK 682

>Ecym_3010 Chr3 complement(21352..22215) [864 bp, 287 aa] {ON}
           similar to Ashbya gossypii ACR019W
          Length = 287

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 3/100 (3%)

Query: 149 ERLLELIREGTGYIFVRGWTGYRVNTIILKCHCKQDKCHQILKPRCNVKKHHDPDNLKQF 208
           E L   I+   G    +  T   + ++    +C QDK HQ L    +++K H+ DN KQ+
Sbjct: 190 EGLRNKIKNVCGIKLSKERTSVHITSVSCVLYCSQDKSHQRLIQSKDIQKSHNLDNAKQY 249

Query: 209 NCFSSFSVHFNVKLNTIKICFCHKSKHETLPITIIPASLR 248
            C S   V+++ K + + I F H   +E     I+P+S R
Sbjct: 250 QCQSYMRVNYSFKTHVLSIKFRHTKHNEQ---AILPSSTR 286

>ACR019W Chr3 (390552..391418) [867 bp, 288 aa] {ON} NOHBY317; No
           homolog in Saccharomyces cerevisiae
          Length = 288

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 149 ERLLELIREGTGYIFVRGWTGYRVNTIILKCHCKQDKCHQILKPRCNVKKHHDPDNLKQF 208
           E L   IR  +G    +  T   V ++    +C QDK HQ L      KK+ + DNLKQ+
Sbjct: 183 ECLRNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTKETKKNSNLDNLKQY 242

Query: 209 NCFSSFSVHFNVKLNTIKICFCHKSKHETLPITI 242
           +C S   V+++ K   + I F H  +H   P+ I
Sbjct: 243 HCQSYMRVNYSFKTQVLSIKFRH-IQHGDSPLLI 275

>TDEL0C02460 Chr3 (430625..431254) [630 bp, 209 aa] {ON} Anc_7.301
           YDL186W
          Length = 209

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 64  EYEQVFDFNFDAYTTRGKPAVDSSTSYSDNIFIDGDKNCKIDTKTI-SFLDRKYQSNNQT 122
           ++++VF    +    RGKPA+    +YSDN   +G+    ++ KTI   + R ++ +   
Sbjct: 43  QHDKVFGKKMEINMVRGKPAI----TYSDNSTTEGED--VLENKTIFQPIGRWWRRSRSQ 96

Query: 123 KIESEKQMHVITLKNEQL 140
            + +E     +T  NE+L
Sbjct: 97  SVRTENDSFTLTFDNEEL 114

>KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa]
           {ON} Anc_3.133 YOL075C
          Length = 1284

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 613 SRNYRFDTLIYILLNKEVAKIKESIRITKKFEK-EYDSNCLVQNHRKHLPTWRKQWIIEW 671
           SR+   + +  + L K +A  KE  +   K E  EYD    V N    LP W++ W++  
Sbjct: 281 SRSEEAEEIATLRLTKLLANWKEYEKTNIKAETIEYDRQISVDNMTTMLPFWKQVWVLTR 340

Query: 672 KNI 674
           +N+
Sbjct: 341 RNV 343

>NCAS0B06430 Chr2 (1214203..1218609) [4407 bp, 1468 aa] {ON} Anc_2.253
            YIL115C
          Length = 1468

 Score = 32.0 bits (71), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 39/79 (49%), Gaps = 7/79 (8%)

Query: 774  NGVCNTTKQMSDANCRKLDYETEIDM---ISENKHSEIDDESEGKLRIFNFFLADEETRL 830
            +G+ N   Q+   N  K   ET ID    I EN++ + D+E E KL   ++   D ETR 
Sbjct: 1051 DGISNNETQVK-GNTNKTSDETNIDKEEEIGENQNKDSDNEVESKLSNESYVDVD-ETR- 1107

Query: 831  LITQCPSFKSIIEEMTYIK 849
               +  S   + EE TYIK
Sbjct: 1108 -SEESESASPVEEESTYIK 1125

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 98,896,909
Number of extensions: 4468615
Number of successful extensions: 14233
Number of sequences better than 10.0: 23
Number of HSP's gapped: 14688
Number of HSP's successfully gapped: 23
Length of query: 897
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 778
Effective length of database: 39,836,145
Effective search space: 30992520810
Effective search space used: 30992520810
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)