Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0B10142g5.349ON29329314570.0
Ecym_81845.349ON2481792543e-25
AGR349W5.349ON2421432282e-21
KLTH0H14806g5.349ON3462242296e-21
TBLA0H019805.349ON3591542139e-19
ZYRO0D10120g5.349ON3292862121e-18
KAFR0C018705.349ON3411911952e-16
TDEL0E027805.349ON3473001855e-15
SAKL0G08888g5.349ON3793021831e-14
KNAG0C055205.349ON3851511794e-14
Kwal_34.159865.349ON2311971692e-13
Suva_2.4875.349ON3681391601e-11
YDR318W (MCM21)5.349ON3681391582e-11
Skud_4.5845.349ON3681351538e-11
Smik_4.5775.349ON3681391531e-10
TPHA0D020705.349ON3732021521e-10
CAGL0H07139g5.349ON3581331521e-10
Kpol_1051.55.349ON3701421512e-10
NCAS0F028505.349ON2811051262e-07
Smik_10.1711.302ON88361685.3
Kpol_359.83.445ON348170675.4
SAKL0B01122g8.30ON33739675.5
CAGL0K12914g8.2ON42841668.4
NOTE: 1 genes in the same pillar as KLLA0B10142g were not hit in these BLAST results
LIST: NDAI0I01550

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B10142g
         (293 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...   565   0.0  
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   102   3e-25
AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...    92   2e-21
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...    93   6e-21
TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...    87   9e-19
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...    86   1e-18
KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...    80   2e-16
TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...    76   5e-15
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...    75   1e-14
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...    74   4e-14
Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...    70   2e-13
Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...    66   1e-11
YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...    65   2e-11
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...    64   8e-11
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...    64   1e-10
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...    63   1e-10
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...    63   1e-10
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....    63   2e-10
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...    53   2e-07
Smik_10.171 Chr10 complement(299809..302460) [2652 bp, 883 aa] {...    31   5.3  
Kpol_359.8 s359 complement(8905..9951) [1047 bp, 348 aa] {ON} co...    30   5.4  
SAKL0B01122g Chr2 complement(102399..103412) [1014 bp, 337 aa] {...    30   5.5  
CAGL0K12914g Chr11 (1277987..1279273) [1287 bp, 428 aa] {ON} sim...    30   8.4  

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/293 (94%), Positives = 277/293 (94%)

Query: 1   MEETEAVQQDIEALEREIQTIKIQIANAHSGASKDEVKIPDAYKQFLSENINFSNLMRKD 60
           MEETEAVQQDIEALEREIQTIKIQIANAHSGASKDEVKIPDAYKQFLSENINFSNLMRKD
Sbjct: 1   MEETEAVQQDIEALEREIQTIKIQIANAHSGASKDEVKIPDAYKQFLSENINFSNLMRKD 60

Query: 61  ENTTLSINLSPRKPGTTTGQIQGIDSSIRSNFGVSSGHNEVAGFKSITDFVQWENSVRLI 120
           ENTTLSINLSPRKPGTTTGQIQGIDSSIRSNFGVSSGHNEVAGFKSITDFVQWENSVRLI
Sbjct: 61  ENTTLSINLSPRKPGTTTGQIQGIDSSIRSNFGVSSGHNEVAGFKSITDFVQWENSVRLI 120

Query: 121 GVSLFPVNYDNIEFMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINI 180
           GVSLFPVNYDNIEFMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINI
Sbjct: 121 GVSLFPVNYDNIEFMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINI 180

Query: 181 HQHWQLITKDTDTSDSNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNM 240
           HQHWQLITKDTDTSDSNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNM
Sbjct: 181 HQHWQLITKDTDTSDSNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNM 240

Query: 241 GLNVSFRLGAXXXXXXXXXXXXXXXXCTFNGEKNISLLGSIYGITNRFQSIIM 293
           GLNVSFRLGA                CTFNGEKNISLLGSIYGITNRFQSIIM
Sbjct: 241 GLNVSFRLGADIIKIKVDDGDDEIIDCTFNGEKNISLLGSIYGITNRFQSIIM 293

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  102 bits (254), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 94/179 (52%), Gaps = 19/179 (10%)

Query: 84  IDSSIRSNFGVSSGHNEVAGFKSITDFVQWENSVRLIGVSLFPV----------NYDNI- 132
           + S  + N  + S    +     +  FV+ EN  R+ G++ FP+          ++D+  
Sbjct: 23  VRSPSKRNKLMKSSATSIRPDNELEKFVEIENCYRMSGITFFPLVDPGKLASNTHHDSTS 82

Query: 133 ---EFMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITK 189
              E +GIRLE+F+E +LKY+PP+Y+ILK   K   IW+L+KH +PK I+I Q W     
Sbjct: 83  LVAELLGIRLEVFNETTLKYEPPYYIILKRRPKANQIWDLYKHTIPKVIDIEQIWSTTGH 142

Query: 190 DTDTSDSNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNVSFRL 248
              + D  +  FA  CY +LL +H R+QF   L+     +     + +D+  + +SF+L
Sbjct: 143 GIISMDKEVYIFAKKCYMELLAIHYRLQFICNLDPQLFEN-----IKVDSYAVMLSFQL 196

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 94  VSSGHNEVAGFKSITDFVQWENSVRLIGVSLFPV---------NYDNI----EFMGIRLE 140
           + S   E +  + + +F++ EN  R+ G++ FP+         + DN     E +GIRLE
Sbjct: 24  ILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDPGRLGGQDKDNEGIVNEMLGIRLE 83

Query: 141 LFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMK 200
           +F+E + ++D P+YV+L+   K    W+LFKH LPK ++  + W         SDS++  
Sbjct: 84  VFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPKMLDAERIWSTTLNGAICSDSDVYL 143

Query: 201 FANLCYKDLLKVHSRVQFFRKLE 223
           FA  CY  L+ +H R+QF  +L+
Sbjct: 144 FAKKCYARLIDMHFRLQFIARLD 166

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score = 92.8 bits (229), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 103/224 (45%), Gaps = 29/224 (12%)

Query: 87  SIRSNFGVSSGHNEVAGFKSITDFVQWENSVRLIGVSLFPV---------NYDNI----E 133
           S R     S  H E      +   VQ EN  R++G+S FPV           D I    +
Sbjct: 133 SKRKRAAQSRAHEE------LVQKVQIENIYRMLGISTFPVVDPSDLEGTEEDEINIKRK 186

Query: 134 FMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDT 193
            +G+RLELF+EL   ++PP+Y++ K + K    W +F+H +P Y+ + Q +Q +  +   
Sbjct: 187 MLGLRLELFNELERSFEPPYYILFKQNPKN-SYWNIFRHTVPSYVGVEQMFQQVRSNGLL 245

Query: 194 SD-SNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNVSFRLGAXX 252
           ++ S I  FA   YK LL +  + Q FR+ E      +  S L ID    +VSF +    
Sbjct: 246 ANQSEIYTFAKKVYKSLLSISVKTQIFRRTEKK----EAISQLEIDPSCTSVSFHIEKLG 301

Query: 253 XXXXXXXXXXXXXXCTFNGEKNIS----LLGSIYGITNRFQSII 292
                         C+    +N+S    +LG +  + +R +S++
Sbjct: 302 CFVKLKLDATDVIACSCIPHENVSWNAQMLGPVVSLPDRIESLV 345

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score = 86.7 bits (213), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 88/154 (57%), Gaps = 19/154 (12%)

Query: 107 ITDFVQWENSVRLIGVSLFPV-NYDNIEFM-------------GIRLELFDELSLKYDPP 152
           + +FV  E   R++G++ FPV +  ++EF+             GIRLE++++L   ++ P
Sbjct: 146 LKNFVILEIVYRMVGITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKP 205

Query: 153 FYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKDLLKV 212
            Y++LK S K   IW +FK+ +P YI+IH  +  I     T+DS+I  FA   Y  L  +
Sbjct: 206 HYILLKQSEKS-KIWSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSI 264

Query: 213 HSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNVSF 246
             ++Q+F+KLE    N K +  L+ID +G+ +SF
Sbjct: 265 SKKIQYFKKLE----NLKVFENLNIDLIGIQISF 294

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 131/286 (45%), Gaps = 45/286 (15%)

Query: 1   MEETEAVQQDIEALEREIQTIKIQIANAHSGASKDEV-----------------KIPDAY 43
           M+  E ++QDIE+L REI ++  +     +   + E                  K P  Y
Sbjct: 1   MQSVEELEQDIESLTREITSLCQKRDELKAQKFEKECSELSNHPVVKEFESVFTKFPKLY 60

Query: 44  KQFLSEN--INFSNLMRKDENTTL-SINLSPRKPGTTTGQIQG--IDSSIRSNFGVSSG- 97
           +    EN  ++ ++    DE +T+ S  +  RK   + G +Q    D SI    G +S  
Sbjct: 61  EVLARENQIVDSNDNDTSDEPSTVDSSFVKRRKLEFSDGSVQNKMFDKSIADLLGDTSSS 120

Query: 98  ------HNEVAGFKSITDFVQWENSVRLIGVSLFP------VNYD----NIEFMGIRLEL 141
                  +++  FK +   V  EN+ RL G++ FP      +N+     N + +GIRLE+
Sbjct: 121 TSPGKRRSKLQNFKGLESQVSIENAYRLFGITFFPLVDPSDINFQRNDINRKMLGIRLEV 180

Query: 142 FDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKF 201
           F+E   +++ P Y++LK ++K L  W LFKH +P +I++   +Q I     T+   +  F
Sbjct: 181 FNEGLRQFEKPHYILLKQNLK-LNSWSLFKHTIPAFIDLESIFQKIDNGIITTYDQVYLF 239

Query: 202 ANLCYKDLLKVHSRVQFFRKLE-----GNYVNDKQYSLLHIDNMGL 242
           A   Y  LL V  RVQ   +L+      N   D Q + +  D  G+
Sbjct: 240 AKQVYIQLLCVSQRVQIIEELQDIRLISNLEIDLQIAAVSFDIQGM 285

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 88/191 (46%), Gaps = 29/191 (15%)

Query: 74  PGTTTGQIQGIDSSIRSNFGVSSGHNEVAGFKSITDFVQWENSVRLIGVSLFPV------ 127
           P     ++ G D S   N  + + H+++            EN  RL G++ FPV      
Sbjct: 117 PSKRRQRLNGDDRSSIGNLPLDNLHDQIM----------VENIFRLFGITFFPVVDPSDL 166

Query: 128 -------NYDNI-EFMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYIN 179
                    D + E +GIRL++FDELS KYD P Y++LK  +K    W++FKH +P YI 
Sbjct: 167 QMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKS-DTWDIFKHTIPSYIG 225

Query: 180 IHQHWQLITKDTDTSDSNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDN 239
           + + ++ ++     S  +I  F+   Y  LLK  +R    +K E   +     S L I  
Sbjct: 226 VEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARKGKLKKFEEKGL----ISNLRISL 281

Query: 240 MGLNVSFRLGA 250
               VSF +G 
Sbjct: 282 SSTKVSFSIGT 292

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 129/300 (43%), Gaps = 71/300 (23%)

Query: 1   MEETEAVQQDIEALEREIQTIKIQIANAHSGASKDEVKIPDA---------------YKQ 45
           M E E +QQDI+AL REI      +     G  KDE++  DA               + Q
Sbjct: 1   MSELEDLQQDIDALTREIG----DLVKERDGL-KDELRRNDADKLANHPVVKNFQSVFHQ 55

Query: 46  F--LSENINFSNLMRKDENTTLSINL---------SPRKPGTTTG------QIQGIDSSI 88
           F  L + ++     R +E+T   I+L         SP+K  +  G      Q Q  D SI
Sbjct: 56  FPQLYDVLSEETTARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPPVFQHQMFDESI 115

Query: 89  RSNFGVSSGHNEVAGFKSITDF----------VQWENSVRLIGVSLFPV--------NYD 130
                 +   +     + + D           V  EN  R+ G++ FPV        N +
Sbjct: 116 AQFIDTNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITYFPVVDPTDLKVNKE 175

Query: 131 ------NIEFMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHW 184
                 N E +GIRLE+F+E   +++ P+Y++LK  +K    W LFKH +P +I++H  +
Sbjct: 176 TNKTEINREMIGIRLEVFNESIARFEKPYYILLKKKIKS-DSWLLFKHTVPIFIDVHALF 234

Query: 185 QLITKDTDTSDSNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNV 244
                    S  NI  FA   Y+ L+++ +R+Q    L  + V         IDN+ L++
Sbjct: 235 NKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGV---------IDNLDLDL 285

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 126/302 (41%), Gaps = 88/302 (29%)

Query: 1   MEETEAVQQDIEALEREIQTIKIQIANAHSGASKDE----------VKIP------DAY- 43
           M + +  QQDI+AL REI ++  Q    H    K E           K+P      D Y 
Sbjct: 1   MSKLQEHQQDIDALNREIASLAQQQDELHLHIQKYEDQLERLRHESEKVPVIELTTDEYG 60

Query: 44  ---------KQFLSENINFSNLMRKDENTTLSI-----NLSPRK---------------- 73
                     + LSE +      R  +NT LS       +SPRK                
Sbjct: 61  PIFEAFPHLHKLLSEKLFQQESNRGHDNTALSTPKKSTTISPRKRVVNQVLPPSMPEHEW 120

Query: 74  -----PGTTTGQIQG-----IDSSI-----RSNFGVSSGHNEVAGFKSITDFVQWENSVR 118
                P              ID+ I     +    +S  HN     +++ D+V+ EN  R
Sbjct: 121 VLRMQPAVEHKMFDSDIADLIDTEILTSPSKRKEKLSKVHN---NKQNLIDYVRLENVYR 177

Query: 119 LIGVSLFPV-------------NYDNI-EFMGIRLELFDELSLKYDPPFYVILKPSVKRL 164
           + G+++FPV              Y+ + E MG+RLE+F+E+   ++ P+YV+LK S KR 
Sbjct: 178 MTGITVFPVVDPSDLKVNKETKEYEILREMMGVRLEVFNEVLSTFEKPYYVLLKKSSKR- 236

Query: 165 GIWELFKHNLPKYINIHQHWQLITKDTD----TSDSNIMKFANLCYKDLLKVHSRVQFFR 220
             W++FKH +P YI+I    QL+ + T+    T  S    FA   Y+ LL+   + Q F 
Sbjct: 237 DSWDIFKHTIPNYIDI----QLLFEKTNGGIITDYSGTYLFAKKVYQLLLQTSLKAQVFE 292

Query: 221 KL 222
            L
Sbjct: 293 VL 294

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score = 73.6 bits (179), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 21/151 (13%)

Query: 114 ENSVRLIGVSLFPV--------NYDN------IEFMGIRLELFDELSLKYDPPFYVILKP 159
           EN+ RL G++ FPV        N +        E +G+R ++F++   K++ PFYV+LK 
Sbjct: 185 ENAYRLFGITYFPVVDPADLQLNAETQKMVITREMLGVRFDVFNDQDSKFEKPFYVLLKK 244

Query: 160 SVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKDLLKVHSRVQFF 219
           ++K   +WE+FKH +P  I++H  +  IT    TS+++I  F+   Y  L++   R++ F
Sbjct: 245 NLK-AKVWEIFKHTIPGNIDVHSLFHTITGGLATSNNDIYLFSKEVYVRLVQSSLRLKHF 303

Query: 220 RKL-EGNYVNDKQYSLLHIDNMGLNVSFRLG 249
             L E   + D     L  D    NVSF  G
Sbjct: 304 NSLQERGLIED-----LRGDLRSTNVSFMTG 329

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 22/28 (78%)

Query: 1  MEETEAVQQDIEALEREIQTIKIQIANA 28
          M E E ++QDI+ALE+EI+++K + A+ 
Sbjct: 1  MRELEDLEQDIDALEKEIESLKKRTADV 28

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 90/197 (45%), Gaps = 23/197 (11%)

Query: 114 ENSVRLIGVSLFPV-NYDNIE------------FMGIRLELFDELSLKYDPPFYVILKPS 160
           EN  R IG+S FPV +  ++E             +G+RLE+F+EL   ++PP YV+ K +
Sbjct: 40  ENLYRTIGLSTFPVVDPSDVEQDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQN 99

Query: 161 VKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSD-SNIMKFANLCYKDLLKVHSRVQFF 219
           +K  G W +F+H +P Y+ + + ++        +D   I  F    Y  LL + ++ Q F
Sbjct: 100 LK-TGHWNIFRHTIPSYVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTF 158

Query: 220 RKLEGNYVNDKQYSLLHIDNMGLNVSFRLGAXXXXXXXXXXXXXXXXCT----FNGEKNI 275
           + L  + +     S L ID    + SF++                  C+     + +   
Sbjct: 159 KSLAESGI----VSQLVIDPSCTSASFQMMQGSVSVKLKLSETDITACSSIPRSSQKWTA 214

Query: 276 SLLGSIYGITNRFQSII 292
           ++LG +  +  R Q+++
Sbjct: 215 TILGPVQSLPRRLQTLV 231

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 71/139 (51%), Gaps = 23/139 (16%)

Query: 107 ITDFVQWENSVRLIGVSLFPV----------NYDNI----EFMGIRLELFDELSLKYDPP 152
           + D +  EN  R+ G++ FP+          + D I    E +GIRLE+F+E + K++ P
Sbjct: 160 LEDSIILENIYRMFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKP 219

Query: 153 FYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTD----TSDSNIMKFANLCYKD 208
            Y++LK  +K    W LFKH +P YI++    Q I  DT+     S  +   FA   +  
Sbjct: 220 HYILLKKRIKS-NSWFLFKHTIPSYIDV----QAIFNDTNGGLVISPDDAYLFAKRVFVQ 274

Query: 209 LLKVHSRVQFFRKLEGNYV 227
           L+++  R Q F+ LE   +
Sbjct: 275 LVEIQKRQQSFKDLEAKKI 293

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 70/139 (50%), Gaps = 23/139 (16%)

Query: 107 ITDFVQWENSVRLIGVSLFPVN--------------YDNIEFMGIRLELFDELSLKYDPP 152
           + D++  EN  R+ G++ FP+               + + E +GIRLE+F E + +++ P
Sbjct: 160 LEDYIVLENVYRMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKP 219

Query: 153 FYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTD----TSDSNIMKFANLCYKD 208
            YV+LK  +K    W LFKH +P +I++    Q I  DT+     S  +   FA   +  
Sbjct: 220 HYVLLKKRIKS-NSWFLFKHTIPSFIDV----QGIFDDTNGGLVISHDDAYLFAKRVFLQ 274

Query: 209 LLKVHSRVQFFRKLEGNYV 227
           L++V  R Q F+ LE   +
Sbjct: 275 LVEVQKRRQIFKDLEAKKI 293

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score = 63.5 bits (153), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 15/135 (11%)

Query: 107 ITDFVQWENSVRLIGVSLFPVN--------------YDNIEFMGIRLELFDELSLKYDPP 152
           + D +  EN  R+ G++ FP+               + + E +GIRLE+F E   K++ P
Sbjct: 160 LEDSIIMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKP 219

Query: 153 FYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKDLLKV 212
            Y++LK  +K    W LFKH +P +I++   +         S  N+  FA   +  L+++
Sbjct: 220 HYILLKKRIKS-NSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEI 278

Query: 213 HSRVQFFRKLEGNYV 227
             R Q F+ LE   +
Sbjct: 279 QKRQQKFKDLEAKKI 293

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 70/139 (50%), Gaps = 23/139 (16%)

Query: 107 ITDFVQWENSVRLIGVSLFPV----------NYDNI----EFMGIRLELFDELSLKYDPP 152
           + D +  EN  R+ G++ FP+          + D I    E +GIRLE+F E + K++ P
Sbjct: 160 LEDSIVVENVYRIFGITFFPLVDPIDLKIKDDSDEIFVDREMLGIRLEVFSERTSKFEKP 219

Query: 153 FYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTD----TSDSNIMKFANLCYKD 208
            Y++LK  +K    W LFKH +P +I++    Q I  DT+     S  +   FA   +  
Sbjct: 220 HYILLKKRIKS-NSWFLFKHTVPSFIDV----QGIFDDTNGGLVVSYDDAYLFAKRVFLQ 274

Query: 209 LLKVHSRVQFFRKLEGNYV 227
           L+++  R Q F+ LE   +
Sbjct: 275 LVEIQKRQQIFKDLEAKKI 293

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 97/202 (48%), Gaps = 26/202 (12%)

Query: 44  KQFLSENINFSNLMRKDENTTLSINLSPRKPGTTTGQIQGIDSSIRSNFGVSSGH-NEVA 102
           KQ + E+  F++ + ++ NT +  + S RK      +I G D+    N G  + + NE  
Sbjct: 113 KQPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDA----NMGYKNPNLNEEL 168

Query: 103 GFKSITDFVQWENSVRLIGVSLFPVN--------------YDNIEFMGIRLELFDELSLK 148
             K I      EN+ RL G+S FPV                +  E +GIRLE+FD+    
Sbjct: 169 ERKIIK-----ENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGV 223

Query: 149 YDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKD 208
           ++ P Y++LK   K    W LFK+ +P YI+I+  +Q I      +  +I  FA   Y  
Sbjct: 224 FEKPHYILLKKKTKS-NNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQ 282

Query: 209 LLKVHSRVQFFRKL-EGNYVND 229
           LL + +R +   +L E N V+D
Sbjct: 283 LLLIQNRKKNLMQLQEANIVSD 304

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 71/133 (53%), Gaps = 15/133 (11%)

Query: 111 VQWENSVRLIGVSLFP-VNYDNIEF-------------MGIRLELFDELSLKYDPPFYVI 156
           +Q+EN  RL G+S FP V+  ++ F             +GIR ++F+E S  ++ P Y++
Sbjct: 159 IQYENIYRLFGISYFPLVDPSDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYIL 218

Query: 157 LKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKDLLKVHSRV 216
           LK S K    W+LFK+ +P YI++   +  +T     +  ++  FA   Y  L+++  R 
Sbjct: 219 LKKSAKS-DDWKLFKYTVPNYIDVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIRS 277

Query: 217 QFFRKLEGNYVND 229
           + F +LE + + D
Sbjct: 278 ELFLQLEKDGIID 290

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 73/142 (51%), Gaps = 16/142 (11%)

Query: 105 KSITDFVQWENSVRLIGVSLFP-VNYDNI-------------EFMGIRLELFDELSLKYD 150
           K++   ++ EN  RL G++ FP V+  ++             E +GIRLE+++E +  ++
Sbjct: 162 KNLNKKIRIENLFRLFGITFFPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFE 221

Query: 151 PPFYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKDLL 210
            P Y++LK  +K +  W +FKH +P YI+I   W  I      +   I  FA   Y +L+
Sbjct: 222 KPHYILLKKKLK-IDSWMIFKHTIPSYIDIESKWFGINNGMLNTYDEINVFAKEVYIELI 280

Query: 211 KVHSRVQFFRKL-EGNYVNDKQ 231
             + R Q  +KL E  Y+ D Q
Sbjct: 281 HGNIREQKIQKLTELEYIRDCQ 302

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 60/105 (57%), Gaps = 10/105 (9%)

Query: 82  QGIDSSIRSNFGVSSGHNEVAGFKSI-TDFVQWENSVRLIGVSLF-PVNYDNIE--FMGI 137
           + + S  +    + +G +E+   K +  ++   EN  R++G+S F  V+ +++E   +GI
Sbjct: 140 EMLSSPSKRRLILKNGQDEMEENKHLQKEYRLLENVFRIVGISFFDAVDPNDLESDMIGI 199

Query: 138 RLELFDELSLKYDPPFYVILKPSVK--RLGIWELFKHNLPKYINI 180
           RL+ F++ S  Y    Y+ILK   K  R G+W + KH +PKYIN+
Sbjct: 200 RLDPFNQPSKVY----YIILKKEAKNNREGLWTIIKHTIPKYINV 240

>Smik_10.171 Chr10 complement(299809..302460) [2652 bp, 883 aa] {ON}
           YJL070C (REAL)
          Length = 883

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 92  FGVSSGHNEVA-GFKSITD-FVQWENSVRLIGVSLFPVNYDNIEFMGIRLELFDELSLKY 149
           +G SS    +A G K I D F+ W  +V LI   L P    N+E   +R  L  ++ L++
Sbjct: 386 YGCSSTDQPIAIGLKLIDDEFLDWYKNVYLIDYHLTPNKVANLEGKEMRFYLLAKVFLEF 445

Query: 150 D 150
           D
Sbjct: 446 D 446

>Kpol_359.8 s359 complement(8905..9951) [1047 bp, 348 aa] {ON}
           complement(8905..9951) [1047 nt, 349 aa]
          Length = 348

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 63/170 (37%), Gaps = 47/170 (27%)

Query: 45  QFLSENINFSNLMRKDENTTLSINLSPRKPGTTTGQIQGIDSSIRSNFGVSSGHNEVAGF 104
           QF   N+   N      N    IN + R   TT        S IRS F   SG N    +
Sbjct: 40  QFFGANLKIKNTCINQRNAIAQIN-NVRSFSTT--------SLIRSRFNPMSGENSSNRY 90

Query: 105 KSITDFVQWE------NSVR---LIGVSLFPVNYDNIEFMGIRLELFDELSLKYDPPF-- 153
             +  F Q+       NS+R   + G SL    Y    ++            +Y PPF  
Sbjct: 91  VRLNRFQQYRQNDRGTNSLRNLTIFGASLMVGIYFGSPYL-----------FEYVPPFNH 139

Query: 154 ---------YVILKPSVKRLGIWELFKHN--LPKYI-----NIHQHWQLI 187
                    Y IL  +V   G+W+L K+   L +Y+     NI+  W LI
Sbjct: 140 FKRNPSHLVYTILGLNVVVFGLWQLPKNWRFLQRYMLLEKSNIYSKWSLI 189

>SAKL0B01122g Chr2 complement(102399..103412) [1014 bp, 337 aa]
          {ON} similar to uniprot|Q12291 Saccharomyces cerevisiae
          YLR063W Hypothetical ORF
          Length = 337

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%)

Query: 5  EAVQQDIEALEREIQTIKIQIANAHSGASKDEVKIPDAY 43
          E  +QD EAL R IQT+K  + N    A+ D      AY
Sbjct: 32 ELYEQDAEALHRTIQTVKTDLYNRDYAAAFDNEDKRSAY 70

>CAGL0K12914g Chr11 (1277987..1279273) [1287 bp, 428 aa] {ON}
           similar to uniprot|P43555 Saccharomyces cerevisiae
           YFL048c EMP47 Golgi membrane protein
          Length = 428

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 4/41 (9%)

Query: 33  SKDEVKIPDAYKQFLSENINFSNLMRKDENTTLSINLSPRK 73
           +KD+  IPD YK+FL+ N     L+++ E    SI +  RK
Sbjct: 347 TKDDTIIPDNYKEFLNMNDKLGELLKEQE----SIRMEHRK 383

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,009,119
Number of extensions: 1402038
Number of successful extensions: 4375
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4468
Number of HSP's successfully gapped: 43
Length of query: 293
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 184
Effective length of database: 40,982,805
Effective search space: 7540836120
Effective search space used: 7540836120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)