Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0B10175g5.351ON73173139580.0
TPHA0E011205.351ON73373029410.0
Kpol_339.125.351ON73373329280.0
Suva_15.2625.351ON73172628950.0
SAKL0G08844g5.351ON74673128830.0
KAFR0D046705.351ON73173128780.0
Smik_8.1485.351ON73173128750.0
YHR072W (ERG7)5.351ON73172628680.0
AGR351W5.351ON72972828470.0
KNAG0B045805.351ON72972428420.0
TDEL0E027605.351ON73173128350.0
Kwal_34.159795.351ON72872528280.0
KLTH0H14850g5.351ON72672428130.0
Skud_8.1315.351ON73172628080.0
TBLA0A031205.351ON74372627850.0
NCAS0H016405.351ON72872527620.0
CAGL0J10824g5.351ON73372227600.0
NDAI0C019705.351ON73172827590.0
ZYRO0D10164g5.351ON73273227370.0
Ecym_81825.351ON73273227360.0
TPHA0I032307.533ON324137742.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B10175g
         (731 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1529   0.0  
TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1137   0.0  
Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1132   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1119   0.0  
SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1115   0.0  
KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1113   0.0  
Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1112   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1109   0.0  
AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...  1101   0.0  
KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1099   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1096   0.0  
Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1093   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1088   0.0  
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...  1086   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1077   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1068   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1067   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1067   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1058   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...  1058   0.0  
TPHA0I03230 Chr9 complement(713161..714135) [975 bp, 324 aa] {ON...    33   2.5  

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1529 bits (3958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/731 (100%), Positives = 731/731 (100%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP
Sbjct: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
           HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI
Sbjct: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD
Sbjct: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
           TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL
Sbjct: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY
Sbjct: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
           FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE
Sbjct: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF
Sbjct: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV
Sbjct: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
           YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC
Sbjct: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE
Sbjct: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660
           ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI
Sbjct: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
           GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGHSAI 731
           LYVKEYGHSAI
Sbjct: 721 LYVKEYGHSAI 731

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/730 (72%), Positives = 606/730 (83%), Gaps = 1/730 (0%)

Query: 3   ELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSK-KVPQSTFARWLLKCEDFPEPH 61
           E YSE IGLP+TDPK WRL TD+LGR++WEYL E +      QST+ +WLL+  DFP P+
Sbjct: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63

Query: 62  PEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIP 121
           P INS+++ F A NA HNGA F++LLQDP SG FPCQYKGPMFM IGY+   YIA IEIP
Sbjct: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123

Query: 122 EHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDT 181
           +HE+ EMIRY+ N +HPVDGGWGLH VDKSTV GT LNYV +RLLGL KDH VCV+ARDT
Sbjct: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183

Query: 182 LLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLP 241
           L+RLGGAI +PHW KIWLS LNLYKWEGVNPAPPE W+LPY L IHP RWWVHTRG+Y+P
Sbjct: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243

Query: 242 VSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYF 301
           VSYLS T+Y+CEL PLL EIRTEIYT+ FE+IDF KHRNTVCGVDLYYPH+K+LD  N  
Sbjct: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303

Query: 302 ISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEF 361
           +  YE Y+RP W+ +KS   VYEL+KKEI NTDYLCIAPVN AFCA+VTLIEEGK+S++F
Sbjct: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363

Query: 362 GRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFL 421
            RF YR KD LFHGPQG+TVMGTNG QVWDCAF+IQY F+AGLAE PEF++ I  ++KFL
Sbjct: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423

Query: 422 CRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVY 481
           CRSQF  +C  GSFRDKR+GAW FSTKTQGYTVSDCTAE+IKAIIMV NS  +  +   +
Sbjct: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483

Query: 482 DTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECT 541
             E+L  GID+L+ LQNL SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYVECT
Sbjct: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543

Query: 542 DSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEA 601
           DSSVLGLTYF ++++Y+K++I   I  AI YIK  QQ +GSWYGCWGIC+TYAGMFA+EA
Sbjct: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603

Query: 602 LNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIG 661
           L T+GE Y+NSEVVRKGCDF V KQ+ DGGWSE MKSSELHTYVS + S VVQTAWVLI 
Sbjct: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663

Query: 662 LILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGL 721
           L+LAK+P K VIDR I LLK RQQPSGEWK+E VEGVFNHSCAIEY SYRFLFPIKALGL
Sbjct: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723

Query: 722 YVKEYGHSAI 731
           YVK YG+ +I
Sbjct: 724 YVKNYGNDSI 733

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/733 (71%), Positives = 609/733 (83%), Gaps = 2/733 (0%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M E YSE IGL +TDPK WRL TD LGR++WEYL+  D+ K PQS++ +WLL+  +FP P
Sbjct: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60

Query: 61  HPEINS--KTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKI 118
            P  NS  K   +TA++A HNGA FF+LLQD +SG FPCQYKGPMFMTIGY+   YIA +
Sbjct: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120

Query: 119 EIPEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRA 178
           +IP+HE+ E+IRY+ N AHPVDGGWGLH VDKSTV GTVLNYV +RLLGL KDH VCV+A
Sbjct: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180

Query: 179 RDTLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGI 238
           RDTL++LGGAI +PHW K WLS LNLYKWEGVNPAPPE W+LPY L+IHP RWWVHTRG+
Sbjct: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240

Query: 239 YLPVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTM 298
           YLP+SYLS  +YSCEL PLL E+R EIYT+PF++IDF +HRNTVCGVDLYYPH+KVLD  
Sbjct: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300

Query: 299 NYFISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDS 358
           N  I  YE+Y+RP W+  KS   VY+L+KKEI NTDYLCIAPVN AFCA+VTLIEEG+DS
Sbjct: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360

Query: 359 EEFGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSF 418
           + F RF +RFKD LFHGPQG+TVMGTNGVQVWDCAF IQY F+AGLAE PEF++TIVR++
Sbjct: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420

Query: 419 KFLCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVW 478
           +FLCRSQF  +CV GSFRDKR+GAW FSTKTQGYTVSDCTAEAIKAIIMV NSD +R V 
Sbjct: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480

Query: 479 GVYDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYV 538
                E+L  GIDVL+ LQNL SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYV
Sbjct: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540

Query: 539 ECTDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFA 598
           ECTDSSVLGLT+F ++ +YRK++I + I  AI YIK  QQ +GSWYGCWGIC+TYAGMFA
Sbjct: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600

Query: 599 LEALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWV 658
           +EAL T+GE Y NSE VRKGCDF V+KQ+ DGGW E MKSSELH+YV  ++S VVQTAWV
Sbjct: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660

Query: 659 LIGLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKA 718
           L+ L+LA++PDK VIDR I LLK RQ PSGEWK+E+VEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720

Query: 719 LGLYVKEYGHSAI 731
           LGLY K Y  + I
Sbjct: 721 LGLYTKAYSDNGI 733

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1119 bits (2895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/726 (71%), Positives = 597/726 (82%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M E YSE IGLP+TDP+RWRL TD LGR++WEYL+   +   P STF +WLL+  DFP+P
Sbjct: 1   MTEFYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTPEQAANDPPSTFTQWLLQDPDFPQP 60

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
           HP  N  +  F+A++A HNGA FF+LLQ+PDSG FPCQYKGPMFMTIGYV   YIA I+I
Sbjct: 61  HPAKNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGIQI 120

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PEHE+ E+IRY+ N AHPVDGGWGLH VDKSTV GTVLNYV++RLLGL KDH VCV+ARD
Sbjct: 121 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKARD 180

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
           TLLRLGGAI +PHW K+WLS LNLYKWEGVNPAPPE W+LPY L IHP RWWVHTRG+Y+
Sbjct: 181 TLLRLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 240

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           PVSYLS  ++ C + PLLEE+R EIYT+PF+ I+F  HRNTVCGVDLYYPH+K+L+  N 
Sbjct: 241 PVSYLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIANN 300

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
           F+  YE+Y+R  ++   S  +VY+LVKKEI NTD LCIAPVN AFCA+VTLIEEG DS+ 
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDSQA 360

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           F  F YRFKD LFHGPQG+T+MGTNGVQ WDCAF IQY F AGLAE PEFH+TIV ++KF
Sbjct: 361 FKDFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAYKF 420

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LCRSQF  +CV GSFRDKR GAW FSTKTQGYTVSDCTAE+IKAIIMV NS  + DV  +
Sbjct: 421 LCRSQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVHHL 480

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
              E+L  GIDVLL LQN+ SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYVEC
Sbjct: 481 ITNERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDSSVLGLTYF ++F+Y+K++I   I  AI YIKKSQ P+G WYG WGIC+TYAGMFALE
Sbjct: 541 TDSSVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFALE 600

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660
           AL+T+GETYENS  VRKGCDF V+KQ+ DGGW E MKSSELH+YV  +ES VVQTAW LI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWALI 660

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+ A++P + VIDR I LLK RQ+ SGEWK+E VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEY 726
           +Y K Y
Sbjct: 721 MYTKAY 726

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1115 bits (2883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/731 (70%), Positives = 606/731 (82%), Gaps = 1/731 (0%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M +LYS+ +GLP+TDP RWRL TD+LGR+TWEYLS   + K PQS++ ++LL+  DFP P
Sbjct: 17  MTKLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAP 76

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
            PE  S+   FTA++AA+NGA+F +LLQ+ +SG FPCQYKGPMF+TIGYV T Y A IEI
Sbjct: 77  KPERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEI 135

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PEHE+ E++RY+ N AHPVDGGWGLH  DKST  GT +NYV++RLLGLP DH VC RAR 
Sbjct: 136 PEHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARS 195

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
           TLL+LGGAI +PHW KIWLSILNLY WEGVNPAPPELW+LPY L IHP RWWVHTR +Y+
Sbjct: 196 TLLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYM 255

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           PV YLS+ ++ CEL PLL+EIRTEIYT+ ++TIDF KHRNTVCG+DLYYPHTK+LD  N+
Sbjct: 256 PVGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANW 315

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
            +  YE+Y+RPNW L  +  +VYEL+KKEI NTDYLCIAPVN AFCA+VTLIEEG DS E
Sbjct: 316 GMVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHE 375

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           F RF  RFKDVLFHGPQG+T+MGTNGVQVWDCAF +QY+F+A LAELPEF   IV+++KF
Sbjct: 376 FNRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELAELPEFRGIIVKAYKF 435

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LCRSQF  +C  GSFRDKR+G WPFSTKTQGYTVSDCTAEA+KAIIMV NS  + +    
Sbjct: 436 LCRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNE 495

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
              E+L   +D+LL LQN+ SFEYGSFA+YEKIKA  L+EKLNPAEVFGNIMVEFPYVEC
Sbjct: 496 ISDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVEC 555

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDSSVLGLTYF ++++YRK DI HAI  AI YIK+SQ  NGSWYG WG+C+TYAGMFALE
Sbjct: 556 TDSSVLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYGSWGVCFTYAGMFALE 615

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660
           AL T+GE YENSEVVRKGCDF V++Q+ DGGW E  KSSELH YVS ++S VVQTAW +I
Sbjct: 616 ALYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVI 675

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
           GL+LA++PDK VIDR I LLK RQ PSGEWK+E++EGVFNHSC IEYPSY+FLFPIKALG
Sbjct: 676 GLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALG 735

Query: 721 LYVKEYGHSAI 731
           LY K YG+ AI
Sbjct: 736 LYAKRYGNDAI 746

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/731 (70%), Positives = 600/731 (82%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M   YS+ +GL +TDP+ WRL TDDLGRQTW+Y+ + D++  PQ+TF +WLL+   FP P
Sbjct: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
           +P+I +    FTA +A +NGA FF+LLQD +SG FPCQYKGPMFMTIGYV   YIA IEI
Sbjct: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PEHEK E+IRY+ N AHPVDGGWGLH VDKST  GT +NYV++RLLGL K H VCVRARD
Sbjct: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
           TLLRLGGAI  PHW KIWLS+LNLY WEGVNPAPPE W+LPY L IHP RWWVHTRG+YL
Sbjct: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           P+SYLS  +YS E  PLLEEIR EIY +PF+ I+F +HRNTVCGVDLYYPH+ +LDT N 
Sbjct: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
            I  YE+++RP WL +KS   +YEL++KE  NTDYLCIAPVN AFCA+ TLIEEG +S+ 
Sbjct: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           F ++  RFKD LFHGPQG+TV GTNGVQ WDCAF IQY+F+AGLAE PEF++ +  +FKF
Sbjct: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LCRSQF  +CV GSFRDKR+GAW FSTKTQGYTVSDCTAE+IKAIIMV NS  +  +   
Sbjct: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
              E+L  GID+LL LQN+ SFE+GSFATYEKIKAPL++EKLNPAEVFGNIMVE+PYVEC
Sbjct: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDSSVLGLTYF R++ YR ++I   I  AI YIK +QQ +GSWYG WGIC+TYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660
           AL ++GE YENS+ V KGCDF V+KQ+PDGGWSE MKSSELHTYVS KES VVQTAWVLI
Sbjct: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+LAK+PDK VIDR I+LLK RQ+PSGEWK+E+VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGHSAI 731
           LYVKEYG   I
Sbjct: 721 LYVKEYGAQGI 731

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1112 bits (2875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/731 (70%), Positives = 600/731 (82%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M E YSETIGLP+TDP+ WRL TD++GR++WEYL+   +   P STF +WLL+  +FP P
Sbjct: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
            PE N  +  F+A++A HNGA FF+LLQ+PDSG FPCQYKGPMFMTIGYV   YIA I+I
Sbjct: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PEHE+ E+IRY+ N AHPVDGGWGLH VDKSTV GT LNYV++RLLGLPKDH VCV++R+
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
           TLLRLGGA+ SPHW KIWLS LNLY+WEGVNPAPPE W+LPY L +HP RWWVHTR +Y+
Sbjct: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           PVSYLS  +++C + PLLEE+R EIYT+PF+ I F KHRNTVCGVDLYYPH+K L+  N 
Sbjct: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
           F+  YE+Y+R  ++   S  +VY+LV+KEI NTD LCIAPVN AFCA+VTLIEEG DS+ 
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           F +F YRFKD LFHGPQG+T+MGTNGVQ WDCAF IQY+F+AGLAE  EF+ TIV ++KF
Sbjct: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LCR+QF  +CV GSFRDKR GAW FSTKTQGY VSDCTAEAIKAIIMV NS  + +V  +
Sbjct: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
              E+L  GIDVLL LQN+ SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYVEC
Sbjct: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDSSVLGLTYF +YF+Y+K++I   I  AI +IKKSQ PNGSWYG WGIC+TYAGMFALE
Sbjct: 541 TDSSVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFALE 600

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660
           AL+T+GETYENS  VRKGCDF V+KQ+ DGGW E MKSSELH+YV  ++S VVQTAWVLI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+ A++P K VIDR I LLK RQ+ SGEWK+E VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGHSAI 731
           +Y K Y   A+
Sbjct: 721 MYSKAYEQHAL 731

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/726 (70%), Positives = 599/726 (82%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M E YS+TIGLP+TDP+ WRL TD+LGR++WEYL+   +   P STF +WLL+   FP+P
Sbjct: 1   MTEFYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQP 60

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
           HPE N  +  F+A++A HNGA FF+LLQ+PDSG FPCQYKGPMFMTIGYV   YIA IEI
Sbjct: 61  HPERNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PEHE+ E+IRY+ N AHPVDGGWGLH VDKSTV GTVLNYV++RLLGLPKDH VC +AR 
Sbjct: 121 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARS 180

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
           TLLRLGGAI SPHW KIWLS LNLYKWEGVNPAPPE W+LPY L +HP RWWVHTRG+Y+
Sbjct: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           PVSYLS  ++SC + PLLEE+R EIYT+PF+ I+F K+RNTVCGVDLYYPH+  L+  N 
Sbjct: 241 PVSYLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANS 300

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
            +  YE+Y+R  ++   S  +VY+L+K E+ NTD LCIAPVN AFCA+VTLIEEG DSE 
Sbjct: 301 LVVFYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEA 360

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           F R  YRFKD LFHGPQG+T+MGTNGVQ WDCAF IQY F+AGLAE PEF+ TIV ++KF
Sbjct: 361 FQRLQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKF 420

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LC +QF  +CV GS+RDKR GAW FSTKTQGYTV+DCTAEAIKAIIMV NS  + +V  +
Sbjct: 421 LCHAQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHM 480

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
             +E+L  GIDVLL LQN+ SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYVEC
Sbjct: 481 ISSERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDSSVLGLTYF +YF+YRK++I   I  AI +IKKSQ P+GSWYG WGIC+TYAGMFALE
Sbjct: 541 TDSSVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALE 600

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660
           AL+T+GETYENS  VRKGCDF V+KQ+ DGGW E MKSSELH+YV  ++S VVQTAW LI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALI 660

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+ A++P+K VIDR I+LLK RQ+ SGEWK+E+VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEY 726
           +Y + Y
Sbjct: 721 MYSRAY 726

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/728 (68%), Positives = 602/728 (82%)

Query: 4   LYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHPE 63
           LYS+ +GLP TD +RWRL  D++G + WEY+ E ++ KVPQ+T  +WLL    FP P PE
Sbjct: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61

Query: 64  INSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPEH 123
           ++SK  GFTA NAA+NGA+F  LLQD  SGTFPC Y+GPMFMTIGYVV M++  + IPE 
Sbjct: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121

Query: 124 EKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTLL 183
           ++ E++RYV N AHPVDGGWGLH  DKSTV+GT LNYV++RLLG+ ++H V  RAR TLL
Sbjct: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181

Query: 184 RLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPVS 243
           R+GGAI SP+W K+WLS+LNLYKWEGVNPAPPELW+LPY    HPARWWVHTR I+LP+S
Sbjct: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241

Query: 244 YLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFIS 303
           YL+  +Y C L PLLEEIR+EI+T+PFE IDF  +RN VCG+DLYYPHT VL+T+N  I 
Sbjct: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301

Query: 304 KYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFGR 363
            YE+Y+RPNWLLK S NR+YEL+K EI NTDYLCIAPVNNA  AIVT IEEG DS EFGR
Sbjct: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361

Query: 364 FLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLCR 423
           FL RFK+VLF GPQG+ VMGTNGVQVWDCAFYIQ MF A L + PEF+E IVR+++FLCR
Sbjct: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421

Query: 424 SQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYDT 483
           SQ T+DCV GS+RD R+GAWPFSTKTQGY VSDCTAEA K++++V NS  +++V     +
Sbjct: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481

Query: 484 EKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTDS 543
           EKL+  ID LLGLQNL SF+YGSFA+YEKI+APL +E LN AEVF NIMVE PYVECTDS
Sbjct: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541

Query: 544 SVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEALN 603
           SVLGL+++R+Y +YR+ ++DHAI  A+ +IK +Q+ +GSWYGCWGICYTYAGMFALEAL+
Sbjct: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601

Query: 604 TIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIGLI 663
             GE+Y +SEVV+KGC+F V+KQLPDGGWSE MKSSELHTYVSDK SYVVQTAW LIGL+
Sbjct: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661

Query: 664 LAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723
           LA +PD+ VIDR I LLK+RQ PSGEWKYE++EGVFNHSCAIEYPSYRF+FPIKALG+Y 
Sbjct: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721

Query: 724 KEYGHSAI 731
           K+Y   A+
Sbjct: 722 KKYAKDAL 729

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1099 bits (2842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/724 (70%), Positives = 597/724 (82%), Gaps = 5/724 (0%)

Query: 4   LYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHPE 63
           LYSE +GLPRTDPKRWRL TD+LGR+TW+Y+ E+  +  PQS+F +WLL+  D      E
Sbjct: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRD-----TE 60

Query: 64  INSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPEH 123
            ++     TA+++  NGA FF+ LQDP SG FPCQYKGPMFMTIGY+   YIA IEIP+H
Sbjct: 61  TSAPKEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120

Query: 124 EKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTLL 183
           E+ E+IRY+ N +HPVDGGWGLH VDKSTV GTVLNYV++RLLGL +DH VC++ARDTLL
Sbjct: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180

Query: 184 RLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPVS 243
           RLGGAI +PHW KIWLS+LNLYKWEGVNPAPPE W+LPY L IHP +WWVHTRG+YLP+S
Sbjct: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240

Query: 244 YLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFIS 303
           YLS   YSCEL PLLEEIR EIYT+PF++IDF KHRNTVCGVDLYYPH+KVLD  N  I 
Sbjct: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300

Query: 304 KYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFGR 363
            YE+Y+RP W+ KKS  +VY L++KEI NTDYLCIAPVN AFCA+VTLIEEG DSE F +
Sbjct: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360

Query: 364 FLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLCR 423
           F  RFKD LFHGPQG+TVMGTNGVQ WDCAF +QY F+AGLAE PEF+  IV +++FL R
Sbjct: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420

Query: 424 SQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYDT 483
           SQF  +CV GSFRDKR G+W FSTKTQGYTVSDCTAEAIKAIIMV N+ ++ DV    + 
Sbjct: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480

Query: 484 EKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTDS 543
            +L  GIDVLL LQN  SFEYGSFATYEKIKAPL+MEKLNPAEVFGNIM+E+PYVECTDS
Sbjct: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540

Query: 544 SVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEALN 603
           SVLGLT+F +Y+ YR ++I   I  AI Y+K++Q+P+GSWYGCWGICYTYAGMFALEAL+
Sbjct: 541 SVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600

Query: 604 TIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIGLI 663
           ++ E Y NS +VRKGCDF V+KQL DGGW E MKSSELH+YVS  ES VVQTAW +I L+
Sbjct: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660

Query: 664 LAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723
           LA++PDK VI+R I LL+ RQ PSGEWK+E+VEGVFNHSCAIEYPSYRFLFPIKALGLY 
Sbjct: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720

Query: 724 KEYG 727
           K Y 
Sbjct: 721 KTYA 724

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/731 (69%), Positives = 597/731 (81%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M + YSE +GL RTDP  WRL TD+LGR+TW YL+   +K   Q TF +WLL+ E FP+P
Sbjct: 1   MVQFYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAKNDEQCTFTQWLLQSEKFPKP 60

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
            P  +S T+ F A +A  NGA FF+LLQDP SG FPCQYKGPMF+TIGYV   YI+   I
Sbjct: 61  SPNRHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGTTI 120

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PEHE+ E+IRY+ N AHPVDGGWGLH VDKST  GTV+NYV++RLLGLPKDH VC++AR 
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKARA 180

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
            L++LGGAI +PHW KIWLS+LNLYKWEGVNPAPPE+W+LPY L IHP RWWVHTR IYL
Sbjct: 181 LLMKLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAIYL 240

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           PVSYLS  +YSC L+ LL E+R+EIY +PF++I+F  +RNTVCG+DLYYPHT VL+  N 
Sbjct: 241 PVSYLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMANN 300

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
            +  YE+++RPNWL KK+ +RVY L+KKEIANTDYLCIAPVN AFCA+VT IEEGK+S  
Sbjct: 301 VMVFYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKESSA 360

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           F +F  R KD LFHGPQG+T+MGTNGVQ WDCAF IQY F+AGLAE PE+++TI  ++KF
Sbjct: 361 FKKFEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAYKF 420

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LCR+QF  +CVEGSFRDKR+GAWPFSTK QGYTVSDCTAEAIKAIIMV NS K+  +   
Sbjct: 421 LCRTQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIRNE 480

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
              E+L  GIDVLL LQN++SFEYGSFATYEKIKAPL MEKLNPAEVFGNIMVEFPYVEC
Sbjct: 481 ITDERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYVEC 540

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDSSVLGLTYF  +++YRK++I   I  AI YIK+ Q  +GSWYGCWG+CY+YAGMFA+E
Sbjct: 541 TDSSVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFAME 600

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660
           AL+++GE Y NSE VRKGCDF V++Q+ DGGW E MKSSELH+YVS +ES VVQTAWVLI
Sbjct: 601 ALHSVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWVLI 660

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+L K+P+KSVID  I LLK+RQ  +GEWK+E +EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLLGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGHSAI 731
           LY   YG  +I
Sbjct: 721 LYTATYGDDSI 731

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/725 (70%), Positives = 598/725 (82%), Gaps = 1/725 (0%)

Query: 4   LYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHPE 63
           LYSE +GLP+TD KRWRL TD LG + WEYLSE ++K+ PQS + ++LL+  DF  P P 
Sbjct: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61

Query: 64  INSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPEH 123
           +N  ++ FTA +AA NGA+FF LLQ+ DSG FPCQYKGPMFMTIGYV  +Y A++ IP  
Sbjct: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120

Query: 124 EKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTLL 183
            K E+IRY+ N +HPVDGGWGLH VDKST  GTV+NYV++RLLGL  D+ VC RAR TL 
Sbjct: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180

Query: 184 RLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPVS 243
           RLGGA+ +PHW K WLSILNLYKWEGVNPAPPELW+LPY L IHP RWWVHTR IY  + 
Sbjct: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240

Query: 244 YLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFIS 303
           YLS+ +YSC + PLLEEIR EIYTQPFE+IDF K +N VCGVDLYYPHT++L+  N  + 
Sbjct: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300

Query: 304 KYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFGR 363
            YE+Y++P+W LK S  +VYEL+KKEI NTDYLCIAPV+ AFCAIVTLIEEG+DS EF R
Sbjct: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360

Query: 364 FLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLCR 423
           FL RF+DVLF GPQG+TVMGTNGVQVWDCAF IQY F+AGLAELPEFHETI +++KFLCR
Sbjct: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420

Query: 424 SQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYDT 483
           SQF  +C  GSFRDKR+GAWPFSTKTQGYTVSDCTAE++KAIIMV NS  + ++      
Sbjct: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480

Query: 484 EKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTDS 543
           E+L   +DVLL LQN  SFEYGSFATYEKIKA   +EKLNPAEVFGNIMVEFPYVECTDS
Sbjct: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540

Query: 544 SVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEALN 603
           SVLGLTYF +++ YR+++I  AI+ AI YIK +Q+P+GSWYGCWGIC+TYAGMFALEAL+
Sbjct: 541 SVLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALEALH 600

Query: 604 TIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIGLI 663
           T+ ETYENSEVV+KGCDF V+KQ PDGGWSE MKSSELH+YV    S  VQTAW LIGL+
Sbjct: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660

Query: 664 LAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723
           LA++P+K +ID+ INLLK+RQ  SGEWK+E VEGVFNHSCAIEYPSY+FLFPIKALGLY 
Sbjct: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720

Query: 724 KEYGH 728
           K+Y H
Sbjct: 721 KKYEH 725

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1088 bits (2813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/724 (70%), Positives = 594/724 (82%), Gaps = 1/724 (0%)

Query: 3   ELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHP 62
           +LY++ +GLP TD   WRL TD+LG + WEYLSE ++K  PQS++ ++LL+  DF  P P
Sbjct: 2   KLYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAKADPQSSYVKYLLQNPDFEAPEP 61

Query: 63  EINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPE 122
             +SK   FTA +AA NGA+FF LLQ+ D+G FPCQYKGPMF+TIGYV T+Y A+I +PE
Sbjct: 62  LRSSKCDEFTAGDAAFNGAQFFSLLQE-DTGIFPCQYKGPMFLTIGYVATLYCARIPVPE 120

Query: 123 HEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTL 182
           H K E+IRY+ N AHPVDGGWGLH VDKST  GT +NYV++RLLGL  DH VC RAR TL
Sbjct: 121 HIKIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRARKTL 180

Query: 183 LRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPV 242
            RLGGAI +PHW K WLSILNLY+WEGVNPAPPELW+LPY L IHP RWWVHTR +Y  +
Sbjct: 181 HRLGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYQAL 240

Query: 243 SYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFI 302
            YLS+ +Y CEL PLL+EIR EIY +PFE+IDF KH+NTV GVDLYYPHTK+L+  N  +
Sbjct: 241 GYLSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIANVAL 300

Query: 303 SKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFG 362
           + YE Y++PNW LK S  +VYEL+KKEI NTDYLCIAPV+ AFCA+VTLIEEG+DS EF 
Sbjct: 301 TLYENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSYEFK 360

Query: 363 RFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLC 422
           RF+  F++VLF GPQG+TVMGTNGVQVWDCAF IQY F+AGLAELPEF +TI +++KFLC
Sbjct: 361 RFVDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYKFLC 420

Query: 423 RSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYD 482
           RSQF  +C  GSFRDKR+GAWPFSTKTQGYTVSDCTAEA+KAIIMV NS K+  + G   
Sbjct: 421 RSQFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRGEIS 480

Query: 483 TEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTD 542
            E+L   +D+LLGLQN  SFEYGSFATYEKIKA   +EKLNPAEVFGNIMVEFPYVECTD
Sbjct: 481 DERLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVECTD 540

Query: 543 SSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEAL 602
           SSVLGLTYF +Y+NYRK +I  AI+ AI YIK+ Q P+GSWYGCWG+C+TYAGMFALEAL
Sbjct: 541 SSVLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFALEAL 600

Query: 603 NTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIGL 662
            T+GE YENSEVVRKGCDFF ++Q  DGGWSE MKSSELHTYV    S VVQTAW LIGL
Sbjct: 601 YTVGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWALIGL 660

Query: 663 ILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGLY 722
           +LAK+P++ VIDR I LLK+RQ PSGEWK+E VEGVFNHSCAIEYPSY+FLFPIKALGLY
Sbjct: 661 LLAKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKALGLY 720

Query: 723 VKEY 726
            K Y
Sbjct: 721 SKRY 724

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/726 (69%), Positives = 593/726 (81%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M E YSE IGLP+TDP+ WRL TD+LGR++WEYL+   +   P STF +WLL+  +F +P
Sbjct: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
            P  N  +  F+A++A HNGA FF+LLQDP SG FPCQYKGPMF+TIGYV   YIA ++I
Sbjct: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PEHE+ E+IRY+ N AHPVDGGWGLH VDKSTV GTVLNYV++RLLGLPKDH VC +AR 
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
           TLLRLGGAI SPHW KIWLS LNLYKWEGVNPAPPE W+LPY L +HP RWWVHTRG+Y+
Sbjct: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           PVSYLS  ++SC + PLLEEIR EIYT+PF+ IDF  HRNTVCGVDLYYPH++ LD  N 
Sbjct: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
           F+  YE+Y+R  ++   S  +VY+L+K EI NTD LCIAPVN AFCA+VT IEEG DS+ 
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           F +F YRFKD LFHGPQG+T+MGTNGVQ WDCAF IQY F+AGLAE PEF+ TIV ++KF
Sbjct: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LCR+QF  +CV GSFR+KR G+W FSTKTQGYTV+DCTAE+IKAIIMV NS  + +V  +
Sbjct: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
             +E+L  GIDVLL LQN+ SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYVEC
Sbjct: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDSSVLGLTYF ++F+Y+K++I   I  AI YIK++Q P+GSWYG WGIC+TYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFAME 600

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660
           AL+T+GE YENS  VRKGCDF V+KQ+ DGGW E MKSSELH+YV   +S VVQ+AW LI
Sbjct: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L  A++P+K VIDR I LLK RQ+ SGEWK+E+VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEY 726
           +Y K Y
Sbjct: 721 MYAKAY 726

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1077 bits (2785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/726 (69%), Positives = 589/726 (81%), Gaps = 3/726 (0%)

Query: 4   LYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHPE 63
           LYS+ + LP+TDP+RWRLITD LGR++WEYLSE DSKK+PQSTF +WLL+  DFP P P+
Sbjct: 14  LYSDELKLPKTDPRRWRLITDKLGRESWEYLSEEDSKKIPQSTFVKWLLQIPDFPTPKPK 73

Query: 64  INSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPEH 123
           I      FT  +A  NGA FF+LLQDP+SG FPCQYKGPMF+TIGYV   YIA I+IPEH
Sbjct: 74  IKQGDKNFTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIPEH 133

Query: 124 EKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTLL 183
           E+ E+IRY+ N AHPVDGGWGLH VDKSTV GTVLNYV++RLLGLPK H VCV+AR TL+
Sbjct: 134 ERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKTLI 193

Query: 184 RLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPVS 243
           RLGGAI SPHW KIWLS+LNLYKWEGVNPAPPE W+LPY L IHP RWWVHTRG+YLPVS
Sbjct: 194 RLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLPVS 253

Query: 244 YLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFIS 303
           YL  T+++C   PL+EEIR EIY   ++TIDF KHRNTVCGVDLYYPH+K+LD  N  + 
Sbjct: 254 YLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNILV 313

Query: 304 KYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFGR 363
            YE+++RPN++  KS  +V +L++KEIANTDYLCIAPVN AFC++V L+E+G +S+EF R
Sbjct: 314 FYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEFER 373

Query: 364 FLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLCR 423
             YRFKD LFHGPQG+TVMGTNGVQ WDCAF +QY FMAGLAE PEF + I+RS+KFLCR
Sbjct: 374 CQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFLCR 433

Query: 424 SQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYDT 483
           SQF  +CV GSFRDKR+G W FSTKTQGYTVSDCTAE+IKAIIMV NS  +++V      
Sbjct: 434 SQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEISD 493

Query: 484 EKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTDS 543
           E+L  GI++L+ LQNL  FEYGSFATYEKIKAPL ME LNPAEVF NIMVE+PYVECTDS
Sbjct: 494 ERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECTDS 553

Query: 544 SVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEALN 603
           SVLGLTYF ++++Y+  +I   I  AI YIK++Q  +GSWYG WGIC+TYA MFALEAL 
Sbjct: 554 SVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEALE 613

Query: 604 TIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKE---SYVVQTAWVLI 660
           TIGE Y NSE V+KGCDF V+KQ  DGGWSE MKSSE+H YV   +   SYVVQT+W +I
Sbjct: 614 TIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWSVI 673

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
           GLILA +PDK V+ R I  +K +Q PSGEW+++ VEGVFNHSC IEYPSYRFLFPIKALG
Sbjct: 674 GLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKALG 733

Query: 721 LYVKEY 726
           LY   Y
Sbjct: 734 LYRTRY 739

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1068 bits (2762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/725 (69%), Positives = 580/725 (80%), Gaps = 4/725 (0%)

Query: 3   ELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHP 62
           +LYS+ +GL +TDP RWRL T+ LGR TWEY++       PQSTF +WLL+  DFP P P
Sbjct: 4   KLYSDELGLQKTDPTRWRLRTNPLGRHTWEYINSEQKTNDPQSTFTKWLLQLPDFPAPTP 63

Query: 63  EINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPE 122
                    TA  A ++GA FF LLQD +SGTFPCQYKGPMFMTIGYV   YIA +EIP 
Sbjct: 64  TTEEPR---TAREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGLEIPN 120

Query: 123 HEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTL 182
           HE+ E+IRY+ N AHPVDGGWGLH  DKSTV GTV+NYV++RLLG+ KDH VC RAR TL
Sbjct: 121 HERIEIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRARKTL 180

Query: 183 LRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPV 242
           L LGGAI +PHW K+WLS+LNLYKWEGVNPAPPE W+LPY L IHP RWWVHTRG+YLP+
Sbjct: 181 LSLGGAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGVYLPI 240

Query: 243 SYLSSTQYSCELDPLLEEIRTEIYT-QPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYF 301
           SYLS   +SCEL PLL+EIR EIYT QPFE I F ++RN VCGVDLYYPH++VLD  N  
Sbjct: 241 SYLSLVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDVANAC 300

Query: 302 ISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEF 361
           I KYE Y+RP WL K S  +VYEL+KKEI+NTDYLCIAPVN AFCA+VTLIEEG DS  F
Sbjct: 301 IVKYEEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVDSNAF 360

Query: 362 GRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFL 421
            +F YRFKD LFHGPQG+TVMGTNGVQVWDCAF IQY F+AGLAE  EF++TI  ++ FL
Sbjct: 361 QKFSYRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASAYAFL 420

Query: 422 CRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVY 481
           CRSQF  +CV GSFRDKR+G+W FSTKTQGYTVSDCTAE+IKAIIMV NS  ++ +  + 
Sbjct: 421 CRSQFDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAIHHLI 480

Query: 482 DTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECT 541
             EK+  GIDVLL LQN+ SFEYGSFATYEKIKAPL +EKLNPAEVFGNIMVE+PYVECT
Sbjct: 481 TDEKIYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPYVECT 540

Query: 542 DSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEA 601
           DSSVLGLTYF  Y+NYR  +I   I  A+ YIK  Q  +GSWYG WGICYTYAGMFA+EA
Sbjct: 541 DSSVLGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMFAMEA 600

Query: 602 LNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIG 661
           L+++GE Y NS VV+KGCDF V +Q+ DGGW E MKSSELHTYV+ + S VVQTAWV+I 
Sbjct: 601 LHSVGECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAWVVIA 660

Query: 662 LILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGL 721
           L+LAK+P K VI + + LLK RQ+PSGEWK+E+ EGVFNHSCAIEYPSYR LFPIKALGL
Sbjct: 661 LLLAKYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIKALGL 720

Query: 722 YVKEY 726
           Y + Y
Sbjct: 721 YAEIY 725

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1067 bits (2760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/722 (70%), Positives = 584/722 (80%), Gaps = 2/722 (0%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M + YS+T+G+PRTDPKRWRL T +LGR+ WEY+ ++     PQSTF +WLL+ E+FP P
Sbjct: 1   MTQFYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQSTFVQWLLQDEEFPTP 60

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
            P    +    ++  A + GA F++LLQD  SG FPCQYKGPMFMTIGYV   YIA +++
Sbjct: 61  SPR--KEGDDLSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGVKL 118

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PEHE+ E+IRY+ N AHPVDGGWGLH VDKSTV GTVLNYV +RLLGLPKDH VCVRAR 
Sbjct: 119 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRARH 178

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
           TL RLGGA  +PHW KIWLSILNLYKWEGVNPAPPE W+LPY L IHP RWWVHTR +YL
Sbjct: 179 TLHRLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAVYL 238

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           PVSYLS  +YSC L  LL EIR EIYT+ F+ I+F +HRNTVCGVDLYYPH+K+LDT N 
Sbjct: 239 PVSYLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTAND 298

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
            I  YE+Y+RP  +   S   VY L+KKEI NTD LCIAPVN AFCA+VT +EEGKDS+ 
Sbjct: 299 VIVFYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDSKA 358

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           F RF YRFKD LFHGPQG+TVMGTNGVQ WDCAF IQY F+AGLAE PEF E I+ ++KF
Sbjct: 359 FERFQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAYKF 418

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LCRSQF  +CVEGSFRDKR+GAW FSTKTQGYTVSDCTAEAIKAIIMV NS  +  V   
Sbjct: 419 LCRSQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVHDE 478

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
              E+L  GIDVLL LQN+  FEYGSFATYEKIKAPL MEKLNPAEVFGNIMVE+PYVEC
Sbjct: 479 ITDERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYVEC 538

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDSSVLGLTYF +Y++YRK +I H I  AI YIK++QQ +G WYGCWGIC+TYAGMFA+E
Sbjct: 539 TDSSVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFAME 598

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660
           AL+++GETY+NS  VRKGCDF ++KQ+PDGGW E MKSSELH YV   +S VVQTAW LI
Sbjct: 599 ALHSVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWALI 658

Query: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+LAK P++  I+R INLLK RQQPSGEWK+E+ EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 659 ALLLAKCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALG 718

Query: 721 LY 722
           LY
Sbjct: 719 LY 720

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1067 bits (2759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/728 (68%), Positives = 591/728 (81%), Gaps = 2/728 (0%)

Query: 3   ELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHP 62
           +LYSE +GL +TDP  WRL T+  GRQ+WEY++++ S   PQS F +WLL+  DFP P  
Sbjct: 4   KLYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDPQSNFTKWLLQLPDFPTPQY 63

Query: 63  EINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPE 122
             N K    +A      GAKFF LLQD  SGTFPCQYKGPMFMTIGYV   Y+A I+IPE
Sbjct: 64  PDNIKD--VSAEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADIKIPE 121

Query: 123 HEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTL 182
            E+ E+IRY+ N AHPVDGGWGLH  DKSTV GTVLNY+++RLLGL  +H VC++ARDTL
Sbjct: 122 SERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKARDTL 181

Query: 183 LRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPV 242
           LRLGGAI++PHW K+WLS+LNLYKWEGVNPAPPE W+LPY + IHP RWWVHTRG+YLP+
Sbjct: 182 LRLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGVYLPI 241

Query: 243 SYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFI 302
           SYLS   Y CEL  LL+EIR+EIY +PF++IDF KHRNTVCGVDLYYPH+K LD  N  I
Sbjct: 242 SYLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFANSLI 301

Query: 303 SKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFG 362
             YE+Y+RPN L   S ++VY+L+KKEI NTDYLCIAPVN AFCA+VTL+EEG DS+ F 
Sbjct: 302 VPYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADSKAFE 361

Query: 363 RFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLC 422
           RF YRFKD LF GPQG+TVMGTNGVQ WDCAF IQY+F+AGLA+ PEF+ TI  ++KFLC
Sbjct: 362 RFQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAYKFLC 421

Query: 423 RSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYD 482
           RSQF  DCV GSFRDKR GAW FSTKTQGYTVSDCTAE+IKAIIMV NS  ++D+     
Sbjct: 422 RSQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIHDEIS 481

Query: 483 TEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTD 542
            E+L   +D+LL LQN  SFE+GSFATYEKIKAPL +E LNPAEVFGNIMVE+PYVECTD
Sbjct: 482 DERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYVECTD 541

Query: 543 SSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEAL 602
           SSVLGLT F +++NYRK +I   I+ AI YIKK Q+ +GSWYG WGICYTYAGMFA+EAL
Sbjct: 542 SSVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFAMEAL 601

Query: 603 NTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIGL 662
           +++GETY NS VV+KGCDF V +QL DGGW E MKSSELHTYVS KES VVQTAWV++ L
Sbjct: 602 HSVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVLAL 661

Query: 663 ILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGLY 722
           +LA++P+K++ID+ I LLK+RQQ SGEWK+E+ EGVFNHSCAIEYPSYRFLFPIKALGLY
Sbjct: 662 LLAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALGLY 721

Query: 723 VKEYGHSA 730
            + Y H+A
Sbjct: 722 SQIYEHNA 729

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1058 bits (2737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/732 (66%), Positives = 590/732 (80%), Gaps = 1/732 (0%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M +LYSE + L RTDP  WRL  D LGR++WEY+S+ D+K  PQS + +WLL+   FP+P
Sbjct: 1   MTKLYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQSKYVQWLLQLPSFPKP 60

Query: 61  HPEINSKTSG-FTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIE 119
            P+I+S  +  F A  A  NGA F++LLQDPDSG FPCQYKGPMFMTIGYVV  Y+A IE
Sbjct: 61  SPKIHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGIE 120

Query: 120 IPEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRAR 179
           IP+ ++ EMIRY+ N +HPVDGGWGLH  DKSTV GT +NYV +RLLGLP+DH VCV+AR
Sbjct: 121 IPKPKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKAR 180

Query: 180 DTLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIY 239
            TL +LGGA+ +PHW KIWLS+LNLYKWEGVNPAPPE W+LPY L IHP RWWVHTR IY
Sbjct: 181 RTLHKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAIY 240

Query: 240 LPVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMN 299
           LPVSYLS  +Y C L PLL+E+R E+Y +PF +IDF  +RNTVCGVDLYYPH+KVLD MN
Sbjct: 241 LPVSYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLMN 300

Query: 300 YFISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSE 359
             +  YE+++R NW+   + NRVY L+KKEIANTDYLCIAPVN AFCA+VTLIEEG +S 
Sbjct: 301 SVLVFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNSP 360

Query: 360 EFGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFK 419
           +F RF +RF D LFHGPQG+T+MGTNGVQ WDCAF IQ +F AGLAE  +++ET+VR+++
Sbjct: 361 QFKRFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAYE 420

Query: 420 FLCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWG 479
           FL R+QF ++CV GSFRD R GAW FSTKTQGYTVSDCTAE+IKAIIMV  S  Y  V  
Sbjct: 421 FLNRAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVHS 480

Query: 480 VYDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVE 539
           + D E+L   IDVLL LQN+  FEYGSFATYE IKAPLLMEKLNPAEVFGNIMVE+PYVE
Sbjct: 481 LIDDERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVE 540

Query: 540 CTDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFAL 599
           CTDS+VLGLT F  Y +YR+ +I   I+ A+ YIKK Q  +GSWYGCWG+C+TYAGMFAL
Sbjct: 541 CTDSAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFAL 600

Query: 600 EALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVL 659
           EAL+++GE Y NS++V+KGCDF V +Q+ DGGW E MKS ELHTYV  +ES VVQT+WV+
Sbjct: 601 EALHSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWVI 660

Query: 660 IGLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKAL 719
           I L+L+K+P+KSVIDRA+  L+ RQ+ SGEWK++ VEGVFNHSCAIEYP+YRF+FPIKAL
Sbjct: 661 IALLLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKAL 720

Query: 720 GLYVKEYGHSAI 731
           GLYV  +G  AI
Sbjct: 721 GLYVNAFGKEAI 732

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score = 1058 bits (2736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/732 (66%), Positives = 581/732 (79%), Gaps = 1/732 (0%)

Query: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60
           M ELYS+ +GLP TDP RWRL    LG  +W+Y+SE DSKK+PQ    +WLL  ++F  P
Sbjct: 1   MVELYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSKKIPQCNCTKWLLNADNFSTP 60

Query: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120
            P++ +  + F A+NAA+NGA F +LLQ+ DSGTFP QYKGPMFMTI YV +MY+ + EI
Sbjct: 61  EPDVGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRKEI 120

Query: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180
           PE EK E+IRY+ N AHPVDGGWGLH   KSTV GTVLNY+++RLLG+ KDH VC RAR 
Sbjct: 121 PECEKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRARS 180

Query: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240
           TL RLGGAI +PHW KIWLSILNLYKWEGVNPAP E W LPY + IHPARWW+HTR IYL
Sbjct: 181 TLHRLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAIYL 240

Query: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300
           P+SYL    Y+CEL PLL+EIR EIYT  F+ I F KHRNTVC VDLY+PH+ +L+ +N 
Sbjct: 241 PMSYLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVINS 300

Query: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360
            I  Y+ Y+RP+WL+K S  +VYEL++KEI NT+YLC+APV+ AFC+IVT IEEG DS E
Sbjct: 301 AIVWYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADSPE 360

Query: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420
           F R +  F   +FHGPQG+TVMGTNG QVWDC+F++QY+FMA LAELPEF + +  ++KF
Sbjct: 361 FERLMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAYKF 420

Query: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480
           LCRSQFT +CV GS+RDKR+G WPFSTKTQGYTVSDCTAEA+KA+IMV  S  +  +   
Sbjct: 421 LCRSQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIHDE 480

Query: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540
              E L+  IDVLL LQN+ S EYGSFATYEKI+APL+MEKLNPAEVF NIMVE+PYVEC
Sbjct: 481 ISEEALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600
           TDS +LGLTYF  Y++YRK DIDH++  A  YIKK Q  +GSWYGCWGICYTYAGMFALE
Sbjct: 541 TDSCILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFALE 600

Query: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVS-DKESYVVQTAWVL 659
           AL TIGE YENSEVVR+GCDF V KQL DGGWSE +KS+EL  Y++ DK S VV T+W L
Sbjct: 601 ALYTIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSWAL 660

Query: 660 IGLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKAL 719
           IGL+LA +PDK VIDR I LLK RQ  SGEWK+E +EG+FNHSCAIEYP+YRFLFPIKAL
Sbjct: 661 IGLLLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIKAL 720

Query: 720 GLYVKEYGHSAI 731
           G+Y K+YG  AI
Sbjct: 721 GIYAKKYGKRAI 732

>TPHA0I03230 Chr9 complement(713161..714135) [975 bp, 324 aa] {ON}
           Anc_7.533 YPR176C
          Length = 324

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 60/137 (43%), Gaps = 30/137 (21%)

Query: 499 LSSF--EYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTDSSVLGLTYFRRYFN 556
           LS F  +YG FA + K    LL   L+  ++             T +S+  LT  RR   
Sbjct: 65  LSCFDDQYGGFAPFPKHDGHLL-STLSGLQILA-----------TYNSLDALTVIRR--- 109

Query: 557 YRKKDIDHAIDSAIAYIKKSQQPNGSWYGC-WGICYTYAGMFALEALNTIGETYENSEVV 615
                     +  I +IK +Q P+GS+ G  +G   T     AL +L+ +GE   +S+VV
Sbjct: 110 ----------EKCIKFIKGNQLPDGSFQGDRFGEVDTRFSYNALSSLSILGEL--SSDVV 157

Query: 616 RKGCDFFVTKQLPDGGW 632
               DF +     DGG+
Sbjct: 158 DPAVDFILKCYNFDGGF 174

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,618,555
Number of extensions: 3752109
Number of successful extensions: 8222
Number of sequences better than 10.0: 24
Number of HSP's gapped: 8345
Number of HSP's successfully gapped: 24
Length of query: 731
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 614
Effective length of database: 40,065,477
Effective search space: 24600202878
Effective search space used: 24600202878
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)