Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0B10868g3.483ON57457430100.0
SAKL0F02970g3.483ON57357126890.0
CAGL0I10648g3.483ON57457226350.0
Kwal_55.211873.483ON57357326210.0
KLTH0F14630g3.483ON57357326180.0
YPR145W (ASN1)3.483ON57257226180.0
Smik_6.2203.483ON57257126130.0
Kpol_480.193.483ON57457426050.0
YGR124W (ASN2)3.483ON57257126030.0
Suva_16.4743.483ON57257225990.0
Skud_7.4353.483ON57257125960.0
Smik_16.3963.483ON57257225960.0
TDEL0D055203.483ON57357125890.0
NCAS0F035103.483ON57557325890.0
KNAG0A079203.483ON57857625890.0
Suva_7.4103.483ON57257225810.0
Skud_16.4393.483ON57257225540.0
NDAI0B058103.483ON57757625450.0
ZYRO0B04136g3.483ON57257325350.0
KAFR0G036703.483ON57257125350.0
TBLA0C044303.483ON58057925260.0
AFR303W3.483ON57157125200.0
Ecym_12443.483ON57357325060.0
TPHA0D042003.483ON57457424760.0
NCAS0C001908.875ON5174831591e-10
ZYRO0A00528g8.875ON5121031421e-08
KLLA0D10285g8.875ON5154441402e-08
Kpol_455.78.875ON518941313e-07
ADL350C8.875ON508831271e-06
TBLA0C063008.875ON5182191233e-06
KAFR0L021108.875ON514951233e-06
NDAI0K001808.875ON522941215e-06
KNAG0J002008.875ON5151021206e-06
Skud_13.468.875ON5191011198e-06
TPHA0C049508.875ON525991191e-05
Suva_13.528.875ON519991171e-05
TDEL0B004408.875ON516941171e-05
YML096W8.875ON525951143e-05
Smik_13.398.875ON521961143e-05
SAKL0D00352g8.875ON515971143e-05
Kwal_27.97058.875ON515991082e-04
Ecym_81558.875ON5131031054e-04
KLTH0E16412g8.875ON515951000.001
Skud_7.311singletonON8189890.002
CAGL0H06963g8.875ON51793910.018
Kpol_1024.378.551ON231130731.9
KLLA0B06061g4.167ON20473704.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B10868g
         (574 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1164   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...  1040   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1019   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...  1014   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...  1013   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1013   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...  1011   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1008   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1007   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1005   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1004   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1004   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1001   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...  1001   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...  1001   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...   998   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   988   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   984   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   981   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   981   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   977   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   975   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   969   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   958   0.0  
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    66   1e-10
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    59   1e-08
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    59   2e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    55   3e-07
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    54   1e-06
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    52   3e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    52   3e-06
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    51   5e-06
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    51   6e-06
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    50   8e-06
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    50   1e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    50   1e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    50   1e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    49   3e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    49   3e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    49   3e-05
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    46   2e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    45   4e-04
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    43   0.001
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    39   0.002
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    40   0.018
Kpol_1024.37 s1024 complement(101873..102568) [696 bp, 231 aa] {...    33   1.9  
KLLA0B06061g Chr2 complement(540386..540917,541004..541086) [615...    32   4.2  

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1164 bits (3010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/574 (97%), Positives = 562/574 (97%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDKK 574
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDKK
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDKK 574

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1040 bits (2689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/571 (86%), Positives = 524/571 (91%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA +++  VQ +KPKALQLSKRIRHRGPDWSGN+VKN+TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITSEDG YTL VNGEIYNHI LREE  SYPFKTLSDCEPIIPLY+KYDID PK+LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYD+KKDRIIAARDPIGITTLYMGRSS+SP +V+F+SELKCL DDCDEI AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRY+TPDWLDE RIP TP+D+K +R SLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEK N +LDPV YD +   LAG+D++G+LHAAGWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDRDFL +CMNIDP +KMI  +EG+IEKYILRKAFDTTDEPD+KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE+ ISDEQFAQPK EWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQH+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/572 (84%), Positives = 520/572 (90%), Gaps = 1/572 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA++++ DV A+KPKALQLSKRIRHRGPDWSGN+VKNSTI+VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITSEDG YTL VNGEIYNHI LRE+   Y FKTLSDCEPIIP Y ++DIDAPK+LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYD+K+DRI+AARDP+GITTLYMGR S+SPK+V+F+SELKCLTDDCDEI AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRYFTPDW+DESRIPTTPV+FK +RESLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYD-SDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPD 299
             IA+IAARETEK N E D    D S   QLAG+D QGHLH AGWSRLHSFA+GLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH+ESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQK 479
           RVPFLD++FLQLCMNIDP DKMI  + G+IEKYILRKAFDT+DEPD+KPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKD AE  ISD  F+ PK EWG+DIPTTKEAYWYRLKFDALFPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571
           AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score = 1014 bits (2621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/573 (83%), Positives = 518/573 (90%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIF  FR+ DV  +KP ALQL+KRIRHRGPDWSGN+++NST+L HERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           P+ SE+  Y LAVNGEIYNHI LREE + YPFKTLSDCEPIIPLYEKY IDAPK+LDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AW LYD+KKDR+IAARDPIGITTLYMGR S SPK+V+F+SELKCLTD+CD IIAFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD++TRY+TP+WLDE+RIP+ P+D   +R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEK N E++PV YDS+   LAG+D+ G LH+AGWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVA FIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FL LCMN+DP +KMI  AEG+IEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE+TISDEQF QPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDK 573
           ASTVMRWIPKADWGCAEDPSGRYAKIH+QH+ K
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK 573

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/573 (83%), Positives = 516/573 (90%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIF  FR+  V+ +KP AL+L KRIRHRGPDWSGNI+KNST++ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           P  SED +Y L VNGE+YNHI LREE +SYPFKTLSDCEPIIPLYEKY IDAPK+LDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AW LYD+KKDRI+AARDPIGITTLYMGR S SPK+V+F+SELKCLTD+CD IIAFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD++TRYF PDW+DE RIP+ P+D   +R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETEK N+++DPV YDS+   LAG+D+ G+L +AGWS LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMN+DP +KMI  AEG+IEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE+ ISDEQF QPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDK 573
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQH+DK
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK 573

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/572 (83%), Positives = 514/572 (89%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+FR+ DV  YKPKALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS DG Y L VNGEIYNHI LREECA Y F TLSDCEPIIP+Y K+DIDAPK+LDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMGRSSASPK+V+F+SELKCLTDDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE RIP+TP+D+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARET K   +++P  YDS    LAG+D+ G LH AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDPN+KMIKP EG+IEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE+ ISDE FA PKAEWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572
           A TVMRWIPKADWGCAEDPSGRYA+IHE+H++
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1011 bits (2613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/571 (83%), Positives = 517/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+F++ D+ ++KPKALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS DG Y L VNGEIYNHI LREEC+ Y F+T SDCEPIIPLY ++DIDAPK+LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           A+C+YD+KKDRI+AARDPIG+ TLYMGRSS SPK+V+F+SELKCLTD CD IIAFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE RIP+TPVD+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEK NA+++      D  QLAG+D+QGHLH +GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADVNEES-SVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLD+DFLQLCMNIDP DKMIKP EGKIEKYILRKAFDTT+EPD+KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+D AE  ISD  FA PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571
           A+TVMRW+PKADWGCAEDPSGRYAKIHE+HV
Sbjct: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/574 (82%), Positives = 515/574 (89%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA++++ + +A+KP+ALQLSKRIRHRGPDWSGN+VKNSTILVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS  G Y L VNGEIYNHI LRE C  Y +KTLSDCEPIIPLY K+DIDAPK+LDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYD+KKDRIIAARDPIGITTLYMGR+S SPK+V+F+SELKCLTDDCD I+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD++TRYF+PDW+DE RIPT PV +KA+RESLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETEK   E+D   YDS+   L G+D+QG+LH AGWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP +KMI  +EG+IEKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F+ PK  WG DIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDKK 574
           A TVMRWIPKADWGCAEDPSGRYAKIHEQH+  K
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIGDK 574

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/571 (83%), Positives = 515/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+F++ D+  +KPKALQLSK+IRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS DG Y L VNGEIYNHI LRE C+ Y F+T SDCEPIIPLY ++DIDAPK+LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           A+CLYDSKKDRI+AARDPIG+ TLYMGRSS SP++V+F+SELKCLTD CD II+FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+TRYFTPDWLDE RIP+TPVD+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEK NA+ +    + D  QLAG+D+QGHLH +GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADANED-NNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLD+DFLQLCMNIDPN+KMIKP EG+IEKYILRKAFDTTDEPD+KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+D AE  ISD  FA PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571
           A TVMRWIPKADWGCAEDPSGRYAKIHE+HV
Sbjct: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/572 (82%), Positives = 514/572 (89%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+F++ DV  YKPKALQLSKRIRHRGPDWSGN VKNSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS D  Y L VNGEIYNHI LREEC  Y FKTLSDCEPIIP+Y K+DIDAPK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AW LYD+K+DRIIAARDPIGITTLYMGRSSASPK+V+F+SELKCLTDDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE RIP+TP+D+ A+R SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IAAIAARET K   +++P  YD+    LAG+D++G+LH AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP++KMI+P EG+IEKYILRKAFDTTDEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE+ ISDE FA PKAEWG+DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+H+D
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/571 (82%), Positives = 512/571 (89%), Gaps = 1/571 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+F++ D+ ++KPKALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PI S DG Y L VNGEIYNHI LRE+C+ Y F+T SDCEPIIPLY ++DIDAPKHLDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           A+CLYD+KKDR++AARDPIG+ TLYMGRSS SPK+V+F+SELKCLTD CD II+FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+TRYFTP+WLDE RIP+ PVD+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEK NA+ D      +  QLAG+D+QGHLH +GWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADADGDA-SVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDRDFLQLCMNIDP DKMI P EG+IEKYILRKAFDTTDEP++KPYLPEEILWRQKE
Sbjct: 420 VPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+D AE  ISD  FA PKA+WG+DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571
           A TVMRW+PKADWGCAEDPSGRYAKIHE+HV
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/572 (82%), Positives = 511/572 (89%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+F++ DV  YKPKALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS D  Y L VNGEIYNHI LREEC  Y FKTLSDCEPIIP+Y K+DIDAPK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMGRSSASPK+V+F+SELKCLTDDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE RIP+TP+D+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARET     ++DP  YDS    LAG+D+ G LH AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLD++FLQLCMNIDPN+KMIKP EG+IEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE+ ISDE FA PKAEWG DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572
           A TVMRWIPKADWGCAEDPSGRYA+IHE+H+D
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/571 (82%), Positives = 519/571 (90%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+ ++ DVQAYK KALQLSKRIRHRGPDWSGN+++N+T+LVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS  G+YTL VNGEIYNHI LREE + Y F TLSDCEPIIPLYEKYDID PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYD+K+DRIIAARDP+GITTLYMGR+S SPK+V+F+SELKCLTDDCD I+AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE+RIP+ PVD+KA+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETEK NAE+D   YDS+   LAG+D+ G+LH+AGWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVA FIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFH E+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP DKMI   EG++EKYILRKAFDTTDEPD+KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISD+ FA PK+ WGDD+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571
           A TVMRW+PKADWGCAEDPSGR+A+IH+QHV
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/573 (82%), Positives = 515/573 (89%), Gaps = 1/573 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+FR+ DV+AYKPKALQL+KRIRHRGPDWSGN+VKN+TIL HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS  G+YTL VNGEIYNHI +REECA Y FKTLSDCEPIIPLY KYD+DAPKHLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYD+K+DRI+AARDPIGITTLYMGR S +P++V+F+SELKCLTDDCD I+AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD++TRYF PDWLDE RIP+TPVD KA+RE+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQ-LAGLDEQGHLHAAGWSRLHSFAVGLPNAPD 299
             IA+IAARETEK   ++D    + + H+ L G+D++GHLH  GWSRLHSFA+GLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVA FIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQK 479
           RVPFLD++FLQLCMNIDP DKMI  A GKIEKYILRKAFDTTD+P+ KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKD AE  ISD  F  PK  WG+D+PTTKEAYWYRLKFDAL+PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572
           AA TVMRWIPKADWGCAEDPSGRYAKIHE+HVD
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/576 (82%), Positives = 517/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+FR+ DVQA+KP+ALQLSKRIRHRGPDWSGNI+KNSTI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS  G Y L+VNGEIYNHI LREEC  Y +K+LSDCEPIIP+Y KYD+DAPKHLDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYD+KKDRI+AARDPIGITTLYMGRSS  PK+V+F+SELKCLTDDCD IIAFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+TRY+TP+WLDE++IP+TPVD K +R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYD----SDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPN 296
             IAAIAARETEK N ELDP  YD    ++ H LAG+D++G+L +A WSRLHSFA+GLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILW 476
           LEARVPFLD++FL LCMNIDP DK+I   EG+IEKYILRKAFDT DEPD+KPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKD AE+ ISDE FA PKA WG D+PTTKEA+WYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572
           Q TAA TVMRWIPKADWGCAEDPSGR+AKIHEQHV+
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  998 bits (2581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/572 (82%), Positives = 511/572 (89%), Gaps = 1/572 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+F++ D++ +KPKALQLSKRIRHRGPDWSGN + NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS DG Y L VNGEIYNHI LRE+C+ Y F+T SDCEPIIPLY ++DIDAPK+LDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           A+CLYDSKKDR+IAARDPIG+ TLYMGR S SPK+V+F+SELKCLTD CD IIAFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+TRYFTPDWLDE R+PTTPVD++A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETE  N E +     ++  +LAG+D+QGHLH +GWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETETANVEANEEA-SAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLD+DFLQLCMNIDP DKMI   EG+IEKYILRKAFDTTDEPD+KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID L+D AE  ISD  FA PKA WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HV+
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/572 (81%), Positives = 507/572 (88%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA++++ DV  YK KALQLSKRIRHRGPDWSGN  KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS D  Y L VNGEIYNHI LREEC  Y FKTLSDCEPIIP+Y K+DI+APK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMGRSSASPK+V+F+SELKCLTDDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE RIP+TP+D+ A+R SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARET     +++P  YDS    LAG+D+ G+LH AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP +KMI+  EG+IEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE+ ISDE FA PKAEWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+H++
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/576 (80%), Positives = 508/576 (88%), Gaps = 4/576 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+F++ DV A+KP+ALQLSKRIRHRGPDWSGN++KN+TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS  G+YTL VNGEIYNHI +RE+   YPFKTLSDCEPIIPLY K+DID PKHLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYDSK+DRIIAARDPIGITTLYMGR+S +P++V+F+SELKCLTDDCD IIAFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRYFTPDWLDE RIP   +D  A+RESLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAEL----DPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPN 296
             IA+IAARETEK NA+     +    ++    L G+D++GHLH  GWS+LHSFA+GLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDLQAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILW 476
           LEARVPFLDRDFLQLCMNIDP +KMI  AEG+IEKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKD AE  ISD  F  PK  WG DIPTTKEAYWYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIHE+HV+
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/573 (80%), Positives = 507/573 (88%), Gaps = 1/573 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+FR+ DVQ Y+P ALQLSKRIRHRGPDWSGN+VKNSTILVHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PI S  G+YTL VNGEIYNHI LREEC+ YPF++LSDCEPIIPLY KY +DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYDSK+DRI+AARDPIGITTLYMG+SS SPK+ +F+SELKCL DDCDEI+AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D++TRYF P WLDES +P+TP+D+K +R SLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETE+ N ELDPV YDS+   LAG+D QG+LH  GWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVA FIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDRDFL LCM +DPN+KMIKP EG+IEKYILRKAFDTTDEP++KPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE  ISDE  A P+ EWGDD PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDK 573
           A+TVMRWIPKADWGC  DPSGR+AKIHEQH+D 
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/571 (81%), Positives = 505/571 (88%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA+FR+ DV ++K KALQLSKRIRHRGPDWSGN+VKNSTI+VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS  G+YTL VNGEIYNHI LRE+   Y FKTLSDCEPIIPLY + DIDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AW LYDSKKDRI+AARDPIG+TTLYMGRSS SPK+V+F+SELKCL DDCD I+AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+TRYFTP+W+DE++IPTTPVD+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETE  N ELD   Y  +   LAG+D++GHL  +GWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVA FIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FL LCMNIDPNDK+I   EG+IEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE  ISDE FA PK+ WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571
           A TVMRWIPKADWGCAEDPSGRYA+IHE+H+
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/579 (79%), Positives = 504/579 (87%), Gaps = 7/579 (1%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA++++P+V A+KP+ALQL+KRIRHRGPDWSGN+VKN+T+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS  G+Y L VNGEIYNHI LREE   Y +KTL DCEPIIP+Y KYD+DAP HLDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           A+ LYDS+KDR+IAARDP+GITTLYMGR+S +PK+V+F+SELKCL DDCD IIAFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+ RYF P+W+DES IPTTPVD K VRE+LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDP-------HQLAGLDEQGHLHAAGWSRLHSFAVG 293
             IA+IAARETEK   E + + Y+           +L GLD+ G+L    WS+LHSFA+G
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPNAPDLQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 353
           LP APDL+AARKVA FIGSIHHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEE 473
           AWGLEARVPFLDRDFL LCMNIDPNDKMIKP EGKIEKY+LRKAFDT+DEPD+KPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDA 533
           ILWRQKEQFSDGVGYSWID LKD AE  ISDE FA PK  WG DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572
           LFPQKTAA TVMRWIPKADWGCAEDPSGRYAKIHEQH+D
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHID 579

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/571 (79%), Positives = 507/571 (88%), Gaps = 2/571 (0%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA +R  D++++KP AL+LSKR+RHRGPDWSGN++KN TILVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PI S DG+Y L VNGEIYNHI LREEC+ Y F +LSDCEPIIPLY KYD++ P+HLDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYD ++DRI+AARDPIG+TTLYMG+SS+SP++ +F+SELKCL D+CDEI AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKLTRYF PDW+DE+RIP+ PVD+KAVR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETE+ N E   V   +D   LAG+D++G LH  GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETERANREAGDVY--ADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFH E+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP +KMI P +G+IEKYILRKAFDT+DEP + PYLPEEILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE  ISDEQFA P   WGDDIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571
           A+TVMRW+PKADWGCAEDPSGRYAKIH+QH+
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/573 (78%), Positives = 509/573 (88%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIFA +R   ++++KP ALQLSKRIRHRGPDWSGN+VKN TI VHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PI S+DG+Y L VNGEIYNHI LR+ CA YPF TLSDCEPIIPL++KY ++ P +LDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AWCLYD+K DRI+AARDPIG+TTLYMG+ S SP++ +F+SELKCL ++CDEII+FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRYF P WL +S  PT PVD+K +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEK N E+D V YDS    L G+D++ HLHA+GWS+LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGSIHHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDRDFL+LCMNIDP +KMIKP EGKIEKYILRKAFDT+DEPD++PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKDAAE+ ISDEQFAQPK EWGDDIP+TKEAYWYR+KFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDK 573
           ASTVMRW+PKA+WGC+EDPSGR+AKIHE+H+ K
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHISK 573

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/574 (78%), Positives = 498/574 (86%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60
           MCGIF  +++ + +A+KP+ALQLSKRIRHRGPDWSGN+VKNSTI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120
           PITS+DG + L VNGEIYNHI +RE+   Y FKTLSDCEPIIPLY KY  +APKHLDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180
           AW LYD+K+DRIIAARDPIGITTLYMGRSS SPK+V+F+SELKCLTDDCD I+AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD++TRY+TPDW+DE+RI   P+D   +R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETEK           S  +QL G+D+ G+L ++GWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVA FIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480
           VPFLDR+FL LCMNIDP++KMI   EG+IEKYILRKAFDTTDEP+ KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F  P+  WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDKK 574
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQH+  K
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIGAK 574

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 113/483 (23%), Positives = 186/483 (38%), Gaps = 108/483 (22%)

Query: 27  IRHRGPDWSGNIV--KNSTILVHERLAIVGLDSGAQPITSE----DGSYTLAVNGEIYNH 80
           I  RGP++S   V  K  T      L++       QP T +    +  Y L  NGE+YNH
Sbjct: 48  ISARGPNYSSLRVSKKYKTAWYSSVLSL------RQPFTCQSIEIEERYVLQFNGELYNH 101

Query: 81  IMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMFAWCLYDSKKDRIIAARDPIG 140
            ++  +   Y    L +  P IP          K L+G FA+ +YD            I 
Sbjct: 102 EIVHND-TQYIVGLLKESAPSIPA-------IIKKLNGEFAYSIYD------------IQ 141

Query: 141 ITTLYMGRSSASPKSV-WFSSE------LKCLTDDCDEIIAFPPGHVYDSET--DKLTR- 190
             T Y GR +   +S+ +F  E      L  +T      I    G +Y   T   KL   
Sbjct: 142 NGTFYFGRDTVGKRSLSYFLDENTGEFYLASVTGSQPNFIDCTAGIIYQYSTRSKKLNSD 201

Query: 191 ------YFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMA-------EVPYXXXXXXX 237
                 Y     +D+ ++   P     + E L KAV +R+++         P        
Sbjct: 202 LSISSPYEIATTMDQ-QLTKLPNCIDGLFEHLNKAVHRRIVSIHPAHIENSPISILFSGG 260

Query: 238 XXXXXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLP-N 296
                IAA+  ++      E  P++                L   G+    +    LP +
Sbjct: 261 LDCSVIAALICKQLSNIKKEKKPIL---------------ELLNVGFENPRTGM--LPKD 303

Query: 297 APDLQAARKVATFIGSIHHEHTFTL-------QEGLD---ALDDVIYHLETYDVTTIRAS 346
            PD + A   +  + +++ + T  L       +E L+    + D+++  +T    +I  S
Sbjct: 304 VPDRKLALSSSEILKNLYPDVTIKLVNIDVSYEEYLEYRPKVIDLMFPKQTEMDLSIAIS 363

Query: 347 TPMFLLSRK-----IKAQGVK--------MVLSGEGSDEIFGGYLYFAQAPSAAEFHVES 393
              F  + K     I   G+K        ++ SG G+DE++GGY  FA   S  +  +E 
Sbjct: 364 ---FFFAAKGSGYTISKDGIKEKYQRKGIVLFSGLGADELYGGYHKFANK-SPDDLAIEL 419

Query: 394 VKRVKNLHLADCLRANKSTMAWGLEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYI 453
            +++ N++  +  R +K     G+E R PFLD + ++          M  P   K+ K I
Sbjct: 420 TRQINNIYDRNLNRDDKVIANNGVEVRYPFLDEEVIKFST-------MEIPINYKVNKMI 472

Query: 454 LRK 456
           LRK
Sbjct: 473 LRK 475

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRK 456
           A G+E R PFLDR  ++  M          P   KI K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQ-------SIPINWKINKLILRK 471

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 70/165 (42%), Gaps = 23/165 (13%)

Query: 69  YTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMFAWCLYDSK 128
           Y L  NGE+YN  +L  + +       +D   +         +    L+G FA+ +YD  
Sbjct: 88  YILQFNGELYNEEILDNDTSFVASLLENDKMSVF--------EVISFLEGEFAYTIYDMH 139

Query: 129 KDRIIAARDPIGITTLYMGRSSASPKSVWFSS---ELKCLTDDCDEIIAFPPGHVYDSET 185
           + ++   RD IG  +L   R   +   ++ +S   + +  TD    I+     ++YD E 
Sbjct: 140 EHKLYFGRDDIGKRSLSY-RLDQAIGDIYVASVTGQQEGFTDCLAGIV-----YIYDVED 193

Query: 186 DKLTRYFTPDWLDE--SRIPTTPVDFK----AVRESLEKAVRKRL 224
             L +   P    E  S I     +F+    A+ E L+ A+ KR+
Sbjct: 194 KSLNQQMLPILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 101/444 (22%), Positives = 171/444 (38%), Gaps = 75/444 (16%)

Query: 60  QPITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDID-APKHLDG 118
           Q +  +D  Y L  NGE+YN   + E C        SD E I  L EK+ ++   +   G
Sbjct: 82  QSVMVQD-RYLLQYNGELYNDDTV-ENCEH------SDTEYISSLLEKHSVEEVVRKCYG 133

Query: 119 MFAWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSEL--KCLTDDCDEIIAFP 176
            FA+ + D ++ ++   RD IG  +L           +    EL    ++  CD      
Sbjct: 134 EFAYAITDLQERKVYFGRDSIGKRSL---------SYILLDDELYITSVSGRCDGFQNCL 184

Query: 177 PG--HVYDSETDKLTR--------YFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMA 226
            G  +++D  T +LT         Y   D +D           K + E L ++V +R++ 
Sbjct: 185 AGVIYIFDINTKQLTGSVKIHDEPYIVSDQIDNDFQLLEEYKIK-LYECLRRSVYQRIVT 243

Query: 227 EVPYXXXXXXXXXX-------XXIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHL 279
             P                    I A+   +  K N   + ++                L
Sbjct: 244 IHPMHLENGNISILFSGGLDCSVITALLCEQLIKINRNSETII---------------EL 288

Query: 280 HAAGWSRLHSFAVGLPNAPDLQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLET-- 337
              G+    +  +   ++PD   A K A  +  ++ +    L E      D + H +T  
Sbjct: 289 LNVGFENPRTGKMP-SDSPDRILAIKSAQLLSELYPQVNIKLIEVDVPYTDYLSHKDTVI 347

Query: 338 ---YDVTT---IRASTPMFLLSR---KIKAQGVK--------MVLSGEGSDEIFGGYLYF 380
              Y   T   +  +   +  SR   K+   G          ++ SG G+DE++GGY  F
Sbjct: 348 DLMYPKNTEMDLSIAIAFYFASRGRGKVTENGESKPYNRSGIVMFSGLGADELYGGYHKF 407

Query: 381 AQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVPFLDRDFLQLCMNIDPNDK 440
           +   S  E  +E  K++  +H  +  R +K     G+E R PFLD   +Q  +++  N K
Sbjct: 408 SN-KSNEELVIELQKQIAQIHDRNLNRDDKVISNHGIEVRYPFLDERVVQFSVDLPLNYK 466

Query: 441 MIKPAEGKIEKYILRKAFDTTDEP 464
           + K     + K ILR  F  ++EP
Sbjct: 467 VNKHILRVMAKDILRLDF-ISEEP 489

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E  VE  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFAN-KSIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRK 456
           FLD + +Q  ++         P   K+ K ILRK
Sbjct: 450 FLDEEVIQYSVS-------QIPISYKVNKGILRK 476

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 54/125 (43%), Gaps = 22/125 (17%)

Query: 27  IRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQPITSE----DGSYTLAVNGEIYNHIM 82
           I  RGP++S   V       H       + S  QP T +    D  Y L  NGE+YN   
Sbjct: 50  IVSRGPNYSSLRVNRE----HGISWFSSILSLRQPFTRQSIVVDERYVLQFNGELYN--- 102

Query: 83  LREECASYPFKTLSDCEPIIPLYEKYDIDAP---KHLDGMFAWCLYDSKKDRIIAARDPI 139
              E +       +D + I+ L +  D D     + LDG FA+ +YD K+  I   RD I
Sbjct: 103 --SEISG------NDTQYIVSLLKSCDGDVVSLVRKLDGGFAYTIYDLKEGNIYFGRDTI 154

Query: 140 GITTL 144
           G  +L
Sbjct: 155 GKRSL 159

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   S  E  VE  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDRDFLQLCMNID---PNDKMI 442
           FLD   ++  + +     NDKMI
Sbjct: 441 FLDEKVIKASVALPISYKNDKMI 463

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 103/219 (47%), Gaps = 23/219 (10%)

Query: 22  QLSKRIRHRGPDW-SGNIVKNSTILVHERLAIVGLDSGAQPITSEDGSYTLAVNGEIYNH 80
            L K I  RGP++ S   +K+  I +   +  +      Q +  ED  Y L  NGE+YN 
Sbjct: 43  NLMKLISARGPNFASLRTLKDHRISLFSSVLSLREPFCKQSVLVED-RYVLQFNGELYND 101

Query: 81  IMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMFAWCLYDSKKDRIIAARDPIG 140
            ++  +   +  K L + E       K  I   K+LDG FA+ +YD K  R+   RDPIG
Sbjct: 102 EIIHND-TQFIVKLLLNTEQ----NSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIG 156

Query: 141 ITTLYMGRSSASPKSV-WFSSELKCLTDDCDEIIAFPPGHVYDSETDKLT--RYFTPDWL 197
             +L    + A+   V   S  +K    +CD  + +     YD+ T+K +    F   + 
Sbjct: 157 KRSLCYYLTDANELYVSSVSGSIKGFK-NCDAGVIYE----YDA-TNKNSPLTIFNNIFE 210

Query: 198 DESRIPTTPVDFKAVRESLEK-------AVRKRLMAEVP 229
           D +    + ++FK++++ +E+       AVRKR+++  P
Sbjct: 211 DFTINDKSDLEFKSLQKHIEELYKVLYNAVRKRVLSIHP 249

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           + +G+ ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G
Sbjct: 387 RRKGI-VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNG 444

Query: 417 LEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRK 456
           +E R PFLD   ++   +         P   KI K ILRK
Sbjct: 445 VEVRYPFLDEHVIKYSTH-------DIPINYKINKLILRK 477

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKA 457
           FLD + +Q             P   K+ K ILRK 
Sbjct: 447 FLDHNVVQF-------STQEIPINYKVNKLILRKV 474

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 71/167 (42%), Gaps = 34/167 (20%)

Query: 1   MCGIFASFRNPDVQAYKPKALQLSK---------------------RIRHRGPDWSGNIV 39
           MCGI   + NP++  ++ + L+ ++                      I +RGP++S   +
Sbjct: 1   MCGILLHY-NPNI-VHEDRFLEFNEDECISVDESNGTSEIFNAIIPHIANRGPNYSSLRL 58

Query: 40  --KNSTILVHERLAIVGLDSGAQPITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSD 97
             K  T      LA+  L    Q +  ED  Y L  NGE+YN  + +++  +    +L  
Sbjct: 59  SEKYHTAWFSSVLAL-RLPFTKQSLCVED-RYVLQFNGELYNKEIKQDQNDTQFIASLLS 116

Query: 98  CEPIIPLYEKYDIDAPKHLDGMFAWCLYDSKKDRIIAARDPIGITTL 144
               +       I     LDG FA+ +YD ++ +I   RD IG  +L
Sbjct: 117 SSTDV-------IHTLTQLDGEFAYTIYDLRETKIYFGRDSIGKRSL 156

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  K++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRK 456
           FLD D ++        +++  P   KI K ILRK
Sbjct: 455 FLDIDVIKF-----STEEL--PINYKINKLILRK 481

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 71/168 (42%), Gaps = 19/168 (11%)

Query: 69  YTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMFAWCLYDSK 128
           Y +  NGE+YN  +   +   Y  + L + + II        D  + LDG FA+ +YD +
Sbjct: 91  YVVQFNGELYNDEIQYND-TQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQ 141

Query: 129 KDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHVYDSETDKL 188
                  RDPIG   L     + + + ++ SS   C T   D I      + YD +  +L
Sbjct: 142 NRMFYFGRDPIGRRCLSFSIDNETGE-LYISSVTGCKTGFQDCIAG--TIYKYDCQLKEL 198

Query: 189 TR-------YFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVP 229
                    ++  + LD+  +     + + +   L  +V KR+++  P
Sbjct: 199 NTDSKISKPFYVSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 355 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTM 413
           KI  Q   +VL SG G+DE++GGY  FA   S  +  +E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 414 AWGLEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILR 455
           + G+E R PFLD   ++             P   KI K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFSTE-------DLPINYKINKLILR 473

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 12/89 (13%)

Query: 60  QPITSE----DGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKH 115
           QP T +    DG Y L  NGE+YN  +   +   Y    L+  E  IP       D    
Sbjct: 76  QPFTKQSLVVDGRYVLQFNGELYNDEIEFND-TQYIADMLARGEASIP-------DIIAR 127

Query: 116 LDGMFAWCLYDSKKDRIIAARDPIGITTL 144
           LDG FA+ +YD++  +    RD IG  +L
Sbjct: 128 LDGEFAYTIYDTEDQKYYFGRDAIGKRSL 156

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 52/101 (51%), Gaps = 9/101 (8%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           + QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G
Sbjct: 388 QRQGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNG 445

Query: 417 LEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKA 457
           +E R PFLD   + L         +  P   K+ K ILRK 
Sbjct: 446 VEVRYPFLDEYVINLST-------LEIPINYKVNKLILRKV 479

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (45%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQPITSE----DGSYTLAVNGEIYNHIM 82
           I  RGP++S   V    I  H+      + S  +P T +    D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRV----IKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREECASYPFKTLSDCEPIIPLYEKYDI-DAPKHLDGMFAWCLYDSKKDRIIAARDPIGI 141
             +E + +   +L     +  L +  ++ D  + L+G +A+ +YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (52%), Gaps = 9/99 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILR 455
           +E R PFLD    +  +N    +    P   KI K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKE---IPINYKINKKILR 477

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 7/119 (5%)

Query: 27  IRHRGPDWSG-NIVKNSTILVHERLAIVGLDSGAQPITSEDGSYTLAVNGEIYNHIMLRE 85
           I  RGP++    + K+  I  +  +  +      Q I   D  Y L  NGE+YN+ +   
Sbjct: 47  IARRGPNYQMFRVFKSEQISWYSSILSLRKPFTKQSIEVND-RYILQFNGELYNNEIHGI 105

Query: 86  ECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMFAWCLYDSKKDRIIAARDPIGITTL 144
              +Y    L        L EK  I+  + L+G FA+ ++DSKK  +   RD IG  +L
Sbjct: 106 SDTTYFVNCLKTA-----LDEKDIINILRTLEGEFAYTIFDSKKKLVYFGRDTIGKRSL 159

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKA 457
            R PFLD   ++    +D       P   KI K ILR  
Sbjct: 448 VRYPFLDEHVIKFSA-VDI------PINFKINKLILRNV 479

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 22/127 (17%)

Query: 27  IRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQPIT----SEDGSYTLAVNGEIYNHIM 82
           I  RGP++S   V  +    ++      + S  QP T    S D  Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSLRVSKA----YQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYNKEI 102

Query: 83  LREECASYPFKTLSDCEPIIPLYEKYD-----IDAPKHLDGMFAWCLYDSKKDRIIAARD 137
             ++         +D + I  L +        ID  + L+G +A+ +YD K  +    RD
Sbjct: 103 SDDD---------NDSQYIASLLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGITTL 144
           PIG  +L
Sbjct: 154 PIGRRSL 160

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRK 456
           FLD D ++        +++  P   K+ K ILR+
Sbjct: 449 FLDHDVIKF-----STEEI--PINYKVNKMILRR 475

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 94/219 (42%), Gaps = 35/219 (15%)

Query: 27  IRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQPITSED----GSYTLAVNGEIYNHIM 82
           I+ RGPD+S   V +     H       + S  +P TS+       + L  NGE+YN   
Sbjct: 47  IKSRGPDYSSLRVSSE----HSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYN--- 99

Query: 83  LREECASYPFKTLSDCEPIIP-LYEKYD--IDAPKHLDGMFAWCLYDSKKDRIIAARDPI 139
             +E  ++     +D + I+  L E Y       + L G FA+ LYD ++ +    RD +
Sbjct: 100 --QEITAHD----NDTQFIVSKLQEGYHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNV 153

Query: 140 GITTLYMGRSSASPKSVWFSSELKCL--TDDCDEIIAFPPGHVYDSETDKL-------TR 190
           G  +L     SA    ++ SS    +    DC   + +    VYD+E+  L       ++
Sbjct: 154 GKRSLSY-HLSAITGELYISSVSGAIPGFKDCIAGVVY----VYDTESKTLDDSIKLESQ 208

Query: 191 YFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVP 229
           YF    LDE  +       + +   L  AVRKR+++  P
Sbjct: 209 YFITKKLDE-ELTCLDSTVEQLYGMLSLAVRKRVLSIHP 246

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKA 457
           FLD   ++L            P   K+ K ILRK 
Sbjct: 452 FLDEYVIKLST-------AEIPINFKVNKLILRKV 479

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 10/90 (11%)

Query: 60  QPITSE----DGSYTLAVNGEIYN-HIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPK 114
           QP T +    D  Y L  NGE+YN  I   +  + Y    L + +  + +     ID  K
Sbjct: 76  QPFTKQSINVDDRYFLQFNGELYNKEISQGDNDSLYIASMLQNLKEGMGV-----IDVIK 130

Query: 115 HLDGMFAWCLYDSKKDRIIAARDPIGITTL 144
            L+G +A+ +YD    ++   RDPIG  +L
Sbjct: 131 SLEGEYAYTIYDVNSSKLYFGRDPIGRRSL 160

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARV 421
           ++LSG G+DE++GGY  FA +AP   E   E  K++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKA 457
           PFLD   ++          +  P   K+ K ILRK 
Sbjct: 451 PFLDEYVIKF-------STVEIPINYKVNKLILRKV 479

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 53/123 (43%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQPITSE----DGSYTLAVNGEIYN-HI 81
           I  RGP++S       T+  +       + S  +P T +    D  Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNKEV 102

Query: 82  MLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMFAWCLYDSKKDRIIAARDPIGI 141
                 + Y    L D E      +   ID  K L+G +A+ +YD K  +    RDPIG 
Sbjct: 103 SHWGNDSLYIASLLKDLED-----DGSVIDVIKSLEGEYAYTVYDVKSAKFYFGRDPIGR 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 48/97 (49%), Gaps = 10/97 (10%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLE 418
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILR 455
            R PFLD   +Q    +        P   K+ K ILR
Sbjct: 445 VRYPFLDEKVVQFSTEL--------PINYKVNKKILR 473

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 79/172 (45%), Gaps = 31/172 (18%)

Query: 27  IRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQPITSE----DGSYTLAVNGEIYNHIM 82
           I +RGP+++ +I  +S   +    +I+ L     P+T +    +  + L  NGE+YN  +
Sbjct: 49  IINRGPNYA-SIRNSSKYGISWFSSILSL---RDPLTRQSVKINDRFVLQYNGELYNSSI 104

Query: 83  LREECASYPFKTLSDCEPIIPLYEKYDIDAPK---HLDGMFAWCLYDSKKDRIIAARDPI 139
                        +D   I  L E+Y  D PK    ++G FA+ ++D + +++   RD I
Sbjct: 105 QH-----------NDTLFIASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLYFGRDTI 153

Query: 140 GITTLYMGRSSASPKSVWFSSELKCLT---DDCDEIIAFPPGHVYDSETDKL 188
           G  +L     S + K   F S +   +   +DC+    +    +YDS+T  L
Sbjct: 154 GKRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYDSKTGNL 199

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 10/99 (10%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILR 455
           +E R PFLD   ++    +        P   K+ K ILR
Sbjct: 442 VEVRYPFLDDRVIEFSTQL--------PINYKVNKMILR 472

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 49/103 (47%), Gaps = 10/103 (9%)

Query: 354 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKST 412
           + I  Q   +VL SG G+DE++GGY  F    S      E  K++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNN-KSPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 413 MAWGLEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILR 455
              G+E R PFLD + + L  ++        P   K  K ILR
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL--------PINYKTNKNILR 469

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 12/77 (15%)

Query: 69  YTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAP-KHLDGMFAWCLYDS 127
           Y L  NGE+YN  +           + +D + I  L EK  +D   + L G FA+ +Y++
Sbjct: 91  YILQYNGELYNDDI-----------SHNDSQYIAGLLEKLPVDVVLRRLYGEFAYSIYNT 139

Query: 128 KKDRIIAARDPIGITTL 144
           K   I   RD +G  +L
Sbjct: 140 KTKCIYFGRDSVGKRSL 156

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKA 457
           FLD   +     +        P   K+ K ILRK 
Sbjct: 448 FLDDQVVAFSTQL--------PINYKVNKMILRKV 474

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 10/85 (11%)

Query: 60  QPITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGM 119
           Q I  ED  + L  NGEIYN  +   +   Y  + L + + I  +         + L G 
Sbjct: 83  QCIEVED-RFVLQYNGEIYNSSISHND-TQYIAEMLLNAKDIPSVI--------RTLSGE 132

Query: 120 FAWCLYDSKKDRIIAARDPIGITTL 144
           FA+ +YD     +   RDPIG  +L
Sbjct: 133 FAYTIYDKLTGEVFFGRDPIGRRSL 157

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 38.9 bits (89), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 43/89 (48%), Gaps = 14/89 (15%)

Query: 102 IPLYEKYDIDAPKHLDGMFAWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSE 161
           +P Y + DIDAPKHL+ MFA+     +K              ++ G S    ++ +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCC--------CCKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDDCDEIIAFPPGHVYDSE 184
             L C    LT  CD   +F PG V+DSE
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 6/93 (6%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTM 413
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 414 AWGLEARVPFLDRDFLQLCMNIDP----NDKMI 442
           + G+E R PFL  + ++      P     DKMI
Sbjct: 442 SNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 65/168 (38%), Gaps = 36/168 (21%)

Query: 1   MCGIFASFRNPDVQAYKPKALQ-----------------LSKRIRHRGPDWSG--NIVKN 41
           MCGI   +  P  +A   + L+                 + K +R RGP++     I   
Sbjct: 1   MCGILLCY-GPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDV 59

Query: 42  STILVHERLAIVGLDSGAQPITSED----GSYTLAVNGEIYN-HIMLREECASYPFKTLS 96
           ++I +   L++       QP T +       Y L  NGE+YN  I+       +    L 
Sbjct: 60  NSIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGELYNDEIIESGNDTQFLSGLLK 113

Query: 97  DCEPIIPLYEKYDIDAPKHLDGMFAWCLYDSKKDRIIAARDPIGITTL 144
            C     + E    +    LDG FA+ + D + + I   RD IG  +L
Sbjct: 114 KC-----ISEDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSL 156

>Kpol_1024.37 s1024 complement(101873..102568) [696 bp, 231 aa] {ON}
           complement(101873..102568) [696 nt, 232 aa]
          Length = 231

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 22/130 (16%)

Query: 318 TFTLQEGLDALDD-VIYHLETYDVTTIRASTPMFLLSRKIKAQGVKMVLSGEGSDEIFGG 376
           T TLQ   D LD  V+Y L ++  T+        LL+  ++ + +  V            
Sbjct: 80  TSTLQHFQDTLDSTVVYPLPSFPTTSHEG-----LLTTLLRKKNIPEV----------DD 124

Query: 377 YLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVPFLDR-DFLQLCMNI 435
           +L F++  S  + ++ S ++V+     D ++ ++    W L   V  L++ DF  L  NI
Sbjct: 125 WLAFSKDVSGLDLNILSEQQVE-----DSIKEDREATKWALTKLVGELEKYDFKNLYYNI 179

Query: 436 DPNDKMIKPA 445
           D N+  ++P 
Sbjct: 180 DENNVPVRPT 189

>KLLA0B06061g Chr2 complement(540386..540917,541004..541086) [615
           bp, 204 aa] {ON} similar to uniprot|P27882 Saccharomyces
           cerevisiae YGR029W ERV1 Flavin-linked sulfhydryl oxidase
           localized to the mitochondrial intermembrane space has a
           role in the maturation of cytosolic iron-sulfur proteins
           ortholog of human hepatopoietin (ALR)
          Length = 204

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 34/73 (46%)

Query: 243 IAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDLQA 302
           +AA AA +   T+A+   ++  S  +  +G  +   L  + W+ LH+ A   PN P    
Sbjct: 70  LAAGAATDISNTSADQPLLIPGSKTYSKSGPADVEELGRSSWTLLHTIAAKYPNKPSDTQ 129

Query: 303 ARKVATFIGSIHH 315
            +++  F+    H
Sbjct: 130 KQEMKQFMTIFSH 142

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,338,058
Number of extensions: 2626229
Number of successful extensions: 5884
Number of sequences better than 10.0: 47
Number of HSP's gapped: 5972
Number of HSP's successfully gapped: 65
Length of query: 574
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 459
Effective length of database: 40,294,809
Effective search space: 18495317331
Effective search space used: 18495317331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)