Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0B10219gna 1ON1791798721e-121
AGR353Cna 1ON1771121226e-08
Ecym_8180na 1ON1741031182e-07
KLLA0D02684g4.303ON20068780.072
Kwal_47.171214.303ON20068770.088
TPHA0B018404.303ON20268770.099
KLTH0D15708g4.303ON20068740.25
TDEL0D011504.303ON20068730.28
YKL196C (YKT6)4.303ON20068730.32
Smik_11.284.303ON20068730.32
Skud_11.294.303ON20068730.33
NCAS0A027604.303ON20068730.34
Suva_11.274.303ON20068720.38
TBLA0F033604.303ON20062720.38
NDAI0D046904.303ON20068720.41
CAGL0D03498g4.303ON20562710.60
SAKL0G16786g4.303ON20068700.65
KAFR0I005304.303ON20268690.89
AER109W4.303ON20068690.96
KNAG0E038404.303ON20066681.2
KNAG0I012201.409ON25546672.4
Ecym_70234.303ON20068627.2
KLLA0F04587g2.232ON225843637.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B10219g
         (179 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B10219g Chr2 complement(893941..894480) [540 bp, 179 aa] {O...   340   e-121
AGR353C Chr7 complement(1385949..1386482) [534 bp, 177 aa] {ON} ...    52   6e-08
Ecym_8180 Chr8 (376511..377035) [525 bp, 174 aa] {ON} similar to...    50   2e-07
KLLA0D02684g Chr4 complement(228564..229166) [603 bp, 200 aa] {O...    35   0.072
Kwal_47.17121 s47 complement(258727..259329) [603 bp, 200 aa] {O...    34   0.088
TPHA0B01840 Chr2 complement(412955..413563) [609 bp, 202 aa] {ON...    34   0.099
KLTH0D15708g Chr4 (1294041..1294643) [603 bp, 200 aa] {ON} highl...    33   0.25 
TDEL0D01150 Chr4 complement(217621..218223) [603 bp, 200 aa] {ON...    33   0.28 
YKL196C Chr11 complement(74932..75534) [603 bp, 200 aa] {ON}  YK...    33   0.32 
Smik_11.28 Chr11 complement(59718..60320) [603 bp, 200 aa] {ON} ...    33   0.32 
Skud_11.29 Chr11 complement(61036..61638) [603 bp, 200 aa] {ON} ...    33   0.33 
NCAS0A02760 Chr1 (527535..528137) [603 bp, 200 aa] {ON} Anc_4.30...    33   0.34 
Suva_11.27 Chr11 complement(60006..60608) [603 bp, 200 aa] {ON} ...    32   0.38 
TBLA0F03360 Chr6 (829891..830493) [603 bp, 200 aa] {ON} Anc_4.30...    32   0.38 
NDAI0D04690 Chr4 (1101865..1102467) [603 bp, 200 aa] {ON} Anc_4....    32   0.41 
CAGL0D03498g Chr4 complement(357058..357675) [618 bp, 205 aa] {O...    32   0.60 
SAKL0G16786g Chr7 (1450325..1450927) [603 bp, 200 aa] {ON} highl...    32   0.65 
KAFR0I00530 Chr9 complement(110681..111289) [609 bp, 202 aa] {ON...    31   0.89 
AER109W Chr5 (841793..842395) [603 bp, 200 aa] {ON} Syntenic hom...    31   0.96 
KNAG0E03840 Chr5 (760749..761351) [603 bp, 200 aa] {ON} Anc_4.30...    31   1.2  
KNAG0I01220 Chr9 (229930..230697) [768 bp, 255 aa] {ON} Anc_1.40...    30   2.4  
Ecym_7023 Chr7 (42277..42879) [603 bp, 200 aa] {ON} similar to A...    28   7.2  
KLLA0F04587g Chr6 (444673..451449) [6777 bp, 2258 aa] {ON} simil...    29   7.9  

>KLLA0B10219g Chr2 complement(893941..894480) [540 bp, 179 aa] {ON}
           conserved hypothetical protein
          Length = 179

 Score =  340 bits (872), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 166/179 (92%), Positives = 166/179 (92%)

Query: 1   MPSIDNELRFPDSTQPHAIAKWFHDPENVGGFIFLCFVVTLVLIAVVSFIFGIXXXXXXX 60
           MPSIDNELRFPDSTQPHAIAKWFHDPENVGGFIFLCFVVTLVLIAVVSFIFGI       
Sbjct: 1   MPSIDNELRFPDSTQPHAIAKWFHDPENVGGFIFLCFVVTLVLIAVVSFIFGIYYFFNPY 60

Query: 61  XXXXXXKSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPI 120
                 KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPI
Sbjct: 61  TPPPTPKSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPI 120

Query: 121 DKHKSLLSTVKHFFYPRHVIPLEKIHRDESPCYFFADDEASVEQVEKEANRACSPHNMV 179
           DKHKSLLSTVKHFFYPRHVIPLEKIHRDESPCYFFADDEASVEQVEKEANRACSPHNMV
Sbjct: 121 DKHKSLLSTVKHFFYPRHVIPLEKIHRDESPCYFFADDEASVEQVEKEANRACSPHNMV 179

>AGR353C Chr7 complement(1385949..1386482) [534 bp, 177 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YLR012C
          Length = 177

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 56/112 (50%), Gaps = 11/112 (9%)

Query: 10  FPDSTQPHAIAKWFHDPENVGGFIFLCF---VVTLVLIAVVSFIFGIXXXXXXXXXXXXX 66
           FP S +   +  +  D + +G F F+CF   ++ L++  V++ ++               
Sbjct: 21  FPTSLRMSDLRSFISDTDRMGSFCFMCFMCFILMLLMYMVLASMYDCGYALRRRLEKENA 80

Query: 67  KS------LWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQES 112
            +      +W+SI DY  KLTP QQ+ Y++ +  ++E+E   HRL+  ++ S
Sbjct: 81  AAVACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQER--HRLESEKELS 130

>Ecym_8180 Chr8 (376511..377035) [525 bp, 174 aa] {ON} similar to
           Ashbya gossypii AGR353C
          Length = 174

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 9/103 (8%)

Query: 5   DNELRFPDSTQPHAIAKWFHDPENVGGFIFL---CFVVTLVLIAVVSFIFGIXXXXXXXX 61
           D     P+S +P  +  +  D + +G F F+    F+++L+   + SF++          
Sbjct: 13  DEWFLLPESIKPKELKSFLTDSDKIGSFSFMWFTVFIISLLAYMIFSFVYEYSYAMKKRI 72

Query: 62  XXXXXKSL------WISIADYQDKLTPEQQDQYIQQACDLYEK 98
                ++L      WISI DY  KL+P  QD Y++ +  ++E+
Sbjct: 73  QRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMFEQ 115

>KLLA0D02684g Chr4 complement(228564..229166) [603 bp, 200 aa] {ON}
           highly similar to uniprot|P36015 Saccharomyces
           cerevisiae YKL196C YKT6 v-SNARE (synaptobrevin)
           essential for endoplasmic reticulum-Golgi transport
          Length = 200

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L I IA YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 123 KELDIYIAKYQD---PSQADAIMRVQQELDETKITLHKTIENVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            +  + F+
Sbjct: 180 SAASRMFY 187

>Kwal_47.17121 s47 complement(258727..259329) [603 bp, 200 aa] {ON}
           YKL196C (YKT6) - v-SNARE [contig 214] FULL
          Length = 200

 Score = 34.3 bits (77), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L I IA YQD   P Q D  ++   +L E ++ LH+  +   + G    N +DK +SL
Sbjct: 123 KELDIYIAKYQD---PSQADSIMRVQQELDETKIVLHKTIESVLQRGERLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ + F+
Sbjct: 180 SASSRMFY 187

>TPHA0B01840 Chr2 complement(412955..413563) [609 bp, 202 aa] {ON}
           Anc_4.303 YKL196C
          Length = 202

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L I I  YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 125 KELEIYINKYQD---PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESL 181

Query: 127 LSTVKHFF 134
            ++ K F+
Sbjct: 182 TASSKMFY 189

>KLTH0D15708g Chr4 (1294041..1294643) [603 bp, 200 aa] {ON} highly
           similar to uniprot|P36015 Saccharomyces cerevisiae
           YKL196C YKT6 v-SNARE (synaptobrevin) essential for
           endoplasmic reticulum-Golgi transport
          Length = 200

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L I I+ YQD   P Q D  ++   +L E ++ LH+  +   + G    N +DK +SL
Sbjct: 123 KELDIYISKYQD---PSQADSIMRVQQELDETKIVLHKTIESVLQRGERLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ + F+
Sbjct: 180 SASSRMFY 187

>TDEL0D01150 Chr4 complement(217621..218223) [603 bp, 200 aa] {ON}
           Anc_4.303 YKL196C
          Length = 200

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L + I  YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 123 KELEMYIRKYQD---PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ K F+
Sbjct: 180 TASSKMFY 187

>YKL196C Chr11 complement(74932..75534) [603 bp, 200 aa] {ON}
           YKT6Vesicle membrane protein (v-SNARE) with
           acyltransferase activity; involved in trafficking to and
           within the Golgi, endocytic trafficking to the vacuole,
           and vacuolar fusion; membrane localization due to
           prenylation at the carboxy-terminus
          Length = 200

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L   I+ YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 123 KQLDTYISKYQD---PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ K F+
Sbjct: 180 TASSKMFY 187

>Smik_11.28 Chr11 complement(59718..60320) [603 bp, 200 aa] {ON}
           YKL196C (REAL)
          Length = 200

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L   I+ YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 123 KQLDTYISKYQD---PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ K F+
Sbjct: 180 TASSKMFY 187

>Skud_11.29 Chr11 complement(61036..61638) [603 bp, 200 aa] {ON}
           YKL196C (REAL)
          Length = 200

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L   I+ YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 123 KQLDTYISKYQD---PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ K F+
Sbjct: 180 TASSKMFY 187

>NCAS0A02760 Chr1 (527535..528137) [603 bp, 200 aa] {ON} Anc_4.303
           YKL196C
          Length = 200

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L   I+ YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 123 KELDTYISKYQD---PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ K F+
Sbjct: 180 TASSKMFY 187

>Suva_11.27 Chr11 complement(60006..60608) [603 bp, 200 aa] {ON}
           YKL196C (REAL)
          Length = 200

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L   I+ YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 123 KQLDTYISKYQD---PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ K F+
Sbjct: 180 TASSKMFY 187

>TBLA0F03360 Chr6 (829891..830493) [603 bp, 200 aa] {ON} Anc_4.303
           YKL196C
          Length = 200

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 73  IADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSLLSTVKH 132
           I  YQD   P Q D  ++   +L E +++LH+  ++  + G    N +DK +SL ++ K 
Sbjct: 129 IVKYQD---PTQADAIMKVQQELDETKIELHKTIENVLQRGEKLDNLVDKSESLTASSKM 185

Query: 133 FF 134
           F+
Sbjct: 186 FY 187

>NDAI0D04690 Chr4 (1101865..1102467) [603 bp, 200 aa] {ON} Anc_4.303
           YKL196C
          Length = 200

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L   I  YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 123 KELDTYITKYQD---PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ K F+
Sbjct: 180 TASSKMFY 187

>CAGL0D03498g Chr4 complement(357058..357675) [618 bp, 205 aa] {ON}
           highly similar to uniprot|P36015 Saccharomyces
           cerevisiae YKL196c YKT6
          Length = 205

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 73  IADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSLLSTVKH 132
           I+ YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL ++ K 
Sbjct: 134 ISKYQD---PAQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKM 190

Query: 133 FF 134
           F+
Sbjct: 191 FY 192

>SAKL0G16786g Chr7 (1450325..1450927) [603 bp, 200 aa] {ON} highly
           similar to uniprot|P36015 Saccharomyces cerevisiae
           YKL196C YKT6 v-SNARE (synaptobrevin) essential for
           endoplasmic reticulum-Golgi transport
          Length = 200

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           + L I I+ YQD   P Q D  ++   +L E ++ LH+  +   + G    N +DK +SL
Sbjct: 123 RELDIYISKYQD---PSQADSIMKVQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ + F+
Sbjct: 180 SASSRMFY 187

>KAFR0I00530 Chr9 complement(110681..111289) [609 bp, 202 aa] {ON}
           Anc_4.303 YKL196C
          Length = 202

 Score = 31.2 bits (69), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L   I  YQD   P Q D  ++   +L E ++ LH+  ++  + G    N +DK +SL
Sbjct: 125 KELESYIIKYQD---PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESL 181

Query: 127 LSTVKHFF 134
            ++ K F+
Sbjct: 182 TASSKMFY 189

>AER109W Chr5 (841793..842395) [603 bp, 200 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL196C (YKT6)
          Length = 200

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           + L + +A YQD   P Q D  ++   +L E ++ LH+  +   + G    N +DK +SL
Sbjct: 123 RELEMYLAKYQD---PSQADSIMRVQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESL 179

Query: 127 LSTVKHFF 134
            ++ + F+
Sbjct: 180 SASSRMFY 187

>KNAG0E03840 Chr5 (760749..761351) [603 bp, 200 aa] {ON} Anc_4.303
           YKL196C
          Length = 200

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 69  LWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSLLS 128
           L   I+ YQD   P Q D  ++   +L + ++ LH+  ++  + G    N +DK +SL +
Sbjct: 125 LQTYISKYQD---PSQADAIMKVQQELDDTKIVLHKTIENVLQRGEKLDNLVDKSESLTA 181

Query: 129 TVKHFF 134
           + K F+
Sbjct: 182 SSKMFY 187

>KNAG0I01220 Chr9 (229930..230697) [768 bp, 255 aa] {ON} Anc_1.409
           YCL010C
          Length = 255

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 134 FYPRHVIPLEKIHRDESPCYFFADDEASVEQVEKEANRACSPHNMV 179
           FYP  V+   K HR+     F  ++E   E   ++  RA   H +V
Sbjct: 193 FYPAVVVGTNKKHRETCRLRFDGEEEVGKENASRQKPRAALSHGLV 238

>Ecym_7023 Chr7 (42277..42879) [603 bp, 200 aa] {ON} similar to
           Ashbya gossypii AER109W
          Length = 200

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 67  KSLWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQESGVMFPNPIDKHKSL 126
           K L + ++ YQD   P Q D  ++   +L E ++ LH+  +   + G    N ++K +SL
Sbjct: 123 KELDLYLSKYQD---PSQADSIMRVQQELDETKIVLHKTIESVLQRGEKLDNLVEKSESL 179

Query: 127 LSTVKHFF 134
            ++ + F+
Sbjct: 180 SASSRMFY 187

>KLLA0F04587g Chr6 (444673..451449) [6777 bp, 2258 aa] {ON} similar to
            uniprot|P40468 Saccharomyces cerevisiae YIL129C TAO3
            Identified in a hunt for mutants that activate OCH1
            transcription Transcriptional Activator of OCH1
          Length = 2258

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 107  KHEQESGVMFPNPIDKHKSLLSTVKHFFYPRHVIPLEKIHRDE 149
            KH +E  V+F   +     ++ T+ H   P+H+IP  KI R+E
Sbjct: 1605 KHAREI-VLFLANVPGGMGVIDTLFHSLEPKHIIPTSKILREE 1646

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,661,424
Number of extensions: 711637
Number of successful extensions: 2364
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2385
Number of HSP's successfully gapped: 27
Length of query: 179
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 77
Effective length of database: 41,785,467
Effective search space: 3217480959
Effective search space used: 3217480959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 62 (28.5 bits)