Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C00352g1.1ON26126113920.0
KLTH0F00374g1.1ON2492592593e-26
Kwal_33.matalpha1singletonOFF2442672567e-26
Kwal_33.12992singletonOFF2442672567e-26
Kwal_YGOB_matalpha11.120ON2442672567e-26
Kwal_YGOB_HMalpha11.1ON2442672567e-26
Ecym_10031.1ON2632072323e-22
Ecym_11141.120ON2632072323e-22
ZYRO0F18590g1.1ON2001911794e-15
ZYRO0F15840g1.120ON2001911794e-15
Suva_3.1481.1ON1751181503e-11
YCR040W (MATALPHA1)1.120ON175731478e-11
YCL066W (HMLALPHA1)1.1ON175731478e-11
Skud_3.1191.120ON1741751451e-10
KNAG0C001501.1ON1451591396e-10
Smik_92.1singletonON156711388e-10
Skud_71.1singletonON1551731371e-09
Suva_69.2singletonON1451011272e-08
TDEL0C070101.1ON2051961276e-08
Kpol_2002.21.1ON2092021267e-08
CAGL0B00242g1.1ON1841841257e-08
CAGL0B01243g1.120ON143641122e-06
NCAS0B091501.1ON1501521123e-06
KAFR0D007101.120ON1721631099e-06
TPHA0E036201.120ON1952021072e-05
TPHA0E040801.1ON1952021072e-05
TBLA0A070401.120ON2011771021e-04
TBLA0A075901.1ON2011771021e-04
NDAI0A001001.1ON13566720.47
ZYRO0C16214g3.354ON35760750.49
YBR260C (RGD1)1.342ON66683675.9
CAGL0K07007g6.150ON73672659.0
SAKL0H11968g8.469ON56666659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C00352g
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...   540   0.0  
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...   104   3e-26
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...   103   7e-26
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...   103   7e-26
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...   103   7e-26
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...   103   7e-26
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    94   3e-22
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    94   3e-22
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...    74   4e-15
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...    74   4e-15
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    62   3e-11
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    61   8e-11
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    61   8e-11
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    60   1e-10
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    58   6e-10
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    58   8e-10
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    57   1e-09
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        54   2e-08
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....    54   6e-08
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    53   7e-08
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    53   7e-08
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    48   2e-06
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      48   3e-06
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    47   9e-06
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    46   2e-05
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    46   2e-05
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    44   1e-04
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    44   1e-04
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    32   0.47 
ZYRO0C16214g Chr3 (1265998..1267071) [1074 bp, 357 aa] {ON} simi...    33   0.49 
YBR260C Chr2 complement(732639..734639) [2001 bp, 666 aa] {ON}  ...    30   5.9  
CAGL0K07007g Chr11 (687697..689907) [2211 bp, 736 aa] {ON} highl...    30   9.0  
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...    30   9.4  

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60
           MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP
Sbjct: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60

Query: 61  APPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSRLL 120
           APPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSRLL
Sbjct: 61  APPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSRLL 120

Query: 121 NGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQWLYE 180
           NGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQWLYE
Sbjct: 121 NGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQWLYE 180

Query: 181 IVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFDTEFL 240
           IVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFDTEFL
Sbjct: 181 IVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFDTEFL 240

Query: 241 ATSFDRTNLIISDCYSLMNSV 261
           ATSFDRTNLIISDCYSLMNSV
Sbjct: 241 ATSFDRTNLIISDCYSLMNSV 261

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score =  104 bits (259), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 120/259 (46%), Gaps = 45/259 (17%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60
           M S  P+FKV + K+  +            + R+   SS+  +  G NLYMS   P +IP
Sbjct: 1   MNSTKPSFKVLIKKKGKT------------LNRRLKNSSKSYRENGANLYMSYSKPQAIP 48

Query: 61  APPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVK-------TKTKKKQINDFIAFR 113
            PP  L+  ++ K KT   S     L N   L   DVK           KK+IN FI FR
Sbjct: 49  KPPNTLINLVRSK-KTSQSSR--KCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFR 105

Query: 114 SYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGI 173
           SYY++   G + Q ELS I+S++WT + +    WE   Q YN + +   F  WLE NY  
Sbjct: 106 SYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWLEENY-- 163

Query: 174 DKQWLYEIVQYE-ECLTPTTKKPYVENIYNSG--FKQRIDSPNQKDIT------------ 218
             Q  YE  + + EC+   + +PY+E++Y+    F  ++ S    DI+            
Sbjct: 164 --QQSYEESELDSECMAKRS-QPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNS 220

Query: 219 ---FSQSDNSADWLVDPIF 234
              F + + + DW++  I 
Sbjct: 221 LPFFEEHNRTTDWMLSSIL 239

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score =  103 bits (256), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 128/267 (47%), Gaps = 42/267 (15%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60
           MK   P+FKV+V+KR  + ++    KI    +++  VS      EGVNLYMS      IP
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKP---KISKKSLKRNYVS------EGVNLYMSYSKQELIP 51

Query: 61  APPQVLVAYIK-EKVKTLNKSEVLMSLG-NSNQLSSRDVKTK--TKKKQINDFIAFRSYY 116
            PP+ ++  +  +  K L+K    +S G + +Q S   + +   T KK+IN FI FRSYY
Sbjct: 52  KPPKAVMKILGSDHGKGLSKG---LSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYY 108

Query: 117 SRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQ 176
           +R++ G + Q ELSTI+S++W    Q  K WE   + YN D +   F  WLE NY  +  
Sbjct: 109 ARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPE-- 166

Query: 177 WLYEIVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFD 236
                ++    +  +   P++E+IY+                  Q+  S +W    +F  
Sbjct: 167 -----IEGTAAVEISYGLPFIEDIYH-----------------EQAVKSTEWTPQELFGT 204

Query: 237 TEFLATSFDRTNLI--ISDCYSLMNSV 261
            E      D  N I  I D   L++S+
Sbjct: 205 KELHQEYQDILNKIIPIEDYSQLIDSL 231

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score =  103 bits (256), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 128/267 (47%), Gaps = 42/267 (15%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60
           MK   P+FKV+V+KR  + ++    KI    +++  VS      EGVNLYMS      IP
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKP---KISKKSLKRNYVS------EGVNLYMSYSKQELIP 51

Query: 61  APPQVLVAYIK-EKVKTLNKSEVLMSLG-NSNQLSSRDVKTK--TKKKQINDFIAFRSYY 116
            PP+ ++  +  +  K L+K    +S G + +Q S   + +   T KK+IN FI FRSYY
Sbjct: 52  KPPKAVMKILGSDHGKGLSKG---LSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYY 108

Query: 117 SRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQ 176
           +R++ G + Q ELSTI+S++W    Q  K WE   + YN D +   F  WLE NY  +  
Sbjct: 109 ARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPE-- 166

Query: 177 WLYEIVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFD 236
                ++    +  +   P++E+IY+                  Q+  S +W    +F  
Sbjct: 167 -----IEGTAAVEISYGLPFIEDIYH-----------------EQAVKSTEWTPQELFGT 204

Query: 237 TEFLATSFDRTNLI--ISDCYSLMNSV 261
            E      D  N I  I D   L++S+
Sbjct: 205 KELHQEYQDILNKIIPIEDYSQLIDSL 231

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score =  103 bits (256), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 128/267 (47%), Gaps = 42/267 (15%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60
           MK   P+FKV+V+KR  + ++    KI    +++  VS      EGVNLYMS      IP
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKP---KISKKSLKRNYVS------EGVNLYMSYSKQELIP 51

Query: 61  APPQVLVAYIK-EKVKTLNKSEVLMSLG-NSNQLSSRDVKTK--TKKKQINDFIAFRSYY 116
            PP+ ++  +  +  K L+K    +S G + +Q S   + +   T KK+IN FI FRSYY
Sbjct: 52  KPPKAVMKILGSDHGKGLSKG---LSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYY 108

Query: 117 SRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQ 176
           +R++ G + Q ELSTI+S++W    Q  K WE   + YN D +   F  WLE NY  +  
Sbjct: 109 ARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPE-- 166

Query: 177 WLYEIVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFD 236
                ++    +  +   P++E+IY+                  Q+  S +W    +F  
Sbjct: 167 -----IEGTAAVEISYGLPFIEDIYH-----------------EQAVKSTEWTPQELFGT 204

Query: 237 TEFLATSFDRTNLI--ISDCYSLMNSV 261
            E      D  N I  I D   L++S+
Sbjct: 205 KELHQEYQDILNKIIPIEDYSQLIDSL 231

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score =  103 bits (256), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 128/267 (47%), Gaps = 42/267 (15%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60
           MK   P+FKV+V+KR  + ++    KI    +++  VS      EGVNLYMS      IP
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKP---KISKKSLKRNYVS------EGVNLYMSYSKQELIP 51

Query: 61  APPQVLVAYIK-EKVKTLNKSEVLMSLG-NSNQLSSRDVKTK--TKKKQINDFIAFRSYY 116
            PP+ ++  +  +  K L+K    +S G + +Q S   + +   T KK+IN FI FRSYY
Sbjct: 52  KPPKAVMKILGSDHGKGLSKG---LSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYY 108

Query: 117 SRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQ 176
           +R++ G + Q ELSTI+S++W    Q  K WE   + YN D +   F  WLE NY  +  
Sbjct: 109 ARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPE-- 166

Query: 177 WLYEIVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFD 236
                ++    +  +   P++E+IY+                  Q+  S +W    +F  
Sbjct: 167 -----IEGTAAVEISYGLPFIEDIYH-----------------EQAVKSTEWTPQELFGT 204

Query: 237 TEFLATSFDRTNLI--ISDCYSLMNSV 261
            E      D  N I  I D   L++S+
Sbjct: 205 KELHQEYQDILNKIIPIEDYSQLIDSL 231

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 94.0 bits (232), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 109/207 (52%), Gaps = 10/207 (4%)

Query: 5   APTFKVAVSK---RSCSSVRKTSKKIRSGMIRKPSVSSR---YRKHEGVNLYMSKVTPTS 58
            P F+V + K   R  S  RK S  ++   I+     ++   Y K EGVNLYM+   P  
Sbjct: 8   TPMFRVKIKKPKTRKGSRRRKGSSVLKILEIKNQDNYNKKKGYYKCEGVNLYMTSGPPKK 67

Query: 59  IPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSR 118
           IP PP+ L+ YIK++       ++  S  N +   S +     K+K+IN+F+AFRSYYSR
Sbjct: 68  IPEPPKELLRYIKQQ--NFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSR 125

Query: 119 LLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQWL 178
              GI+ Q ELS I+++ W    + ++ WE+ A+ YN +   + F  WLE  Y       
Sbjct: 126 FFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTY-TSSYTP 184

Query: 179 YEIVQYEECLTPTTKKPYVENIY-NSG 204
              V+ ++     +K PYVE++Y N+G
Sbjct: 185 KGKVKIDDDQDEKSKHPYVEDLYLNTG 211

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 94.0 bits (232), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 109/207 (52%), Gaps = 10/207 (4%)

Query: 5   APTFKVAVSK---RSCSSVRKTSKKIRSGMIRKPSVSSR---YRKHEGVNLYMSKVTPTS 58
            P F+V + K   R  S  RK S  ++   I+     ++   Y K EGVNLYM+   P  
Sbjct: 8   TPMFRVKIKKPKTRKGSRRRKGSSVLKILEIKNQDNYNKKKGYYKCEGVNLYMTSGPPKK 67

Query: 59  IPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSR 118
           IP PP+ L+ YIK++       ++  S  N +   S +     K+K+IN+F+AFRSYYSR
Sbjct: 68  IPEPPKELLRYIKQQ--NFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSR 125

Query: 119 LLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQWL 178
              GI+ Q ELS I+++ W    + ++ WE+ A+ YN +   + F  WLE  Y       
Sbjct: 126 FFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTY-TSSYTP 184

Query: 179 YEIVQYEECLTPTTKKPYVENIY-NSG 204
              V+ ++     +K PYVE++Y N+G
Sbjct: 185 KGKVKIDDDQDEKSKHPYVEDLYLNTG 211

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 73.6 bits (179), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 90/191 (47%), Gaps = 25/191 (13%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60
            KSN P FKV V K+     R     ++        ++ +  + + VN++M+      IP
Sbjct: 9   FKSNQPLFKVKVEKKG----RSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIP 64

Query: 61  APPQVLVAYIKEKVKTLNKSEVLM------------------SLGNS--NQLSSRDVKTK 100
           +PP+VL+  I+E+   L K +  M                  S+ +S  N LS++  +  
Sbjct: 65  SPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKG 124

Query: 101 TKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASG 160
             +K +N F+AFR+Y S+  NG L Q  LS++++  W    + +K W+  AQ++N     
Sbjct: 125 CSEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPK 183

Query: 161 KHFFNWLEVNY 171
             F  W++  Y
Sbjct: 184 CGFVEWVDQRY 194

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 73.6 bits (179), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 90/191 (47%), Gaps = 25/191 (13%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60
            KSN P FKV V K+     R     ++        ++ +  + + VN++M+      IP
Sbjct: 9   FKSNQPLFKVKVEKKG----RSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIP 64

Query: 61  APPQVLVAYIKEKVKTLNKSEVLM------------------SLGNS--NQLSSRDVKTK 100
           +PP+VL+  I+E+   L K +  M                  S+ +S  N LS++  +  
Sbjct: 65  SPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKG 124

Query: 101 TKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASG 160
             +K +N F+AFR+Y S+  NG L Q  LS++++  W    + +K W+  AQ++N     
Sbjct: 125 CSEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPK 183

Query: 161 KHFFNWLEVNY 171
             F  W++  Y
Sbjct: 184 CGFVEWVDQRY 194

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 55/118 (46%), Gaps = 16/118 (13%)

Query: 59  IPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQ----LSSRDVKTKTKKKQINDFIAFRS 114
           IPAP  + +  I+           L  + + NQ      SR       KK +N F+AFR+
Sbjct: 53  IPAPSPLFLKKIQ-----------LYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRA 101

Query: 115 YYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYG 172
           YYS+   G+  Q  LS+++S+ W  DK     W+  AQ+YN    G  F  WL  NY 
Sbjct: 102 YYSQFGAGV-KQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 158

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 100 KTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDAS 159
           K+ KK +N F+AFR+YYS+  +G+  Q  LS+++++ W  DK     W+  AQ+YN    
Sbjct: 87  KSSKKYLNSFMAFRAYYSQFGSGV-KQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINP 145

Query: 160 GKHFFNWLEVNYG 172
           G  F  WL  NY 
Sbjct: 146 GFGFVEWLTNNYA 158

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 100 KTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDAS 159
           K+ KK +N F+AFR+YYS+  +G+  Q  LS+++++ W  DK     W+  AQ+YN    
Sbjct: 87  KSSKKYLNSFMAFRAYYSQFGSGV-KQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINP 145

Query: 160 GKHFFNWLEVNYG 172
           G  F  WL  NY 
Sbjct: 146 GFGFVEWLTNNYA 158

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 83/175 (47%), Gaps = 21/175 (12%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKT--SKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTS 58
           M ++ P F++   K++  S RKT  SK   +G++++ S S         N+         
Sbjct: 1   MFTSKPAFRI--KKKTSKSYRKTVISKVEGNGIVKRISPSC-------FNVIRPLKKDIQ 51

Query: 59  IPAPPQVLVAYIK-EKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYS 117
           IPAP    +  I+  ++ + N++     L             K+ KK IN F+AFR+YYS
Sbjct: 52  IPAPASRFLKKIQIHRISSGNQTTQCRQL--------SKASIKSSKKHINSFMAFRAYYS 103

Query: 118 RLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYG 172
           +  +G+  Q  LS+++S+ W  DK     W+  AQ+YN    G  F  WL  NY 
Sbjct: 104 QFGSGV-KQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 157

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 58.2 bits (139), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 85/159 (53%), Gaps = 25/159 (15%)

Query: 1   MKSNAPTFKVAVSKRSCS--SVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTS 58
           M S  P FK+ +++   S  S+RK +        R+P+++S        +   +K TP  
Sbjct: 1   MFSKKPLFKMNITQSHSSNKSIRKRT--------RRPNLNS------FASTNAAKNTPK- 45

Query: 59  IPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTK---TKKKQINDFIAFRSY 115
           IP P  ++ A +    + LN    ++S  +S+ LS++ +++     K   +N FIAFR+Y
Sbjct: 46  IPDP-NIIRAVL---FRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAY 101

Query: 116 YSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEY 154
           YS+  NGI  Q +LS+I+SK W  ++  +  W+ + ++Y
Sbjct: 102 YSQFANGI-NQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 57.8 bits (138), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 100 KTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDAS 159
           K+ KK +N F+AFR+YYS+  +G+  Q  LS+++S+ W  DK     W+  AQ+YN    
Sbjct: 87  KSTKKYLNSFMAFRAYYSQFGSGV-KQNILSSLLSEEWHADKTQHGIWDYFAQQYNFINP 145

Query: 160 GKHFFNWLEVN 170
           G  F  WL  N
Sbjct: 146 GFGFVEWLTNN 156

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 21/173 (12%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKT--SKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTS 58
           M ++ P F++   K++  S RKT  SK   +G++++ S S         N+         
Sbjct: 1   MFTSKPAFRI--KKKTSKSYRKTVISKVEGNGIVKRISPSC-------FNVIRPLKKDIQ 51

Query: 59  IPAPPQVLVAYIK-EKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYS 117
           IPAP    +  I+  ++ + N++     L             K+ KK IN F+AFR+YYS
Sbjct: 52  IPAPASRFLKKIQIHRISSGNQTTQCRQL--------SKASIKSSKKHINSFMAFRAYYS 103

Query: 118 RLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVN 170
           +  +G+  Q  LS+++S+ W  DK     W+  AQ+YN    G  F  WL  N
Sbjct: 104 QFGSGV-KQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNN 155

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 16/101 (15%)

Query: 59  IPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQ----LSSRDVKTKTKKKQINDFIAFRS 114
           IPAP  + +  I+           L  + + NQ      SR       KK +N F+AFR+
Sbjct: 53  IPAPSPLFLKKIQ-----------LYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRA 101

Query: 115 YYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYN 155
           YYS+   G+  Q  LS+++S+ W  DK     W+  AQ+YN
Sbjct: 102 YYSQFGAGV-KQNILSSLLSEEWHADKMQHGIWDYFAQQYN 141

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 88/196 (44%), Gaps = 30/196 (15%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRK--PSVSSRYRKHEGVNLYMSKVTPTS 58
            + N P FKV ++K S +S  K   K +   + K  P  S R  +   V  ++  + P  
Sbjct: 11  FRVNRPLFKVQINKDSRTSQCKAKTKFKKAKLDKCQPENSGRLEERH-VKTFVVILRPIK 69

Query: 59  IPAPPQVLVAYIKEKVKTL------------------NKSEVLMS-----LGNSNQLSSR 95
           IP PP +L+  I+++ + +                  +  ++L S     LGN  +  +R
Sbjct: 70  IPLPPNILLEKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDVLGNIYKKPAR 129

Query: 96  DVKTKTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYN 155
           +  +    K +N F+AFR+Y S+   G L Q  LS++++  W    + +  W+  AQ++N
Sbjct: 130 ETASN---KPLNSFMAFRAYNSQFGYG-LKQNILSSLLASAWHSHPEQQGIWDTFAQQFN 185

Query: 156 CDASGKHFFNWLEVNY 171
                  F  W++  Y
Sbjct: 186 FVKPKCGFVEWVDQRY 201

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 90/202 (44%), Gaps = 36/202 (17%)

Query: 6   PTFKVAVSKRSCSSVRKTSKKIRSGMI--RKPSVSSRYRKHEGVNLYMSKVTPTSIPAPP 63
           P FKV ++K +     K  K+ + G+   +  + + +  +   VN++++    T IP PP
Sbjct: 12  PLFKVKLNKSN-----KIEKQKKKGIAINKLANSAGKLSQKANVNVFITNSLVTKIPFPP 66

Query: 64  QVLVAYI----------KEKVKTLNKSEVL--MSLGNSNQLSSRDVKTK----------- 100
             L+  I          K  +   N + +L   S  + + L   D +T+           
Sbjct: 67  SSLLLGIDEETKKMKSKKTSINIQNDTNILNFSSSWDEDDLFLSDTETEYDLLSTSPNSV 126

Query: 101 -----TKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYN 155
                + KK +N F+AFR+Y S+   G L Q  LS+++S+ W  D + +K W +++Q++N
Sbjct: 127 IEVDTSSKKSLNGFMAFRAYNSQFGYG-LKQEILSSLLSEAWHSDPEQQKKWTVLSQQFN 185

Query: 156 CDASGKHFFNWLEVNYGIDKQW 177
                  F  W+   Y  +  W
Sbjct: 186 FVKPKCGFVEWVGQTYEREMMW 207

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 52.8 bits (125), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 89/184 (48%), Gaps = 25/184 (13%)

Query: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60
           MK  A  F+V  +KR  S  +K  +K  S  +   S  S +    G+N+ ++K     IP
Sbjct: 1   MKYTATKFRVRTNKRLRS--QKYPEK-HSDFLGCSSTKSSF----GLNMLLTKPNKFQIP 53

Query: 61  APPQVLVAYIKEKVKTLNKS--------------EVLMSLGNSNQLSSRDV---KTKTKK 103
            P  VL+  I+E+   L  S              E+   + +    S  +V   K+ +KK
Sbjct: 54  PPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNTSIGNVLKSKSSSKK 113

Query: 104 KQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHF 163
           + +N F+AFR+YY++L  G L Q  LS I+S+ W   +  +  W++ AQ++N  +    F
Sbjct: 114 RPMNAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGF 172

Query: 164 FNWL 167
            N++
Sbjct: 173 VNYI 176

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 104 KQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHF 163
           + +N F+AFR+YY++L  G L Q  LS I+S+ W   +  +  W++ AQ++N  +    F
Sbjct: 73  RPMNAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGF 131

Query: 164 FNWL 167
            N++
Sbjct: 132 VNYI 135

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 65/152 (42%), Gaps = 21/152 (13%)

Query: 4   NAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAPP 63
           N P FKV + +R           +R+   ++P            N+++      +IP PP
Sbjct: 10  NKPLFKVNIPRR-----------VRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPP 58

Query: 64  QVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSRLLNGI 123
             ++  + E ++ +  S+         +   R   T    K IN FI FRSYYSR   GI
Sbjct: 59  NWVLQEL-ETIRIIYPSK--------QKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGI 109

Query: 124 LTQTELSTIISKHWTVDKQTRKNWELIAQEYN 155
             QT LS +++K W      +  W+  A +Y+
Sbjct: 110 -KQTMLSQLLAKFWKSSDTDQALWDYFALQYS 140

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 20/163 (12%)

Query: 6   PTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAPPQV 65
           P FKV + K    ++R T     S  I KPS+S   ++   VN++          AP   
Sbjct: 10  PLFKVKLKK----TIRGTKTLQSSKRIGKPSLSKAKKRLNNVNVFSVMTEDLDSIAPNLD 65

Query: 66  LVAYIK-EKVKTLNKSEVL------MSLG--------NSNQLSSRDVKTKTKKKQINDFI 110
           ++  I   K +T + +++L      +  G        N   ++ ++     + + +N F+
Sbjct: 66  IIQMIDIAKNRTQDTNDLLYYWNYALPFGLDPLLVPFNDIPIALKNPIEICQNRNLNPFM 125

Query: 111 AFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQE 153
           AFRSYYS+   G L Q ELS +++K W  D + +  W  + Q+
Sbjct: 126 AFRSYYSQYAQG-LKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 86/202 (42%), Gaps = 38/202 (18%)

Query: 3   SNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAP 62
           S  P FKV+++K+   S++  + K    + ++       R H+    ++++     IP P
Sbjct: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQ-------RSHQ----FIAENFKLKIPYP 56

Query: 63  PQVLVAYIKEKVKTLNKSE------------VLMSLGNSNQLSSRDVKTKTK-------- 102
           P  L+  I  +++ +   +            V ++    N LS  D+             
Sbjct: 57  PTCLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEE 116

Query: 103 ----KKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDA 158
               KK +N FIAFR+Y ++  NG L Q  LS ++S  W    +    W++ AQ++N   
Sbjct: 117 ELLFKKSLNSFIAFRAYNAQFGNG-LNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVK 175

Query: 159 SGKHFFNWLEVNYGIDKQWLYE 180
               F  W+   Y  +++W  E
Sbjct: 176 PKCGFVEWVGQTY--EREWCTE 195

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 86/202 (42%), Gaps = 38/202 (18%)

Query: 3   SNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAP 62
           S  P FKV+++K+   S++  + K    + ++       R H+    ++++     IP P
Sbjct: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQ-------RSHQ----FIAENFKLKIPYP 56

Query: 63  PQVLVAYIKEKVKTLNKSE------------VLMSLGNSNQLSSRDVKTKTK-------- 102
           P  L+  I  +++ +   +            V ++    N LS  D+             
Sbjct: 57  PTCLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEE 116

Query: 103 ----KKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDA 158
               KK +N FIAFR+Y ++  NG L Q  LS ++S  W    +    W++ AQ++N   
Sbjct: 117 ELLFKKSLNSFIAFRAYNAQFGNG-LNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVK 175

Query: 159 SGKHFFNWLEVNYGIDKQWLYE 180
               F  W+   Y  +++W  E
Sbjct: 176 PKCGFVEWVGQTY--EREWCTE 195

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 73/177 (41%), Gaps = 29/177 (16%)

Query: 22  KTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAPPQVLVAYIK-EKVKTLNKS 80
           K +K IR     K S+ +++ +  G+++ + K     IP PP  L+  I+ EK K ++  
Sbjct: 19  KLNKNIRMKTNSK-SMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNIEVEKQKIISTQ 77

Query: 81  EVLMSL---GNSNQLSS-----------------------RDVKTKTKKKQINDFIAFRS 114
            +L       + N LS                         +      ++ +N FIAFR+
Sbjct: 78  HMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNPVNSERVLNGFIAFRA 137

Query: 115 YYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNY 171
           Y S+   G L Q  LS+++S  W  +   +  W   +QEYN       F  WL   Y
Sbjct: 138 YNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVEWLGQTY 193

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 73/177 (41%), Gaps = 29/177 (16%)

Query: 22  KTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAPPQVLVAYIK-EKVKTLNKS 80
           K +K IR     K S+ +++ +  G+++ + K     IP PP  L+  I+ EK K ++  
Sbjct: 19  KLNKNIRMKTNSK-SMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNIEVEKQKIISTQ 77

Query: 81  EVLMSL---GNSNQLSS-----------------------RDVKTKTKKKQINDFIAFRS 114
            +L       + N LS                         +      ++ +N FIAFR+
Sbjct: 78  HMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNPVNSERVLNGFIAFRA 137

Query: 115 YYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNY 171
           Y S+   G L Q  LS+++S  W  +   +  W   +QEYN       F  WL   Y
Sbjct: 138 YNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVEWLGQTY 193

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 95  RDVKTKTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEY 154
           R  +++   K IN F+ FRSYYS+   G+        +    W   +  +  W+  AQ+ 
Sbjct: 52  RPYQSRCYAKSINGFMLFRSYYSQYGKGLKQSLLSPLLSKL-WNAHETDQLLWDQFAQQ- 109

Query: 155 NCDASG 160
            C+A G
Sbjct: 110 -CNAIG 114

>ZYRO0C16214g Chr3 (1265998..1267071) [1074 bp, 357 aa] {ON} similar
           to uniprot|P25042 Saccharomyces cerevisiae YPR065W ROX1
           Heme-dependent repressor of hypoxic genes contains an
           HMG domain that is responsible for DNA bending activity
          Length = 357

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 9/60 (15%)

Query: 107 NDFIAFRSYYSRLL------NG--ILTQTELSTIISKHW-TVDKQTRKNWELIAQEYNCD 157
           N FI FR ++ RLL       G  I   +++S I+   W ++++Q R +WE  A++  C+
Sbjct: 11  NAFILFRQHHHRLLIDEWTAQGVDIPHNSKISKILGVRWKSLNEQERSHWEEQARKEKCE 70

>YBR260C Chr2 complement(732639..734639) [2001 bp, 666 aa] {ON}
           RGD1GTPase-activating protein (RhoGAP) for Rho3p and
           Rho4p, possibly involved in control of actin
           cytoskeleton organization
          Length = 666

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 103 KKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKH 162
           KK +N  +A  +  SRL   +LT  E    I K +  +++   + + ++++Y      KH
Sbjct: 36  KKVLNSDVAINALLSRLKQSLLTCEEFMKFIRKKYAFEEE---HVQELSKQY------KH 86

Query: 163 FFNWLEVNYGIDKQWLYEIVQYE 185
           FFN         K+ ++E++ ++
Sbjct: 87  FFNIQGSTNSSLKKMIHEVLGFD 109

>CAGL0K07007g Chr11 (687697..689907) [2211 bp, 736 aa] {ON} highly
           similar to uniprot|P38330 Saccharomyces cerevisiae
           YBR238c
          Length = 736

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 18/72 (25%)

Query: 138 TVDKQTRKNWELIAQEYNCDASGKHFFNWLE---------VNYG---------IDKQWLY 179
           TV+  T +N      +YN + S  HF N            +NYG          D  W  
Sbjct: 46  TVEVPTHQNGPASNNQYNGNHSRPHFKNQFSSRNSSFTNVMNYGKNHGNNNMSPDSPWYN 105

Query: 180 EIVQYEECLTPT 191
           E+V +E+C++ T
Sbjct: 106 EVVAFEDCVSQT 117

>SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} similar
           to uniprot|P23394 Saccharomyces cerevisiae YDR243C PRP28
           RNA helicase in the DEAD-box family involved in RNA
           isomerization at the 5' splice site
          Length = 566

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 133 ISKHWT---VDKQTRKNWELIAQEYNCDASG----KHFFNWLEVNYGIDKQWLYEIVQYE 185
           + KHW    +D+ T ++W ++ +++N    G    +   NW E+   I ++ L+ I++  
Sbjct: 124 MGKHWKDKRLDEMTERDWRILREDFNISTKGGSIRQPLRNWSELGI-IPEELLHIIIRKL 182

Query: 186 ECLTPT 191
               PT
Sbjct: 183 HYTEPT 188

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.129    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,282,737
Number of extensions: 1226576
Number of successful extensions: 4630
Number of sequences better than 10.0: 70
Number of HSP's gapped: 4755
Number of HSP's successfully gapped: 70
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)