Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00374g1.2ON22322311621e-163
Ecym_11151.121ON2302402152e-20
Ecym_10021.2ON2302402152e-20
NCAS0B091401.2ON2052232115e-20
Skud_102.1singletonON1851221983e-18
Smik_95.1singletonON1851221983e-18
Suva_3.1471.2ON2101221984e-18
YCR039C (MATALPHA2)1.121ON2101221984e-18
YCL067C (HMLALPHA2)1.2ON2101221984e-18
Skud_3.1181.121ON2101221985e-18
Smik_3.1421.121ON2281231986e-18
NDAI0A001101.2ON2112291968e-18
Suva_3.135singletonON1191141881e-17
Suva_3.74singletonON1191141881e-17
Suva_3.751.121ON1191141881e-17
YCR096C (HMRA2)singletonOFF1191141881e-17
Kpol_2002.31.2ON223861899e-17
KNAG0C001601.2ON2032241862e-16
TPHA0E040701.2ON2312301839e-16
TPHA0E036101.121ON2312301839e-16
KAFR0D007201.121ON206851704e-14
CAGL0B00264g1.2ON210691704e-14
CAGL0B01265g1.121ON186621624e-13
ZYRO0F15818g1.121ON2252281574e-12
ZYRO0F18568g1.2ON2252281574e-12
TBLA0A070501.121ON261701559e-12
TBLA0A076001.2ON230571522e-11
Kwal_YGOB_matalpha21.121ON110781382e-10
Kwal_33.12995singletonOFF110781382e-10
Kwal_YGOB_HMalpha21.2ON110781382e-10
Kwal_33.matalpha2singletonOFF110781382e-10
TDEL0C070001.2ON2371321443e-10
KLTH0F00396g1.2ON108701163e-07
Kpol_1036.566.170ON265741021e-04
KAFR0A043706.170ON40961984e-04
Smik_7.1816.170ON27491966e-04
CAGL0C01551g6.170ON22162940.001
TDEL0F018106.170ON25663940.001
Skud_7.1816.170ON27469920.002
TBLA0C037406.170ON29355910.003
CAGL0H02959g6.170ON25976900.004
YGL096W (TOS8)6.170ON27668890.005
KNAG0F022106.170ON32451890.005
ZYRO0G22044g6.170ON20163860.009
YPL177C (CUP9)6.170ON30671870.010
Smik_6.3746.170ON29471870.011
Skud_16.1036.170ON29556870.011
NCAS0H011306.170ON28051860.014
Suva_16.1326.170ON29256860.015
NDAI0I013206.170ON40963860.016
SAKL0A05610g6.170ON32051840.022
KAFR0G036506.170ON17751820.027
NDAI0F021706.170ON38359840.030
KLTH0H05236g6.170ON23451820.041
Suva_7.1726.170ON27056810.048
TPHA0B025806.170ON26497790.091
NCAS0D035706.170ON25756780.11
AFL049C6.170ON25751780.13
Ecym_22476.170ON34951780.16
Kwal_27.110926.170ON22951740.33
KLLA0B10450g6.170ON38951730.59
KNAG0M005006.170ON29866710.91
TDEL0C050403.362ON454173711.2
NDAI0A006701.122ON9547642.6
NDAI0H00100na 1ON9547642.6
SAKL0H03344g4.236ON88597665.8
SAKL0B09856g7.86ON1274143666.0
KLLA0E05325g4.236ON87593657.7
CAGL0K10428g1.363ON18662637.8
TBLA0I028804.236ON89282658.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00374g
         (223 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...   452   e-163
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...    87   2e-20
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...    87   2e-20
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...    86   5e-20
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)        81   3e-18
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)          81   3e-18
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...    81   4e-18
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...    81   4e-18
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...    81   4e-18
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...    81   5e-18
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...    81   6e-18
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...    80   8e-18
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...    77   1e-17
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    77   1e-17
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    77   1e-17
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...    77   1e-17
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...    77   9e-17
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...    76   2e-16
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...    75   9e-16
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...    75   9e-16
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...    70   4e-14
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...    70   4e-14
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...    67   4e-13
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...    65   4e-12
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...    65   4e-12
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    64   9e-12
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    63   2e-11
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    58   2e-10
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    58   2e-10
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    58   2e-10
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    58   2e-10
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    60   3e-10
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    49   3e-07
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    44   1e-04
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    42   4e-04
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    42   6e-04
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    41   0.001
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    41   0.001
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    40   0.002
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    40   0.003
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    39   0.004
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    39   0.005
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    39   0.005
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    38   0.009
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    38   0.010
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    38   0.011
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    38   0.011
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    38   0.014
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    38   0.015
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    38   0.016
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    37   0.022
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    36   0.027
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    37   0.030
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    36   0.041
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    36   0.048
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    35   0.091
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    35   0.11 
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    35   0.13 
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    35   0.16 
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    33   0.33 
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    33   0.59 
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    32   0.91 
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    32   1.2  
NDAI0A00670 Chr1 complement(124998..125033,125093..125308,125369...    29   2.6  
NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 ...    29   2.6  
SAKL0H03344g Chr8 (318176..320833) [2658 bp, 885 aa] {ON} simila...    30   5.8  
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    30   6.0  
KLLA0E05325g Chr5 (476546..479173) [2628 bp, 875 aa] {ON} simila...    30   7.7  
CAGL0K10428g Chr11 (1019646..1020206) [561 bp, 186 aa] {ON} weak...    29   7.8  
TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {O...    30   8.2  

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score =  452 bits (1162), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 223/223 (100%), Positives = 223/223 (100%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI 60
           MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI
Sbjct: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI 60

Query: 61  ESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVR 120
           ESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVR
Sbjct: 61  ESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVR 120

Query: 121 KINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLA 180
           KINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLA
Sbjct: 121 KINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLA 180

Query: 181 ENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNILN 223
           ENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNILN
Sbjct: 181 ENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNILN 223

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score = 87.4 bits (215), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 121/240 (50%), Gaps = 30/240 (12%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFN------------KERAKVITTFQEMFY 48
           M+RIPI SLLNPS       N+       STF+            K R +++     +  
Sbjct: 1   MNRIPIISLLNPSPG--DSHNIRQTLTSSSTFSLKKDTYEADILLKMRNELMKLHSSICC 58

Query: 49  SMLENNDD---YNKIESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKE 105
           + +EN +     NK+   ++       +S K + +  +  + LTAII +       L+ +
Sbjct: 59  TNIENGEVNFILNKVLQGLKILSSDQVFS-KPDRVVIQNISQLTAIIVR-------LVNK 110

Query: 106 KGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSN---NNEFKKGKRFPKSH 162
           K  +  ++    + ++I +    SK    +   ++TQD+M +     +   KG R PK H
Sbjct: 111 KEDIINLQKGLVDPKEIPE--AISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKH 168

Query: 163 IQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
           +QLLE+WY  N  NPYL + D+  + + T  +++Q+KNW+AN+RRKDK + +S ++ ++L
Sbjct: 169 VQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score = 87.4 bits (215), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 121/240 (50%), Gaps = 30/240 (12%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFN------------KERAKVITTFQEMFY 48
           M+RIPI SLLNPS       N+       STF+            K R +++     +  
Sbjct: 1   MNRIPIISLLNPSPG--DSHNIRQTLTSSSTFSLKKDTYEADILLKMRNELMKLHSSICC 58

Query: 49  SMLENNDD---YNKIESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKE 105
           + +EN +     NK+   ++       +S K + +  +  + LTAII +       L+ +
Sbjct: 59  TNIENGEVNFILNKVLQGLKILSSDQVFS-KPDRVVIQNISQLTAIIVR-------LVNK 110

Query: 106 KGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSN---NNEFKKGKRFPKSH 162
           K  +  ++    + ++I +    SK    +   ++TQD+M +     +   KG R PK H
Sbjct: 111 KEDIINLQKGLVDPKEIPE--AISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKH 168

Query: 163 IQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
           +QLLE+WY  N  NPYL + D+  + + T  +++Q+KNW+AN+RRKDK + +S ++ ++L
Sbjct: 169 VQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score = 85.9 bits (211), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 109/223 (48%), Gaps = 21/223 (9%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI 60
           M++I IH LLNP  + K+       +  L + N +   + + F          N D+   
Sbjct: 1   MNKIAIHDLLNPPNTTKT-------HEQLESINTQLNTICSVFPTT------ENLDFKTY 47

Query: 61  ESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVR 120
           +  +RN    L+       L+ + K  L    Q S     VLLK  G   E   ++ + +
Sbjct: 48  QEQLRNIAVTLSSLTNQNELSSENKNVLRVTYQISS----VLLKLLG---ENAHNKDQPK 100

Query: 121 KINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLA 180
                 +S +N + V   ILT+  M   +NE ++G R  K  + LLE+WY  +  NPYL 
Sbjct: 101 TPTSGSESERNPKLV-FNILTKKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLN 159

Query: 181 ENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNILN 223
           +  L  + + T+L+K QIKNW++NRRRK+K   ++ +I +ILN
Sbjct: 160 KASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILN 202

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 80.9 bits (198), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 101 VLLKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPK 160
           VLLKE   MR IE  R       +  Q +K+ + +   ++TQD+++ +   ++ G RF K
Sbjct: 62  VLLKE---MRSIENDRSNY----QLTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTK 113

Query: 161 SHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRN 220
            ++++LE+W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ +
Sbjct: 114 ENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELAD 173

Query: 221 IL 222
           +L
Sbjct: 174 LL 175

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 80.9 bits (198), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 101 VLLKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPK 160
           VLLKE   MR IE  R       +  Q +K+ + +   ++TQD+++ +   ++ G RF K
Sbjct: 62  VLLKE---MRSIENDRSNY----QLTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTK 113

Query: 161 SHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRN 220
            ++++LE+W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ +
Sbjct: 114 ENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELAD 173

Query: 221 IL 222
           +L
Sbjct: 174 LL 175

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score = 80.9 bits (198), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 101 VLLKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPK 160
           VLLKE   MR IE  R   +      Q +K+ + +   ++TQD+++ +   ++ G RF K
Sbjct: 87  VLLKE---MRSIENDRSNYQ----LTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTK 138

Query: 161 SHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRN 220
            ++++LE+W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ +
Sbjct: 139 ENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELAD 198

Query: 221 IL 222
           +L
Sbjct: 199 LL 200

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score = 80.9 bits (198), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 101 VLLKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPK 160
           VLLKE   MR IE  R   +      Q +K+ + +   ++TQD+++ +   ++ G RF K
Sbjct: 87  VLLKE---MRSIENDRSNYQ----LTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTK 138

Query: 161 SHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRN 220
            ++++LE+W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ +
Sbjct: 139 ENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELAD 198

Query: 221 IL 222
           +L
Sbjct: 199 LL 200

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score = 80.9 bits (198), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 101 VLLKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPK 160
           VLLKE   MR IE  R   +      Q +K+ + +   ++TQD+++ +   ++ G RF K
Sbjct: 87  VLLKE---MRSIENDRSNYQ----LTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTK 138

Query: 161 SHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRN 220
            ++++LE+W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ +
Sbjct: 139 ENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELAD 198

Query: 221 IL 222
           +L
Sbjct: 199 LL 200

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score = 80.9 bits (198), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 101 VLLKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPK 160
           VLLKE   MR IE  R   +      Q +K+ + +   ++TQD+++ +   ++ G RF K
Sbjct: 87  VLLKE---MRSIENDRSNYQ----LTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTK 138

Query: 161 SHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRN 220
            ++++LE+W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ +
Sbjct: 139 ENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELAD 198

Query: 221 IL 222
           +L
Sbjct: 199 LL 200

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score = 80.9 bits (198), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 78/123 (63%), Gaps = 8/123 (6%)

Query: 101 VLLKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPK 160
           VLLKE   MR IE  R       +  Q +K+ + +   ++TQD+++ +   ++ G RF K
Sbjct: 105 VLLKE---MRSIENDRSNY----QLTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTK 156

Query: 161 SHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRN 220
            ++++LE+W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ +
Sbjct: 157 ENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELAD 216

Query: 221 ILN 223
           +L+
Sbjct: 217 LLS 219

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score = 80.1 bits (196), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 113/229 (49%), Gaps = 29/229 (12%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI 60
           M++I I  LLNP  +    SN       L + N +    + T    F +  EN D   +I
Sbjct: 1   MNKIAISDLLNPPTAGPVTSN-------LDSINNQ----LVTICSKFPTAKENVDGSYQI 49

Query: 61  ESLIRNFQPKLTWSHKCESLTFK-----QKAY-LTAIIQKSIKSLLVLLKEKGKMREIEF 114
           +  + N    L+   +  +LT K     Q  Y L++++ K +K +++L   +   ++   
Sbjct: 50  Q--LHNIVSFLSTLTQSTNLTSKDCSNIQLTYELSSMLGKVLKDMVLLNGTEEVEKKKVK 107

Query: 115 SRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNR 174
             +E+   +KY             ++TQD+M    N+  +G R PK  +  LE+WY  + 
Sbjct: 108 EEEELETNSKYV----------FNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHI 157

Query: 175 RNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNILN 223
           + PYL   +L  + + T L+K QIKNW++NRRRK+K+  +S DI  I+N
Sbjct: 158 QKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPDIVEIIN 206

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score = 77.0 bits (188), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 72/114 (63%), Gaps = 5/114 (4%)

Query: 109 MREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLEN 168
           MR IE  R       +  Q +K+ + +   ++TQD+++ +   ++ G RF K ++++LE+
Sbjct: 1   MRSIENDRSNY----QLTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTKENVRILES 55

Query: 169 WYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
           W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ ++L
Sbjct: 56  WFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score = 77.0 bits (188), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 72/114 (63%), Gaps = 5/114 (4%)

Query: 109 MREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLEN 168
           MR IE  R       +  Q +K+ + +   ++TQD+++ +   ++ G RF K ++++LE+
Sbjct: 1   MRSIENDRSNY----QLTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTKENVRILES 55

Query: 169 WYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
           W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ ++L
Sbjct: 56  WFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score = 77.0 bits (188), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 72/114 (63%), Gaps = 5/114 (4%)

Query: 109 MREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLEN 168
           MR IE  R       +  Q +K+ + +   ++TQD+++ +   ++ G RF K ++++LE+
Sbjct: 1   MRSIENDRSNY----QLTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTKENVRILES 55

Query: 169 WYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
           W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ ++L
Sbjct: 56  WFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score = 77.0 bits (188), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 72/114 (63%), Gaps = 5/114 (4%)

Query: 109 MREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLEN 168
           MR IE  R       +  Q +K+ + +   ++TQD+++ +   ++ G RF K ++++LE+
Sbjct: 1   MRSIENDRSNY----QLTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTKENVRILES 55

Query: 169 WYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
           W++ N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ ++L
Sbjct: 56  WFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score = 77.4 bits (189), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 2/86 (2%)

Query: 139 ILTQDLMHSNNNEFK--KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKT 196
           I+TQD+M+      K  +G R PK +++LLE WY  N  NPYL +  ++ + K T+L+K 
Sbjct: 130 IVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKV 189

Query: 197 QIKNWLANRRRKDKITEVSSDIRNIL 222
           QIKNW++NRRRK+K   +S ++  +L
Sbjct: 190 QIKNWVSNRRRKEKSITISPEVSRLL 215

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score = 76.3 bits (186), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 105/224 (46%), Gaps = 25/224 (11%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI 60
           M+RI I  LLN ++ C S+       +D    N +  ++ + F +    +L N+ +    
Sbjct: 1   MNRIEIQDLLN-NQDCSSLD------KDFKNINSQLLEICSNFPK---ELLSNHGELQMQ 50

Query: 61  ESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVR 120
              I  F  KL   +   S+T K +A +T    K I SLL          +  F RKE  
Sbjct: 51  LQGILLFLTKLVGKNDL-SVTLKNEARMTYQFSKIIASLL------KSFEDFFFERKE-- 101

Query: 121 KINKYRQSSKNFESVNIKILTQDLMHSNNNEFK--KGKRFPKSHIQLLENWYSMNRRNPY 178
               Y   + +       ++TQD+M+      +  +G RF  +  + LE+WY  +   PY
Sbjct: 102 ----YNDPATSENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPY 157

Query: 179 LAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
           L +  L  +   T L+K QI+NW++NRRRK+K   VS  I+++L
Sbjct: 158 LDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score = 75.1 bits (183), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 116/230 (50%), Gaps = 15/230 (6%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI 60
           M++IPI+ LLNPS+       +      LS    +    IT   E  +  L++   Y  +
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLY--L 58

Query: 61  ESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREI---EFSRK 117
            ++++  + K     K E +  K    L   +   +KS      ++ K  EI   E    
Sbjct: 59  TTVVKQQELK-----KEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTS 113

Query: 118 EVRKINKYRQSSKNFESVNI---KILTQDLMHSNNNEFK--KGKRFPKSHIQLLENWYSM 172
           +  + N    SS N +  +I    ++TQD+M++N    K  +G R PK ++Q LE+WY  
Sbjct: 114 DNSETNSSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMD 173

Query: 173 NRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
           +R+NPYL E ++  +   T+L++ Q+KNW++NRRRK+K   +S ++  +L
Sbjct: 174 HRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score = 75.1 bits (183), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 116/230 (50%), Gaps = 15/230 (6%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI 60
           M++IPI+ LLNPS+       +      LS    +    IT   E  +  L++   Y  +
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLY--L 58

Query: 61  ESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREI---EFSRK 117
            ++++  + K     K E +  K    L   +   +KS      ++ K  EI   E    
Sbjct: 59  TTVVKQQELK-----KEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTS 113

Query: 118 EVRKINKYRQSSKNFESVNI---KILTQDLMHSNNNEFK--KGKRFPKSHIQLLENWYSM 172
           +  + N    SS N +  +I    ++TQD+M++N    K  +G R PK ++Q LE+WY  
Sbjct: 114 DNSETNSSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMD 173

Query: 173 NRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
           +R+NPYL E ++  +   T+L++ Q+KNW++NRRRK+K   +S ++  +L
Sbjct: 174 HRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score = 70.1 bits (170), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 53/85 (62%), Gaps = 1/85 (1%)

Query: 139 ILTQDLMHSNNNEFK-KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQ 197
           ++TQD+M+ N      +G RF K ++++LE WY+ +   PYL      Y+   T L++ Q
Sbjct: 118 VVTQDMMNLNRTGISYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSRVQ 177

Query: 198 IKNWLANRRRKDKITEVSSDIRNIL 222
           IKNW++NRRRK+K   VS ++  +L
Sbjct: 178 IKNWVSNRRRKEKSVHVSPELIQLL 202

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score = 70.1 bits (170), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 1/69 (1%)

Query: 154 KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITE 213
           +G RF + ++Q+LE WY  +  NPYL  N   Y+++ T L+K QIKNW+ANRRRK K   
Sbjct: 111 RGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIY 170

Query: 214 VS-SDIRNI 221
           +S  DI NI
Sbjct: 171 ISLFDIHNI 179

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score = 67.0 bits (162), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (67%)

Query: 154 KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITE 213
           +G RF + ++Q+LE WY  +  NPYL  N   Y+++ T L+K QIKNW+ANRRRK K   
Sbjct: 111 RGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIY 170

Query: 214 VS 215
           +S
Sbjct: 171 IS 172

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 106/228 (46%), Gaps = 21/228 (9%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLEN-NDDYNK 59
           M++IPI  LLNP                   F  E+ K I        S L + N+ + K
Sbjct: 1   MNKIPIERLLNPVHQ---------------EFPHEKLKNINNKLLALCSKLPSENEQFEK 45

Query: 60  IESLIRNFQPKL-TWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKE 118
            ++ +    P L     +C S    QK         S+ SLL+    + K +  +F R +
Sbjct: 46  DKAELEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSK 105

Query: 119 VRKINKYRQSSKNF--ESVNIKILTQDLMHS--NNNEFKKGKRFPKSHIQLLENWYSMNR 174
            +    Y  +  N   E +   I+TQD ++S   +N+  +G R PK   +LLE+W++ N 
Sbjct: 106 PKYHLPYAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNI 165

Query: 175 RNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
            +PYL  + +  +   T L+  QIKNW++NRRRK+K   +S ++  ++
Sbjct: 166 EHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 106/228 (46%), Gaps = 21/228 (9%)

Query: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLEN-NDDYNK 59
           M++IPI  LLNP                   F  E+ K I        S L + N+ + K
Sbjct: 1   MNKIPIERLLNPVHQ---------------EFPHEKLKNINNKLLALCSKLPSENEQFEK 45

Query: 60  IESLIRNFQPKL-TWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKE 118
            ++ +    P L     +C S    QK         S+ SLL+    + K +  +F R +
Sbjct: 46  DKAELEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSK 105

Query: 119 VRKINKYRQSSKNF--ESVNIKILTQDLMHS--NNNEFKKGKRFPKSHIQLLENWYSMNR 174
            +    Y  +  N   E +   I+TQD ++S   +N+  +G R PK   +LLE+W++ N 
Sbjct: 106 PKYHLPYAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNI 165

Query: 175 RNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222
            +PYL  + +  +   T L+  QIKNW++NRRRK+K   +S ++  ++
Sbjct: 166 EHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 64.3 bits (155), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 51/70 (72%), Gaps = 1/70 (1%)

Query: 154 KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKIT- 212
           +G R PK  +  LE W+  N+ +PYL  +DL  ++  ++L+KTQ+KNW++NRRRK++ + 
Sbjct: 170 RGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHSL 229

Query: 213 EVSSDIRNIL 222
           ++S++I ++L
Sbjct: 230 KISNNIASLL 239

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 41/57 (71%)

Query: 154 KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDK 210
           +G R PK  +  LE W+  N+ +PYL  +DL  ++  ++L+KTQ+KNW++NRRRK++
Sbjct: 170 RGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 48/78 (61%)

Query: 133 ESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTT 192
           +++  KIL+   ++S     +K  ++P +    LENW+ +N  +PYL    ++ +S+ T 
Sbjct: 14  DAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTN 73

Query: 193 LTKTQIKNWLANRRRKDK 210
           L+  QI+NW++NRRRK K
Sbjct: 74  LSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 48/78 (61%)

Query: 133 ESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTT 192
           +++  KIL+   ++S     +K  ++P +    LENW+ +N  +PYL    ++ +S+ T 
Sbjct: 14  DAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTN 73

Query: 193 LTKTQIKNWLANRRRKDK 210
           L+  QI+NW++NRRRK K
Sbjct: 74  LSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 48/78 (61%)

Query: 133 ESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTT 192
           +++  KIL+   ++S     +K  ++P +    LENW+ +N  +PYL    ++ +S+ T 
Sbjct: 14  DAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTN 73

Query: 193 LTKTQIKNWLANRRRKDK 210
           L+  QI+NW++NRRRK K
Sbjct: 74  LSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 48/78 (61%)

Query: 133 ESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTT 192
           +++  KIL+   ++S     +K  ++P +    LENW+ +N  +PYL    ++ +S+ T 
Sbjct: 14  DAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTN 73

Query: 193 LTKTQIKNWLANRRRKDK 210
           L+  QI+NW++NRRRK K
Sbjct: 74  LSSKQIRNWMSNRRRKSK 91

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 10/132 (7%)

Query: 97  KSLLVLLKEKGKMRE--IEFSRKE----VRKINKYRQSSKNFESVNIKILTQDLMHSNNN 150
           K+L V+L E  K+ E  I+F +       RK    R    NFE V +    QD    +  
Sbjct: 98  KTLSVVLSEFKKVEESNIQFHKSRDWDSERKETNLRCKVPNFEIVPLNT-KQDY---STG 153

Query: 151 EFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDK 210
           +  +G R P   ++ LE W++ N   PYL +  L  +   T+L+  QIKNWL+NRRRK K
Sbjct: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213

Query: 211 ITEVSSDIRNIL 222
              ++  I ++L
Sbjct: 214 SAGIADTISDLL 225

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 154 KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITE 213
           K ++F  +  + LE W+  N + PY  +  +  +SKNT L+  QI+NW++NRRRK +   
Sbjct: 38  KQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKES 97

Query: 214 VSSDIRNILN 223
           + S +  ILN
Sbjct: 98  IDSLLEPILN 107

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 152 FKKGKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKD 209
              GKR   PK+ +Q+L  W   + +NPY    +   + K T LTK Q+ NW  N RR+ 
Sbjct: 155 IGAGKRSNLPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRRR- 213

Query: 210 KITEVSSDIRNILN 223
              ++ SD  +I+N
Sbjct: 214 ---KIFSDYYDIVN 224

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 155 GKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKIT 212
           GKR   PK  +Q+L NW   +  NPY    +   + K T LTK Q+ NW  N RR+   T
Sbjct: 270 GKRSNLPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRRKVFT 329

Query: 213 E 213
           +
Sbjct: 330 D 330

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 11/91 (12%)

Query: 140 LTQDLMHSNNNEF--------KKGKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISK 189
           +  + +H ++NEF          GKR   PK+ + +L  W   +  NPY    +   +  
Sbjct: 171 INMNTVHGSSNEFSVKEKKHKAHGKRTNLPKATVSILNKWLLEHINNPYPTVQEKRELLA 230

Query: 190 NTTLTKTQIKNWLANRRRKDKITEVSSDIRN 220
            T LTK QI NW  N RR+ KI    +D  N
Sbjct: 231 KTGLTKLQISNWFINARRR-KIFSGQNDANN 260

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 150 NEFKKGKR---FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRR 206
           N  KK KR    PK  IQ+L  W   +  NPY  + +   +   T LTK Q+ NW  N R
Sbjct: 71  NMMKKSKRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVR 130

Query: 207 RK 208
           R+
Sbjct: 131 RR 132

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 148 NNNEFKKGKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANR 205
           N+     G+R   PK  +Q+L  W   + RNPY    +   +   T LTK Q+ NW  N 
Sbjct: 124 NSGGISNGRRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINV 183

Query: 206 RRK 208
           RR+
Sbjct: 184 RRR 186

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 155 GKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKIT 212
           GKR   PK+ + +L  W   +  NPY    +   +   T LTK QI NW  N RR+ KI 
Sbjct: 194 GKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRR-KIF 252

Query: 213 EVSSDIRNI 221
              +D+ N+
Sbjct: 253 AGHNDVNNL 261

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%)

Query: 154 KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
           K    PK  +Q+L +W   + RNPY    + + +   T LTK Q+ NW  N RR+
Sbjct: 178 KRSNLPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRR 232

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 4/76 (5%)

Query: 148 NNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRR 207
                KK    PK  +++L  W   +  NPY    +   +S  T LTK Q+ NW  N RR
Sbjct: 158 GQGAVKKRANLPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRR 217

Query: 208 KDKITEVSSDIRNILN 223
           +    +V +D  +I N
Sbjct: 218 R----KVFADYYDITN 229

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 155 GKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKIT 212
           GKR   PK+ + +L  W   +  NPY    +   +   T LTK QI NW  N RR+ KI 
Sbjct: 196 GKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR-KIF 254

Query: 213 EVSSDIRN 220
              +D  N
Sbjct: 255 SGQNDANN 262

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            P+  +Q+L NW   +  +PY   ++   + + T LTK Q+ NW  N RR+
Sbjct: 246 LPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRR 296

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 148 NNNEFKKGKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANR 205
           N+   + G+R   PK  +Q+L  W   +  NPY    +   +   T LTK Q+ NW  N 
Sbjct: 72  NHKGSRSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQLSNWFINV 131

Query: 206 RRK 208
           RR+
Sbjct: 132 RRR 134

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 155 GKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKIT 212
           G+R   PK  +Q+L  W   +  NPY  + +   +   T LTK Q+ NW  N RR+   +
Sbjct: 164 GRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIFS 223

Query: 213 EVSSDIRNILN 223
           +  + + +I N
Sbjct: 224 DYYTLVNSIPN 234

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 155 GKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKIT 212
           G+R   PK  +Q+L  W   +  NPY  + +   +   T LTK Q+ NW  N RR+   +
Sbjct: 152 GRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIFS 211

Query: 213 EVSSDIRNILN 223
           +  + + +I N
Sbjct: 212 DYYTLVNSIPN 222

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 155 GKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
           G+R   PK  +Q+L  W   +  NPY  + +   +   T LTK Q+ NW  N RR+
Sbjct: 153 GRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 208

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            PK  +Q+L  W   + +NPY    +   +   T LTK Q+ NW  N RR+
Sbjct: 133 LPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRR 183

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 155 GKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
           G+R   PK  +Q+L  W   +  NPY  + +   +   T LTK Q+ NW  N RR+
Sbjct: 150 GRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 205

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 155 GKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKIT 212
           G+R   P + +Q+L  W   +  NPY    +   + K T LTK Q+ NW  N RR+    
Sbjct: 307 GRRSSLPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWFINVRRRKVFN 366

Query: 213 EVS 215
           E S
Sbjct: 367 ENS 369

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            PK  +Q+L NW   +  NPY +  +   +   T L   Q+ NW  N RR+
Sbjct: 213 LPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRR 263

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            PK  IQ+L  W   +  NPY    +   +   T LTK Q+ NW  N RR+
Sbjct: 76  LPKETIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRR 126

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 152 FKKGKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            + G+R   PK  I++L +W   + +NPY    +   +   T LTK Q+ NW  N RR+
Sbjct: 262 LQHGRRSNLPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRR 320

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            PK  +++L  W + +  NPY +  +   +   T L+K Q+ NW  N RR+
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRR 159

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 35.8 bits (81), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 155 GKR--FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
           GKR   P + + +L  W   +  NPY    +   +   T LTK QI NW  N RR+
Sbjct: 196 GKRSNLPGATVHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRR 251

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 35.0 bits (79), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 15/97 (15%)

Query: 129 SKNFESVNIKILTQDLMHSNNNEFKKGKR--FPKSHIQLLENWYSMNRRNPYLAENDLAY 186
           SK+F ++N +  ++  +         GKR   PK  + +L  W   +  NPY    +   
Sbjct: 138 SKSFSTINTQTTSKTSI---------GKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEE 188

Query: 187 ISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNILN 223
           + + T L+K Q+ NW  N RR+    ++ +D  N++N
Sbjct: 189 LLELTGLSKIQLSNWFINVRRR----KIFNDYYNLIN 221

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITE 213
            P+  +++L  W   +  NPY    +   + + T LTK Q+ NW  N RR+    E
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRKVFNE 242

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            PK  + +L  W   +  NPY +  +   + K T L   Q+ NW  N RR+
Sbjct: 138 LPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRR 188

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            PK  + +L  W   +  NPY +  +   + K T L   Q+ NW  N RR+
Sbjct: 230 LPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRR 280

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            PK  + +L NW   +   PY +  +   +   T L+K Q+ NW  N RR+
Sbjct: 125 LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRR 175

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 32.7 bits (73), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRK 208
            PK  I +L +W   N  NPY        + + T L   Q+ NW  N RR+
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRR 306

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 158 FPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSD 217
            PK  + +L  W   +  NPY    +   +   T L+K Q+ NW  N RR+    +V SD
Sbjct: 183 LPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRR----KVFSD 238

Query: 218 IRNILN 223
             ++ N
Sbjct: 239 YYSLAN 244

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 67/173 (38%), Gaps = 14/173 (8%)

Query: 3   RIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLEN-----NDDY 57
           R  + +LL+  E     SNV +  RDL  FN E    + +F  M+  ++        D  
Sbjct: 131 RSSLEALLHADEDDDEKSNVSTGQRDLKQFNLEGDCPLFSFIPMYCQVITGATLMLADKV 190

Query: 58  NKIESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKG--KMREIEFS 115
            K E  I      + W        FKQKA     +   I  L+  L+ KG  K+  I+F 
Sbjct: 191 IKGERSI-----GINWDGG-RHHAFKQKASGFCYV-NDIVLLIQKLRRKGFQKISYIDFD 243

Query: 116 RKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLEN 168
                 + K  Q S N +++++ +          N  +  KR    +I LL  
Sbjct: 244 LHHGDGVEKAFQFSSNVQTISLHLFEVGFFPGTGNLSESDKRRNVVNIPLLHG 296

>NDAI0A00670 Chr1
           complement(124998..125033,125093..125308,125369..125404)
           [288 bp, 95 aa] {ON}
          Length = 95

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 165 LLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKI 211
           LLEN +   ++ P+L   +  +++K+  ++  Q++ W  N+R + KI
Sbjct: 51  LLENIF---QKKPWLNTKEREFVAKSCGMSALQVRVWFINKRMRTKI 94

>NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 bp,
           95 aa] {ON} silent copy of MATa1 gene at HMRa
          Length = 95

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 165 LLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKI 211
           LLEN +   ++ P+L   +  +++K+  ++  Q++ W  N+R + KI
Sbjct: 51  LLENIF---QKKPWLNTKEREFVAKSCGMSALQVRVWFINKRMRTKI 94

>SAKL0H03344g Chr8 (318176..320833) [2658 bp, 885 aa] {ON} similar
           to uniprot|P11325 Saccharomyces cerevisiae YLR382C NAM2
           Mitochondrial leucyl-tRNA synthetase also has a direct
           role in splicing of several mitochondrial group I
           introns indirectly required for mitochondrial genome
           maintenance
          Length = 885

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 44/97 (45%), Gaps = 6/97 (6%)

Query: 125 YRQSSK-NFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAEND 183
           YR+ ++ N++  +  +L  + + +    ++ G    K   +LL  W+    +  +  + D
Sbjct: 172 YRKEAEINWDPEDQTVLANEQVDAEGRSWRSGALVEK---RLLSQWFLGITKFAHALQKD 228

Query: 184 LAYISKNTTLTKTQIKNWLANRRRKDKI--TEVSSDI 218
           L Y++   T  KT  KNW+      D +  + +  DI
Sbjct: 229 LQYLNDWPTSVKTMQKNWIGESEGTDLVFKSTIGDDI 265

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 29/143 (20%), Positives = 56/143 (39%), Gaps = 21/143 (14%)

Query: 17   KSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKIESLIRN---------- 66
            + +  +PS  + ++T NK+  + I T  + F      +DDY  IE+ +            
Sbjct: 1059 RKLGTIPSEIQIMATLNKKPHENILTLLDFF-----EDDDYYYIETPMHGETGSIDLFDL 1113

Query: 67   FQPKLTWSHKCESLTFKQKA------YLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVR 120
             + K   +     L FKQ A      +   I+ + IK   +++  KG ++ I+F      
Sbjct: 1114 IELKTNMTEHEAKLIFKQVASGIKHLHDNGIVHRDIKDENIIVDNKGFVKLIDFGSAAYV 1173

Query: 121  KINKYRQSSKNFESVNIKILTQD 143
            K   +       +    ++L  D
Sbjct: 1174 KSGPFDVFVGTIDYAAPEVLGGD 1196

>KLLA0E05325g Chr5 (476546..479173) [2628 bp, 875 aa] {ON} similar
           to uniprot|P11325 Saccharomyces cerevisiae YLR382C NAM2
           Mitochondrial leucyl-tRNA synthetase also has a direct
           role in splicing of several mitochondrial group I
           introns indirectly required for mitochondrial genome
           maintenance
          Length = 875

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 44/93 (47%), Gaps = 4/93 (4%)

Query: 125 YRQSSK-NFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAEND 183
           YR+ ++ N++ V+  +L  + + SN   ++ G +  K   +LL  W+    R  +  ++D
Sbjct: 165 YRKEAEINWDPVDQTVLANEQVDSNGKSWRSGAQVEK---KLLSQWFLGITRFAHELQHD 221

Query: 184 LAYISKNTTLTKTQIKNWLANRRRKDKITEVSS 216
           L  +    +  K   KNW+   +  + +  + S
Sbjct: 222 LDGLDGWPSHVKRMQKNWIGESKGVEVVFNLPS 254

>CAGL0K10428g Chr11 (1019646..1020206) [561 bp, 186 aa] {ON} weakly
           similar to uniprot|P43598 Saccharomyces cerevisiae
           YFR017c
          Length = 186

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 103 LKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILT-QDLMHSNNNEFKKGKRFPKS 161
           L++KG +RE+E  R +V K++   +   N+   N+  ++ QD+ H ++  F  G     S
Sbjct: 64  LRDKGLLREMEEVRTDVDKVSS--KGDNNYTYGNLTSMSQQDMKHESSKYFMAG----SS 117

Query: 162 HI 163
           HI
Sbjct: 118 HI 119

>TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {ON}
           Anc_4.236 YLR382C
          Length = 892

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 125 YRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDL 184
           ++++  N++ V+  +L  + + S  + ++ G    K   ++L+ W+    +  +   NDL
Sbjct: 175 HKEAEINWDPVDKTVLANEQVDSTGHSWRSGALVEK---KMLKQWFLGITKFGHALMNDL 231

Query: 185 AYISKNTTLTKTQIKNWLANRR 206
            Y+       K+  KNW++  +
Sbjct: 232 KYLDDWPAKVKSMQKNWISESK 253

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,135,146
Number of extensions: 1113225
Number of successful extensions: 5956
Number of sequences better than 10.0: 203
Number of HSP's gapped: 6078
Number of HSP's successfully gapped: 205
Length of query: 223
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 118
Effective length of database: 41,441,469
Effective search space: 4890093342
Effective search space used: 4890093342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)