Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0B00352gna 1ON49849825040.0
Smik_15.560na 1ON51649917960.0
YOR378Wna 1ON51550517770.0
Suva_8.435na 1ON51550517660.0
Skud_15.545na 1ON51649317510.0
KLTH0C10560gna 1ON51547216760.0
Kwal_23.6547na 1ON51145616680.0
TDEL0B005508.843ON5374298681e-110
Kpol_541.168.843ON5284668371e-105
KAFR0B03930singletonON5554508351e-105
NDAI0K004008.843ON5534848341e-105
TPHA0C047908.843ON5564518231e-103
KLTH0C03806g8.843ON5255138171e-103
SAKL0D01386g8.843ON5214818141e-102
NCAS0A02540singletonON5394788131e-102
Kwal_27.102458.843ON5154508111e-102
Skud_13.4518.843ON5394518041e-100
Suva_13.4678.843ON5434518041e-100
YMR279C8.843ON5404517927e-99
KNAG0J002608.843ON5504507902e-98
KNAG0D00130na 1ON5654167894e-98
NCAS0C004008.843ON5174687855e-98
TBLA0D032708.843ON5504627842e-97
Suva_13.278.843ON5534657823e-97
NDAI0E002808.843ON5494727815e-97
Skud_13.258.843ON5374647789e-97
CAGL0B02343g8.843ON5374717771e-96
YML116W (ATR1)8.843ON5424517771e-96
Smik_13.188.843ON5454517675e-95
KNAG0G034308.843ON5424577604e-94
NCAS0B002908.843ON5424517596e-94
CAGL0L02519gna 1ON5294397561e-93
Smik_13.4928.843ON5434517571e-93
TBLA0D03280singletonON5804677541e-92
KAFR0C04860na 1ON5344737482e-92
KAFR0B039408.843ON5474297451e-91
CAGL0M03003g8.843ON5584626998e-85
KAFR0A028408.843ON5204686914e-84
NCAS0A05720na 1ON5634526318e-75
NDAI0K02730singletonON6045196243e-73
TBLA0C01160singletonON6004546216e-73
TDEL0G04950singletonON5124724004e-42
SAKL0C06116gsingletonON1851261914e-16
KLTH0H16214gsingletonON5514531661e-11
Smik_6.24na 2ON5444261608e-11
SAKL0F00440gsingletonON5444601572e-10
SAKL0C02178gsingletonON5652401572e-10
Skud_6.16na 2ON5494241572e-10
Suva_10.11singletonON5404191511e-09
Kwal_34.15746na 3ON5185071501e-09
SAKL0H16808g8.272ON6574011411e-08
KLLA0F17776gna 4ON5534111393e-08
KLLA0C18931gna 3ON5532731384e-08
AGR076C8.272ON6864071278e-07
SAKL0E04246gna 4ON5652461251e-06
Kwal_56.237548.272ON5894241223e-06
ZYRO0C01430g8.272ON5904091171e-05
Kwal_26.6697singletonON5772751044e-04
SAKL0C05588gsingletonON6771411045e-04
KLTH0G13464g8.272ON5932661036e-04
TDEL0D06610singletonON4974051019e-04
TDEL0C00120singletonON569439960.005
KLLA0A04631g8.272ON579387930.008
KLTH0C10142gsingletonON573144930.009
YPR198W (SGE1)singletonON543355920.011
Ecym_42988.272ON678160920.013
Ecym_73992.473ON563182910.015
Suva_13.2652.473ON561186900.020
KLLA0F13684g2.473ON571195900.022
Skud_13.2442.473ON562172890.028
YKR105C (VBA5)singletonON582182890.031
TPHA0G031502.473ON600250880.042
ABL040W2.473ON567215860.073
YMR088C (VBA1)2.473ON562186850.090
Skud_14.2672.242ON562135850.094
KLTH0C10120gsingletonON651145850.097
Kpol_543.448.272ON643418840.13
KNAG0E025602.473ON578282840.13
NDAI0H022002.473ON571189830.15
Smik_13.2722.473ON561177830.16
YNL065W (AQR1)2.242ON586133830.17
Kwal_33.150205.180ON59762820.19
Smik_14.2622.242ON561135820.20
TDEL0F039908.272ON631407800.33
TBLA0F030408.272ON906244790.46
Skud_16.503singletonON543348790.47
KLTH0G09372g2.242ON551133790.47
Suva_26.1singletonON534150780.63
NCAS0A078102.473ON568201770.74
KLTH0B03894g5.180ON60662770.75
YML049C (RSE1)1.497ON136156770.80
KLTH0A01034gsingletonON506115751.2
Suva_14.2762.242ON562133751.2
SAKL0E02992g2.473ON570191751.2
NDAI0D048404.30ON63997751.3
NCAS0G029902.242ON581134751.3
SAKL0A08228gsingletonON569170751.3
TBLA0B04710singletonON61567751.6
KAFR0J009302.242ON566128741.6
ZYRO0F02178gsingletonON59546741.7
KLLA0F10043gna 5ON52896741.9
SAKL0E08756g2.242ON565133732.1
Kwal_23.48242.242ON553133732.2
SAKL0G06600gsingletonON62974732.3
KLTH0C00330gna 6ON549151732.3
ZYRO0G21890gsingletonON57691732.5
TDEL0A024902.473ON554184723.0
Smik_16.81na 7ON625153723.2
SAKL0G13376g5.180ON62162714.0
ZYRO0A00330gsingletonON576194714.1
CAGL0J01375g2.473ON564179714.4
TPHA0F012902.242ON562132714.6
NCAS0H018805.395ON57356704.9
SAKL0D04510gna 8ON531117705.0
Kwal_26.6686singletonON56977705.2
Kwal_14.722singletonON61174705.4
KLTH0D05434g2.473ON576371705.5
TDEL0E02290singletonON57156705.7
NCAS0C03460na 7ON630131706.1
Kwal_33.152765.227ON552230696.7
Skud_14.2072.145ON67080696.7
Smik_17.11singletonON54470697.3
NDAI0B037702.242ON571135697.4
SAKL0E11110g2.145ON61886688.8
ABL210CsingletonON478151689.2
KLTH0E16720gsingletonON574152689.5
ZYRO0A01474g2.242ON538128689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B00352g
         (498 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   969   0.0  
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   696   0.0  
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   689   0.0  
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   684   0.0  
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   679   0.0  
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   650   0.0  
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   647   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   338   e-110
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   327   e-105
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   326   e-105
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               325   e-105
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   321   e-103
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   319   e-103
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   318   e-102
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   317   e-102
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   317   e-102
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   314   e-100
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   314   e-100
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   309   7e-99
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   308   2e-98
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   308   4e-98
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      306   5e-98
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   306   2e-97
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   305   3e-97
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      305   5e-97
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   304   9e-97
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   303   1e-96
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   303   1e-96
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   300   5e-95
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   297   4e-94
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      296   6e-94
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   295   1e-93
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   296   1e-93
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   295   1e-92
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     292   2e-92
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   291   1e-91
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   273   8e-85
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   270   4e-84
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            247   8e-75
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   244   3e-73
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   243   6e-73
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   158   4e-42
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...    78   4e-16
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    69   1e-11
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    66   8e-11
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    65   2e-10
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    65   2e-10
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    65   2e-10
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    63   1e-09
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    62   1e-09
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    59   1e-08
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    58   3e-08
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    58   4e-08
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    54   8e-07
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    53   1e-06
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    52   3e-06
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    50   1e-05
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    45   4e-04
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    45   5e-04
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    44   6e-04
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    44   9e-04
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         42   0.005
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    40   0.008
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    40   0.009
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    40   0.011
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    40   0.013
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    40   0.015
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    39   0.020
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    39   0.022
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    39   0.028
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    39   0.031
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    39   0.042
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    38   0.073
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    37   0.090
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    37   0.094
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    37   0.097
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    37   0.13 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    37   0.13 
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    37   0.15 
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    37   0.16 
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    37   0.17 
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    36   0.19 
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    36   0.20 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    35   0.33 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    35   0.46 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    35   0.47 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    35   0.47 
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        35   0.63 
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    34   0.74 
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    34   0.75 
YML049C Chr13 complement(174220..178305) [4086 bp, 1361 aa] {ON}...    34   0.80 
KLTH0A01034g Chr1 (100382..101902) [1521 bp, 506 aa] {ON} simila...    33   1.2  
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    33   1.2  
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    33   1.2  
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    33   1.3  
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    33   1.3  
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    33   1.3  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}             33   1.6  
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    33   1.6  
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    33   1.7  
KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {...    33   1.9  
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    33   2.1  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    33   2.2  
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    33   2.3  
KLTH0C00330g Chr3 (25162..26811) [1650 bp, 549 aa] {ON} similar ...    33   2.3  
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    33   2.5  
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    32   3.0  
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    32   3.2  
SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]...    32   4.0  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    32   4.1  
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    32   4.4  
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    32   4.6  
NCAS0H01880 Chr8 complement(361743..363464) [1722 bp, 573 aa] {O...    32   4.9  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    32   5.0  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    32   5.2  
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    32   5.4  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    32   5.5  
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    32   5.7  
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    32   6.1  
Kwal_33.15276 s33 (1039883..1041541) [1659 bp, 552 aa] {ON} YLR0...    31   6.7  
Skud_14.207 Chr14 complement(380245..382257) [2013 bp, 670 aa] {...    31   6.7  
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    31   7.3  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    31   7.4  
SAKL0E11110g Chr5 (933600..935456) [1857 bp, 618 aa] {ON} simila...    31   8.8  
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    31   9.2  
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    31   9.5  
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    31   9.5  

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/498 (96%), Positives = 480/498 (96%)

Query: 1   MSSKKLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDS 60
           MSSKKLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDS
Sbjct: 1   MSSKKLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDS 60

Query: 61  FGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS 120
           FGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS
Sbjct: 61  FGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS 120

Query: 121 NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSS 180
           NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSS
Sbjct: 121 NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSS 180

Query: 181 LLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGL 240
           LLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGL
Sbjct: 181 LLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGL 240

Query: 241 ILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMG 300
           ILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMG
Sbjct: 241 ILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMG 300

Query: 301 CIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPST 360
           CIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPST
Sbjct: 301 CIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPST 360

Query: 361 VMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQ 420
           VMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQ
Sbjct: 361 VMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQ 420

Query: 421 GLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRXXXXXXXXXXXXXXXXXXS 480
           GLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR                  S
Sbjct: 421 GLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGLGVAIS 480

Query: 481 YAIFHYSRLKRSLSEKYV 498
           YAIFHYSRLKRSLSEKYV
Sbjct: 481 YAIFHYSRLKRSLSEKYV 498

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/499 (69%), Positives = 393/499 (78%), Gaps = 4/499 (0%)

Query: 1   MSSKKLNSHEE--QDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIG 58
           M+ + L   +E   D   +Q  +   SLL E   + VLCSAQLMTQAGL QS+ PL IIG
Sbjct: 14  MNVETLKKDDEVLSDEFDVQEEKP-ESLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIG 72

Query: 59  DSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSV 118
           DSFG  NPGQLSWFASA+SLTVGTFILIAGRLGD FGHKKFFV+GF WYALWS+LAGFSV
Sbjct: 73  DSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSV 132

Query: 119 YSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVF 178
           YSNQIFFDCCRAFQG+GPAF LPNAIAI+ RTY+PGR++NM+FSLFGA AP GFV+GAVF
Sbjct: 133 YSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVF 192

Query: 179 SSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHP-PIHPDEKCSLVERIDVAGSVTGV 237
           SS+L + AWWPWAYW+MGI CFLL VAGY +IPH P P        L+ERID AGSVTGV
Sbjct: 193 SSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGV 252

Query: 238 VGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIF 297
           VGLILFNFAWNQGPVVGW+T YTYALLIVG+ FL  F FIESRA  PLLP   LSSDT F
Sbjct: 253 VGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRAAFPLLPFAALSSDTAF 312

Query: 298 VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTS 357
           V+ CIAAGW+SFGIW++YTWQ M + R Q PLLSSAQF PVAISG CAA+ T FLL+ T 
Sbjct: 313 VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTP 372

Query: 358 PSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPA 417
           PSTVM  AM AFTVG+IL+AT PV QTYWAQTFVSIIVMPWGMDMSFPAATI+LS +MP 
Sbjct: 373 PSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPH 432

Query: 418 SHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRXXXXXXXXXXXXXXXX 477
            HQGLAASLVNT++NYSISIGLG AGTIES ++DG  ++LKGYR                
Sbjct: 433 EHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFV 492

Query: 478 XXSYAIFHYSRLKRSLSEK 496
             +YA+  + + K+ +SEK
Sbjct: 493 AATYAVSTFMKSKKRVSEK 511

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/505 (68%), Positives = 397/505 (78%), Gaps = 10/505 (1%)

Query: 1   MSSKKLNSHEE----QDSLL----LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIV 52
           ++ K L+++ E    +D +L    +Q+ R   SLL E   + VLCSAQLMTQAGL QS+ 
Sbjct: 7   VTQKNLDTNAEALKKEDKVLSEFDIQDERP-KSLLWESAFVGVLCSAQLMTQAGLGQSLA 65

Query: 53  PLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSI 112
           PL IIG+SFG  N GQLSWFASA+SLTVGTFILIAGRLGD FGHKKFFV+GF WYALWS+
Sbjct: 66  PLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL 125

Query: 113 LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGF 172
           LAGFSVYSNQIFFDCCRAFQG+GPAF LPNAIAI+ RTY+PGR++NM+FSLFGA AP GF
Sbjct: 126 LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGF 185

Query: 173 VVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHP-PIHPDEKCSLVERIDVA 231
            +GAVFSS+L + AWWPWAYWIMGI CF+L VAGY VIPH P P        L+ERID A
Sbjct: 186 FLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFA 245

Query: 232 GSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKL 291
           GSVTGVVGLILFNFAWNQGPVVGW+T YTYALLIVG+ FL  F +IESRA  PLLP   L
Sbjct: 246 GSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRAAFPLLPFAAL 305

Query: 292 SSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEF 351
           SSDT FV+ CIAAGW+SFGIW++YTWQ M + R Q PLLSSAQF PVAISG CAA++T F
Sbjct: 306 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGF 365

Query: 352 LLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIIL 411
           LL+ T PSTVM+ AM AFTVG+IL+AT PV QTYWAQTFVSIIVMPWGMDMSFPAATI+L
Sbjct: 366 LLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIML 425

Query: 412 STAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRXXXXXXXXXX 471
           S +MP  HQGLAASLVNT++NYSISIGLG AGTIES+++DG    LKGYR          
Sbjct: 426 SDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLS 485

Query: 472 XXXXXXXXSYAIFHYSRLKRSLSEK 496
                   +YA   + + K+ +SEK
Sbjct: 486 GLGIFVAATYAWSTFMKSKKRISEK 510

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/505 (67%), Positives = 390/505 (77%), Gaps = 9/505 (1%)

Query: 1   MSSKKLNSHEEQ---DSLLLQNSREWT-----SLLKEGFAIMVLCSAQLMTQAGLAQSIV 52
           ++ K L +  E    D  +L N  E       SL+ E   + VLCSAQLMTQAGL QSI 
Sbjct: 7   VTQKNLETSAETTKTDDEVLLNQFELQDETPGSLVWEAAFVGVLCSAQLMTQAGLGQSIA 66

Query: 53  PLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSI 112
           PL IIGDSFG  NPGQLSWFAS++SLTVGTFILIAGRLGD FGH+KFF++GF WYALWS+
Sbjct: 67  PLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSL 126

Query: 113 LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGF 172
           LAGFSVYSN+IFFDCCRAFQG+GPAF LPNAIAI+ RTY+PG+++NM+FSLFGA AP GF
Sbjct: 127 LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGKRKNMVFSLFGASAPGGF 186

Query: 173 VVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPH-HPPIHPDEKCSLVERIDVA 231
           V+GAVFSS+L + AWWPWAYWIMGI CFLL VAGY VIPH   P       +++ER+D A
Sbjct: 187 VLGAVFSSMLGQLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFA 246

Query: 232 GSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKL 291
           GSVTGV+GLILFNFAWNQGPVVGWET YTY LLIVG+ FL  F FIESRA +PLLP   L
Sbjct: 247 GSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESRAAYPLLPFAAL 306

Query: 292 SSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEF 351
           SSD  FV+GCIAAGWSSFGIW++YTWQ M   R Q PLLSSAQF PVAISG CAA++T F
Sbjct: 307 SSDAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTGF 366

Query: 352 LLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIIL 411
           LL+ T  STVM+ AM AFTVG IL+AT PV QTYWAQTFVSIIVMPWGMDMSFPAATI+L
Sbjct: 367 LLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIML 426

Query: 412 STAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRXXXXXXXXXX 471
           S +MP  HQGLAASLVNT++NYSISIGLG AGTIESQ++DG  + LKGYR          
Sbjct: 427 SNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWYMGIGLS 486

Query: 472 XXXXXXXXSYAIFHYSRLKRSLSEK 496
                    YA   + + K+  SEK
Sbjct: 487 GLGIFVAAVYASSTFLKSKKKASEK 511

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/493 (68%), Positives = 383/493 (77%), Gaps = 2/493 (0%)

Query: 5   KLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIK 64
           K +     D   +Q+     SLL E   + VLCSAQLMTQAGL QS+ PL IIG SFG  
Sbjct: 20  KKDDEVVLDEFDIQDETP-GSLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTT 78

Query: 65  NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIF 124
           NPGQLSWFASA+SLTVGTFILIAGRLGD FGHKKFFV+GF WYALWS+LAGFSVYSN+IF
Sbjct: 79  NPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIF 138

Query: 125 FDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSE 184
           FDCCRAFQG+GPAF LPNAIAI+ RTY+ G+++NM+FSLFGACAP GFV+GAVFSSLL +
Sbjct: 139 FDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQ 198

Query: 185 FAWWPWAYWIMGITCFLLGVAGYLVIPHHP-PIHPDEKCSLVERIDVAGSVTGVVGLILF 243
            AWWPWAYWIMGI CF L +AGY +IPH   P        L+ER+D AGSVTGV+GLILF
Sbjct: 199 LAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILF 258

Query: 244 NFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIA 303
           NFAWNQGPVVGW+T YTY LLIVG+ FLA F FIESRA  PLLP   LSSDT FV+ CIA
Sbjct: 259 NFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRAAFPLLPFAALSSDTAFVLSCIA 318

Query: 304 AGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMI 363
           AGW+SFGIW++YTWQ M + R Q PLLSSAQF PVA+SG CAA++T +LL+RT PSTVM+
Sbjct: 319 AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVML 378

Query: 364 IAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLA 423
            AM AFT G+IL+AT PV QTYWAQTFVSIIVMPWGMDMSFPAATI+LS +MP  HQGLA
Sbjct: 379 FAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLA 438

Query: 424 ASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRXXXXXXXXXXXXXXXXXXSYAI 483
           ASLVNT++NYSISIGLG AGTIES ++DG    LKGYR                   YA 
Sbjct: 439 ASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAW 498

Query: 484 FHYSRLKRSLSEK 496
             + + K+  SEK
Sbjct: 499 STFKKSKKRTSEK 511

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/472 (66%), Positives = 363/472 (76%)

Query: 25  SLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFI 84
           SLL E   + V+C AQLMTQAGL QSI PL IIGDSFG +NPGQLSWFA+A+SLTVGTFI
Sbjct: 41  SLLGEAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFI 100

Query: 85  LIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           LIAGRLGD +GHKKFF++GF WYALWS+LAGFSVYSNQIFFDCCRAFQGIGPA  LPNAI
Sbjct: 101 LIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGIGPALLLPNAI 160

Query: 145 AIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGV 204
           AI+ RTY PGR++ MI SLFGA AP+GFV+GAVFSS+  +  WWPWAYW MGI CF L V
Sbjct: 161 AILGRTYVPGRRKAMILSLFGATAPAGFVLGAVFSSIFGQLTWWPWAYWAMGIVCFFLAV 220

Query: 205 AGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALL 264
           AG LVIP  P    D   S  +R+D+ GSVTGV+GL+L NFAWNQGPVVGW+T YTY+LL
Sbjct: 221 AGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLL 280

Query: 265 IVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLR 324
           IV + FL  F FIESRA HPLLP+  LSSD  FV+GC+ AGWSSFGIW+YY W  +  LR
Sbjct: 281 IVSAVFLCVFAFIESRAPHPLLPLSALSSDAAFVLGCVGAGWSSFGIWIYYFWLFLEELR 340

Query: 325 DQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQT 384
              PLL+SAQF PVAISGLCAA++T F++TR   S VM+ AM AFTVG IL+AT PV Q 
Sbjct: 341 GHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQV 400

Query: 385 YWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGT 444
           YWAQ FVSIIVMPWGMDMSFPAATI+LS +MP  HQGLAASLVN ++NYSISIGLG AGT
Sbjct: 401 YWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGT 460

Query: 445 IESQISDGEDDLLKGYRXXXXXXXXXXXXXXXXXXSYAIFHYSRLKRSLSEK 496
           +E ++++G  +LLKGYR                   Y    + + K+  SEK
Sbjct: 461 VEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYHTFKKSKKMPSEK 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/456 (67%), Positives = 373/456 (81%), Gaps = 2/456 (0%)

Query: 8   SHEEQDSLLLQNS--REWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKN 65
            +EE +SL L  S   +  SL++E   + +L  AQLMTQAGLAQSI P++IIG+SFGI N
Sbjct: 16  KNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISN 75

Query: 66  PGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFF 125
           PGQLSWF++A+SLTVGTFILIAGRLGD FGHKK FV+GFLWY+LWS+LAGFSVYSNQIFF
Sbjct: 76  PGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQIFF 135

Query: 126 DCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEF 185
           DCCRA QGIGPAF LPN+IAI+ RTY PG+++ M+FS+FGA AP GFV+G+VFSS+ S+ 
Sbjct: 136 DCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLGSVFSSIFSQL 195

Query: 186 AWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNF 245
           AWWPWAYW MG  C +LGVAG +VIP  PP   D    ++ERID AG+ TG++GL L NF
Sbjct: 196 AWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNF 255

Query: 246 AWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIAAG 305
           AWNQGPVVGW+T YTYALLIVG  FL  F  IESRA+ PLLP   LS+D  +V+GCIAAG
Sbjct: 256 AWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESRARFPLLPFAALSTDLAYVLGCIAAG 315

Query: 306 WSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIA 365
           WSSFGIW++Y WQ + + R Q PLL+SAQFVPVAISGLCAA++T ++L+      VM+IA
Sbjct: 316 WSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIA 375

Query: 366 MIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAAS 425
           MIAFTVG +LVAT P++QTYWAQTFVS+I+MPWGMDMSFPAATI++S AMP  HQGLAAS
Sbjct: 376 MIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAAS 435

Query: 426 LVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           LVNT++NYSIS+ LGFAGTIE+++++   + L+GYR
Sbjct: 436 LVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYR 471

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 176/429 (41%), Positives = 267/429 (62%), Gaps = 12/429 (2%)

Query: 39  AQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKK 98
            QL+ QAG   ++  ++++       +  + SW  ++F L  G+FILI+GRLGD +G KK
Sbjct: 73  GQLLNQAGSTMTLSTMKVLERELD-SSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKK 131

Query: 99  FFVMGFLWYALWSILAGFSVYS-NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPG-RK 156
             ++G++W  +WS++ G S +S N  FF   RAFQG+G +F LPN + I+   Y+PG R+
Sbjct: 132 MLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRR 191

Query: 157 QNMIFSLFGACAPSGFVVGAVFSSL--LSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHP 214
           +N++ SL G CAP G   G +F+ +  + + + WPWA++   I  FL  +  Y VIP+  
Sbjct: 192 KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSI 251

Query: 215 PIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAF 274
           P++ ++       +D  GS  GV GL+LFNF WNQ  VVGW T Y  ALLIV    +A F
Sbjct: 252 PVNVNKFA-----MDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALF 306

Query: 275 GFIESR-AKHPLLPVRKLSSDTI-FVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSS 332
              E + AK PLLP     S +I  ++  + AGW SFGIW++Y +Q +  LR+  P+ + 
Sbjct: 307 FIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAG 366

Query: 333 AQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVS 392
             F  V+I G  AA++  F + R  P+ ++  +MIAFT GSI+++  PV +TY+     +
Sbjct: 367 GTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGA 426

Query: 393 IIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDG 452
           ++++ +GMD+SFPAA+IILS  +   +QG+A SLVNT++NYS+S+ LG  GTIE QI+  
Sbjct: 427 MVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKS 486

Query: 453 EDDLLKGYR 461
            D LL+G+R
Sbjct: 487 GDRLLEGFR 495

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  327 bits (837), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 175/466 (37%), Positives = 278/466 (59%), Gaps = 17/466 (3%)

Query: 7   NSHEEQDSLLLQNSR----EWTSLLKEGFAIMVLCS-AQLMTQAGLAQSIVPLQIIGDSF 61
           ++++E  S+ L+NS     ++ +   + +A +  C  +QL+  AG  Q++  + ++    
Sbjct: 27  DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQL 86

Query: 62  GIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN 121
              +  ++ W  ++F L  G+FIL++GRLGD +G KK  ++G++   +WS++ G S YS+
Sbjct: 87  HSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSH 145

Query: 122 Q-IFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFS 179
             IFF   RAFQG+G +  LPN + +I   Y+PG  K+NM+ S+ GA +P G  +G +FS
Sbjct: 146 SGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFS 205

Query: 180 SLLSEFAW--WPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGV 237
            L++  +   WPWA++   +  F+     Y  IP++ P + +        +D  GS TGV
Sbjct: 206 GLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRL-----SMDWIGSFTGV 260

Query: 238 VGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSS-DT 295
           +GLILFNF WNQ P  GW ++Y   LL++    L AFG  E R A++PLLP   + +   
Sbjct: 261 LGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQL 320

Query: 296 IFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTR 355
           I ++  +  GW SFGIW +Y +  + NLR+  PL +   +    ISG   A+S  FL+ +
Sbjct: 321 IMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKK 380

Query: 356 TSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAM 415
             P+ ++  +M+ F +G I+ +  PV QTY+     ++I++P GMD+SFPA++IILS  +
Sbjct: 381 IRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNL 440

Query: 416 PASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           P  HQG+A SLVNT+INYS S+ LG AGT+E   +    DLL+GYR
Sbjct: 441 PNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYR 486

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  326 bits (835), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/450 (39%), Positives = 263/450 (58%), Gaps = 12/450 (2%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           QN   ++S  KE   I+    + L+ QAG  Q+   + +IG +F   +  + +W  ++F 
Sbjct: 70  QNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK-TWLMASFP 128

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIGP 136
           L  G+FIL++GR+GD +G K+  + G +   +WS++ GF+ YS+ + FF  CRAFQG+G 
Sbjct: 129 LVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGI 188

Query: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLLSEFA--WWPWAYW 193
           AF LPN + ++   Y+ G  ++N++ S  G CAP+G   GA ++ L++  A   WPW ++
Sbjct: 189 AFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFY 248

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
                  L  V     IP   P++          +D  GSV GV+GLILFNF WN+ P+V
Sbjct: 249 AYAFAGILNLVLAIYSIPDTVPVNVHG-----FSMDWTGSVVGVIGLILFNFVWNEAPIV 303

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLP-VRKLSSDTIFVMGCIAAGWSSFGI 311
           GWE +Y   LLI     +  F   E + AK PLLP     + + I ++  +  GW SFGI
Sbjct: 304 GWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGI 363

Query: 312 WVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV 371
           W +Y +  + NLR   PL + A      + G  AA +  F + R  PS ++  +M+AFTV
Sbjct: 364 WTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTV 423

Query: 372 GSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTII 431
           GSI+++  PV QTYW  TF   I++ +GMD+SFPA++IILS A+P  +QG+A SLVNTI+
Sbjct: 424 GSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIV 483

Query: 432 NYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           NYS S+ LG   T E Q++    DLLKGYR
Sbjct: 484 NYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  325 bits (834), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/484 (38%), Positives = 275/484 (56%), Gaps = 30/484 (6%)

Query: 2   SSKKLNSHEEQDS------------LLLQNSREW------TSLLKEGFAIMVLCSAQLMT 43
           SS++  + +EQD              L +N+  W      +S  KE   +     A L+ 
Sbjct: 30  SSERKTAIKEQDDEIGSDSTTTSSSSLQENNSSWQNPDYFSSSFKEYIFVATCMIANLLN 89

Query: 44  QAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMG 103
           QAG +Q +  + +I DSF     GQ +W  ++F L  G+FILI+GRLGD +G K+  + G
Sbjct: 90  QAGQSQVLSAMNVISDSFHSSTGGQ-TWLMASFPLVSGSFILISGRLGDIYGLKRMMIGG 148

Query: 104 FLWYALWSILAGFSVYSN-QIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIF 161
           F++  +WS++ GF+ Y++   FF   RAFQG+G +F LPN + ++   Y+ G  ++N++ 
Sbjct: 149 FIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVI 208

Query: 162 SLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPD 219
           SL G  AP+G   GA++  L+       WPW ++   +   +  V GY  +P + P + +
Sbjct: 209 SLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVN 268

Query: 220 EKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIES 279
                   +D  GSV GV+GLILFNF WNQGP+VGWE +Y   LLIV   FL AF   E 
Sbjct: 269 GF-----TMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEI 323

Query: 280 R-AKHPLLPVRKLSSDTIF-VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVP 337
           + AK PLLP     +  I  ++  +  GW SFGIW +Y +    NLR+  P+ S   F  
Sbjct: 324 KYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFV 383

Query: 338 VAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMP 397
             I G  AA +    + +  P+ ++  + I FT GSI+++  PV QTYW  TF   I++ 
Sbjct: 384 FIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILV 443

Query: 398 WGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLL 457
           +GMD+ FPA++IILS  +P  +QG+A SLVNTI+NYS S+ LG   T+E QI+   DDLL
Sbjct: 444 FGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLL 503

Query: 458 KGYR 461
           KGYR
Sbjct: 504 KGYR 507

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  321 bits (823), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/451 (38%), Positives = 263/451 (58%), Gaps = 14/451 (3%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           Q  + ++S L E   I      QL+ QAG  QS+  + II + FG +   Q +W  ++F 
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFP 124

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRAFQGIGP 136
           L  G+FIL+ GR GD +G KK  ++G+    +WSI+ G + Y++   FF   +AFQG+G 
Sbjct: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184

Query: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193
           +F LPN I ++   Y PG  K+N+  S  GA AP G   G +FS ++   +   WPW ++
Sbjct: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
              I  FL+GV  Y  +P + P + +       ++D  GS  GVVGL+LF+F WNQ P+ 
Sbjct: 245 AFAIVSFLVGVTCYFFVPDNVPTNTNNL-----KMDWIGSAVGVVGLLLFSFVWNQAPMD 299

Query: 254 GWETSYTYALLIVGSAFLAAFGFIE-SRAKHPLLPVRKLSSDT--IFVMGCIAAGWSSFG 310
           GW+ +Y   LL++    + AF   E + A+ PLLP + ++ +   I ++  I  GW +FG
Sbjct: 300 GWDKAYIIVLLVISVILIIAFFIYEINYAEVPLLP-KAITGNRHIIMILLAIFMGWGTFG 358

Query: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370
           IW +Y +    NLR   P+ +   +    +SG   A    FL+    PS +++I++  FT
Sbjct: 359 IWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFT 418

Query: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430
           +G+++ A  P  QTYW  TF  ++++P GMD+SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 419 MGNLIFAVTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTM 478

Query: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           +NYS S  LG A T+E QI+   DDLLKGYR
Sbjct: 479 VNYSQSFCLGVATTVEKQINSSGDDLLKGYR 509

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  319 bits (817), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/513 (36%), Positives = 290/513 (56%), Gaps = 22/513 (4%)

Query: 1   MSSKKLNSHEEQDSLL-----LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQ 55
           +S K +++HE+ D LL     LQN   +    KE   ++    +QL+ QA   Q+     
Sbjct: 17  ISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFD 76

Query: 56  IIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAG 115
           ++ +    K   Q +W  ++F L  G+FIL++G++GD +G KK  + G+    +WS++ G
Sbjct: 77  LLSEDLKAK-ASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICG 135

Query: 116 FSVYSNQI-FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRK-QNMIFSLFGACAPSGFV 173
            S Y++ + FF   R+FQG+G AF LPN   I+   Y+P  K +NM+FS+ GACAP G  
Sbjct: 136 LSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGAT 195

Query: 174 VGAVFSSLL-SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAG 232
           +G +FS L+ +E   W W ++   I   L G+  + VIP + P +  +      ++D  G
Sbjct: 196 LGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHK-----FKMDWLG 250

Query: 233 SVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKL 291
           S  GV GLI+FNF WNQ P  GW+++Y   LL++    L  F   E+R AK PLLP   L
Sbjct: 251 SFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVL 310

Query: 292 -SSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTE 350
            +   + ++  +  GW SFGIW YY    + NLR   PL +   +   AI G  AA    
Sbjct: 311 FNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVG 370

Query: 351 FLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATII 410
             + +T P+ +++ ++IAF VG I+++  PV QTY+  +  +++++ +GMD+SFPA++II
Sbjct: 371 HTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSII 430

Query: 411 LSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRXXXXXXXXX 470
           LS  +P+ +QG+A SLVNT+INYS+S+ LG +GT E Q++    DLLKGYR         
Sbjct: 431 LSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGL 490

Query: 471 XXXXXXXXXSYAIFHY--SRLKRS----LSEKY 497
                    +YAI  +   R +RS    L EK+
Sbjct: 491 ASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKH 523

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  318 bits (814), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/481 (37%), Positives = 281/481 (58%), Gaps = 13/481 (2%)

Query: 17  LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAF 76
           +Q+   +++  KE   I     +QL+ QAG  Q++  + I+  +F   +  Q +W  ++F
Sbjct: 41  IQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFD-SSTSQQTWLMASF 99

Query: 77  SLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIG 135
            L  G+FIL++G++GD +G KK  ++G++   +WS++ G + Y++ + FF   RAFQG+G
Sbjct: 100 PLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159

Query: 136 PAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLLSEFA-WWPWAYW 193
            AF LPN + I+   Y  G  ++NM+ SL GACAP G  +G +FS L+   +  W W ++
Sbjct: 160 IAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFY 219

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
              IT  +       VIP+  P +          +D  GS  G++G+ILFNF WNQGP+V
Sbjct: 220 AYTITAAINMGLSIWVIPNTIPTNVRG-----SSMDWIGSGIGLLGMILFNFVWNQGPIV 274

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIFVMGCIAA--GWSSFG 310
           GW+T+Y   LLIV  A + AF   E++ A  PL+P R    +   +M  +A   GW SFG
Sbjct: 275 GWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIP-RPAMHNHRLLMTLLAVFFGWGSFG 333

Query: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370
           IW +Y +  + NLR+  PL +   +    I G+ AA+S  + + R  PS ++ ++M+AF 
Sbjct: 334 IWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFD 393

Query: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430
            G I+++  PV QTY+      +I++ +GMD+SFPA++IILS  +P  +QG+A SLV+T+
Sbjct: 394 CGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTM 453

Query: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYRXXXXXXXXXXXXXXXXXXSYAIFHYSRLK 490
           INYS+S+ LG AGT+E QI+   DDLLKGYR                   + + +Y R++
Sbjct: 454 INYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMR 513

Query: 491 R 491
           R
Sbjct: 514 R 514

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  317 bits (813), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/478 (37%), Positives = 272/478 (56%), Gaps = 24/478 (5%)

Query: 2   SSKKLNSHEEQ-------DSLL-----LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQ 49
           +  K  SH E+       DS+L      QN   ++S  KE F I     A L+ QAG  Q
Sbjct: 23  NEDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQ 82

Query: 50  SIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYAL 109
            +  + +I +SF   + G+ +W  ++F L  G+FILI+GR+GD +G KK  + G+++  +
Sbjct: 83  VLSTMNVISESFH-SDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMII 141

Query: 110 WSILAGFSVYS-NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGAC 167
           WS+L GF+ ++ N  FF  CRAFQG+G +F LPN + +I   Y+ G  ++N++ S+ G  
Sbjct: 142 WSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLT 201

Query: 168 APSGFVVGAVFSSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLV 225
           AP+G  +GA++  L+       WPW ++   +T  +  +     +P+  P +        
Sbjct: 202 APTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFA--- 258

Query: 226 ERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAK-HP 284
             +D  GS+ GVVGLILFNF WNQGPV GW+ +Y   LLI+   FL AF   E +    P
Sbjct: 259 --MDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISP 316

Query: 285 LLPVRKLSSDTIF-VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGL 343
           LLPV    +  I  ++  +  GW +FGIW +Y +    NLRD  P+     +    I G 
Sbjct: 317 LLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGT 376

Query: 344 CAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMS 403
            AA+   F + +  P+ ++  + + FT+GS++++  P+ Q YW       I++ +GMD+S
Sbjct: 377 IAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLS 436

Query: 404 FPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           FPA++IILS  +P  +QG+A SLVNT+INY+ S+ LG   T+E QI+   +DLLKGYR
Sbjct: 437 FPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYR 494

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  317 bits (811), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/450 (38%), Positives = 267/450 (59%), Gaps = 11/450 (2%)

Query: 17  LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAF 76
           LQN   +    KE   ++    +QL+ QA   Q+     ++      K   Q  W  ++F
Sbjct: 38  LQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAK-VSQQPWLMASF 96

Query: 77  SLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIG 135
            L  G+FIL++G++GD +G KK  + G++   +WS++ G S Y++ + FF   R+FQG+G
Sbjct: 97  PLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156

Query: 136 PAFTLPNAIAIIARTYRPGRK-QNMIFSLFGACAPSGFVVGAVFSSLL-SEFAWWPWAYW 193
            AF LPN + I+   Y+P  + +N++FSL GACAP G  +G VFS L+ +    W W ++
Sbjct: 157 IAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFY 216

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
              IT  L G+    +IP++ P + +E      ++D  GS  GV GLILFNF WNQ P+ 
Sbjct: 217 AYAITAALNGLVALWIIPNNIPTNVNEY-----KMDWIGSAIGVFGLILFNFVWNQAPIA 271

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKL-SSDTIFVMGCIAAGWSSFGI 311
           GW ++Y   LLIV    L AF   E R AK PLLP   L +   + ++  +  GW SFGI
Sbjct: 272 GWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGI 331

Query: 312 WVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV 371
           W +Y    M NLR   PL +   +   AI G+ A++   + + +T P+ ++ ++M+AF  
Sbjct: 332 WTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDC 391

Query: 372 GSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTII 431
           G I++A  PV QTY+  T   +I++ +GMD+SFPAA+IILS  +P+ +QG+A SLV+T+I
Sbjct: 392 GCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMI 451

Query: 432 NYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           +YS+S+ LG +GT E Q++    DLLKGY+
Sbjct: 452 SYSMSLCLGISGTAEHQVNKNGIDLLKGYQ 481

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/451 (39%), Positives = 266/451 (58%), Gaps = 14/451 (3%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           Q+   ++S  KE   I     AQL+ QAG   ++  + ++  SFG ++  Q +W  ++F 
Sbjct: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFP 115

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIGP 136
           L  G+FILI+GRLGD +G KK  ++G++   +WSI++G S YSN   FF  CRAFQG+G 
Sbjct: 116 LAAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGI 175

Query: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193
           AF LPN + ++   Y+ G  ++N++ S+ GAC P+G + G VF  L+   +   WPW ++
Sbjct: 176 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
             GI  F+  +  +  IP++ P +          +D  GSV  V+GLILFNF WN+ P+ 
Sbjct: 236 AFGIATFISMLMAWYSIPNNVPTNVHGL-----SMDWTGSVLAVIGLILFNFVWNEAPIA 290

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLP--VRKLSSDTIFVMGCIAAGWSSFG 310
           GW+ +Y   LL+V   FL AF   E + A+ PLLP  V K +   I ++  +  GW SFG
Sbjct: 291 GWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTK-NRHMIMILLAVFVGWGSFG 349

Query: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370
           IW +Y      NLR   P+ +   +   AI G  AA    F + R  P+ ++  A++AF 
Sbjct: 350 IWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFD 409

Query: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430
            GSI+ + +PV Q+YW   F    V+ +GMD+SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 410 AGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 469

Query: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           INYS S+ LG   T+E QI+    ++L+GYR
Sbjct: 470 INYSASLCLGMGATVEHQINKSGKNVLEGYR 500

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/451 (39%), Positives = 263/451 (58%), Gaps = 14/451 (3%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           Q+   ++S  +E   I+    AQL+ QAG   ++  + ++  SF  ++  Q +W  ++F 
Sbjct: 58  QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFP 116

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQ-IFFDCCRAFQGIGP 136
           L  G+FILI+GRLGD +G KK  ++G++   +WS++ G S YSN   FF  CRAFQG+G 
Sbjct: 117 LVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGI 176

Query: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193
           AF LPN + ++   Y+ G  ++N++ S  GACAP+G + G +F  L+   +   WPW ++
Sbjct: 177 AFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFY 236

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
              I  FL  +  +  IP++ P +          +D  GSV  V+GLILFNF WNQ P  
Sbjct: 237 AFAIAFFLNMILAWYSIPNNIPTNVHG-----FSMDWTGSVLAVIGLILFNFVWNQAPTA 291

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLP--VRKLSSDTIFVMGCIAAGWSSFG 310
           GW T+Y  ALLI+   FL AF   E + AK PLLP  V K +   I ++  +  GW SFG
Sbjct: 292 GWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTK-NRHMIMILLAVFLGWGSFG 350

Query: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370
           IW +Y      NLR   P+ +   +    I G  AA      + R  P+ ++  A++AF 
Sbjct: 351 IWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFD 410

Query: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430
           VGSI+ + +PV Q++W   F    ++ +GMD+SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 411 VGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTV 470

Query: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           INYS S+ LG   T+E QI+    DLLKGYR
Sbjct: 471 INYSASLCLGMGATVEHQINKNGKDLLKGYR 501

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  309 bits (792), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 179/451 (39%), Positives = 265/451 (58%), Gaps = 14/451 (3%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           Q+   ++S  KE   I     AQL+ QAG   ++  + ++  SF  +   Q +W  ++F 
Sbjct: 58  QDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ-AWLMASFP 116

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRAFQGIGP 136
           L  G+FILI+GRLGD +G KK  ++G++   +WSI++G S YSN   FF   RAFQG+G 
Sbjct: 117 LAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGI 176

Query: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193
           AF LPN + ++   Y+ G  ++N++ S  GACAP+G + G +F  L+   +   WPW ++
Sbjct: 177 AFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFY 236

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
             GI  FL  +  +  IP++ P +          +D  GS   ++GLILFNF WNQ P+V
Sbjct: 237 AFGIATFLSLLMAWYSIPNNVPTNIHGLS-----MDWTGSALAIIGLILFNFVWNQAPIV 291

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIFVMGCIAA--GWSSFG 310
           GW+  Y   LLI+   FL AF   ES+ A+ PLLP R ++ +   +M  +A   GW SFG
Sbjct: 292 GWDKPYIIVLLIISVIFLVAFFVYESKYAEVPLLP-RAMTKNRHMIMILLAVFLGWGSFG 350

Query: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370
           IW +Y      NLR   P+ +   +    I G  AA    F + R  P+ ++  +++AF 
Sbjct: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFD 410

Query: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430
            GSI+ + +PV Q+YW   F    ++ +GMD+SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470

Query: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           INYS S+ LG  GT+E QI+   +DLLKGYR
Sbjct: 471 INYSASLCLGMGGTVEHQINKSGNDLLKGYR 501

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  308 bits (790), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 176/450 (39%), Positives = 251/450 (55%), Gaps = 12/450 (2%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           QN   + +  +E   I     AQL+ QAG AQ+  P+ I+ D+F      Q +W  ++F 
Sbjct: 63  QNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQ-TWLMASFP 121

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQIFFDCCRAFQGIGP 136
           L  G+FIL++GR+GD +G KK  + G+L   +WS++ GF+ Y+ N  FF  CRAFQG+G 
Sbjct: 122 LVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGI 181

Query: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLLSEF--AWWPWAYW 193
           AF LPN + +I   Y+    ++N + S  G CAP G  +G V+S L++      WPW ++
Sbjct: 182 AFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFY 241

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
              I   +  V     IP   P +          +D  GS  GVVG+ILFNF WNQGP+ 
Sbjct: 242 AYAIVVAINMVMAIYSIPSTVPTNIHGF-----GMDWTGSAIGVVGMILFNFVWNQGPID 296

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTI-FVMGCIAAGWSSFGI 311
           GW   Y  ALLIV    L AF   E + AK PLLP   + +  I  ++  +  GW SFGI
Sbjct: 297 GWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGI 356

Query: 312 WVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV 371
           W +Y +    NLR    + +   F    I G  AA      + R  PS ++  +M  FTV
Sbjct: 357 WTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTV 416

Query: 372 GSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTII 431
           G I+++  PV Q+YW       I++ +GMD+SFPA++IILS  +P+ +QG+A SLVNT++
Sbjct: 417 GCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMV 476

Query: 432 NYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           NYS S+ LG   T E+Q++    D LKGYR
Sbjct: 477 NYSTSLCLGVGSTAEAQVNKNGTDKLKGYR 506

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  308 bits (789), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 255/416 (61%), Gaps = 4/416 (0%)

Query: 25  SLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFI 84
           SLL E   ++++ S+Q++  AG  Q I  + +I + F + +P    W    ++ T G+F+
Sbjct: 74  SLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFV 133

Query: 85  LIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQIFFDCCRAFQGIGPAFTLPNA 143
           LIAG++GD  GHK  F++G+ W ALWS+L GFS Y  +  FF  CRA QGIG AFT  +A
Sbjct: 134 LIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSA 193

Query: 144 IAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLG 203
           ++I+ ++Y P +++N IFS FGAC   G V+G VFS+L ++ A W WAYW M I C ++ 
Sbjct: 194 LSILGKSYPPCKRKNFIFSFFGACGSFGVVLGMVFSALFTQLAHWSWAYWSMAIACVVII 253

Query: 204 VAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYAL 263
           +     IP    +    + S V   D  G+   V GL+LF+ AWNQ P  G+  +Y Y L
Sbjct: 254 ILSIFFIPGD--VVEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVL 311

Query: 264 LIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIAAGWSSFGIWVYYTWQLMANL 323
           LIV    LA   ++E++   PLLP   +S++T+ V+  I   ++SF +W  YT++     
Sbjct: 312 LIVSVVILALAMYVETKVDDPLLPWTHISANTLKVLLAIFFAYASFTMWAAYTFRFNLMA 371

Query: 324 RDQPPLLSSAQFVPVAISGLCAAMSTEFLLT-RTSPSTVMIIAMIAFTVGSILVATVPVS 382
           +    LL++A+  P+A+SG+ AA+ +  LL         M+I+++AF V  IL+AT+   
Sbjct: 372 KGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAG 431

Query: 383 QTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIG 438
           QTYW + FV+ IV+ +G+D+SFP+AT++LS  +P   +GL ASLV  ++NY+ ++G
Sbjct: 432 QTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALG 487

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  306 bits (785), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 178/468 (38%), Positives = 271/468 (57%), Gaps = 14/468 (2%)

Query: 2   SSKKLNSHEE--QDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGD 59
           S KK  S +   ++S   QN + + S LKE F I     A L+ QAG  Q +  + +I +
Sbjct: 11  SQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISE 70

Query: 60  SFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVY 119
           SF   + G  +W  ++F L  G+FILI+GR+GD +G KK  + G+++  +W++L GF+ Y
Sbjct: 71  SFH-SDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADY 129

Query: 120 SN-QIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAV 177
           ++   FF  CRAFQG+G +F LPN + ++   Y+ G  ++N++ SL G  AP+G  +GA+
Sbjct: 130 THSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGAL 189

Query: 178 FSSLLSEFA--WWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVT 235
           +  L++  +   WPW ++   +  F+  +     +P + P +          +D  G++ 
Sbjct: 190 WGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFA-----MDWMGAII 244

Query: 236 GVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAK-HPLLPVRKLSSD 294
           GVVGLILFNF WNQGPV GW   Y   LLI+   FL AF   E +    PLLP     + 
Sbjct: 245 GVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNG 304

Query: 295 TIF-VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLL 353
            I  ++G +  GW SFGIW +Y +    NLR+  PL + A      I G  AA    F +
Sbjct: 305 QILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTI 364

Query: 354 TRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILST 413
            R  P+ ++  + + FT+GS++++  P+ QTYW       I++ +GMD+SFPA++IILS 
Sbjct: 365 NRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSD 424

Query: 414 AMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
            +P  +QG+A SLVNTIINYS S+ LG   T+E QI+   ++LL+GYR
Sbjct: 425 HLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  306 bits (784), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 172/462 (37%), Positives = 270/462 (58%), Gaps = 14/462 (3%)

Query: 7   NSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNP 66
           ++ +  +S   QN   + +  +E   I      QL++QAGL Q++  + ++       + 
Sbjct: 52  DTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSS 111

Query: 67  GQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQIFF 125
            Q +W  S+F L +G+FIL++GRLGD +G KK  + G++   +WSI+ G S Y+ N  FF
Sbjct: 112 RQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFF 170

Query: 126 DCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLLSE 184
              RAFQG+G AF LPN I +I   YRPG  ++NMI S+ GA +P+G  +G +F+ L  +
Sbjct: 171 ITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVK 230

Query: 185 F--AWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLIL 242
           +  + WPW+++  G+  F+  +  +  IP+  P +         ++D  GSV GV GLI+
Sbjct: 231 YDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGL-----KMDWLGSVLGVFGLII 285

Query: 243 FNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDT--IFVM 299
            NF +NQ P+VGW+++Y   LL++    L  F   E + AK PL+P + +SS+   + ++
Sbjct: 286 LNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMIL 344

Query: 300 GCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPS 359
             +  GW SFGIW +Y +    NLR   PL + + +    ISG   A+     + +  PS
Sbjct: 345 FSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPS 404

Query: 360 TVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASH 419
            +   +M+ F  G+I+ A  PV+QT++      + ++P GMD SFPA++IILS ++P  +
Sbjct: 405 VLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQY 464

Query: 420 QGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           QG+A SLVNT+INYS SI LG AGT+E + +    DLL GYR
Sbjct: 465 QGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYR 506

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  305 bits (782), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 176/465 (37%), Positives = 260/465 (55%), Gaps = 18/465 (3%)

Query: 7   NSHEE--QDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIK 64
           NS +E  +     QN   +    +E   I     +QL+ Q+G  Q++  + I+ DSFG  
Sbjct: 55  NSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFG-S 113

Query: 65  NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQI 123
           +    SW  ++F L  G+FILI+GR+GD FG K   ++G++   +WS++ G + YS +  
Sbjct: 114 DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDT 173

Query: 124 FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL 182
           FF   RAFQG+G AF LPN + II   Y  G  ++N++ S  GA AP G  +G  F+ L+
Sbjct: 174 FFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLI 233

Query: 183 SEFA--WWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVER--IDVAGSVTGVV 238
                  WPWA++   IT  +  +     IP++ P +       V R  +D  GS  GV+
Sbjct: 234 GTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTN-------VHRFSMDWIGSGLGVI 286

Query: 239 GLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSS-DTI 296
           GL+L N  WNQ P+ GW  +Y   LLI+   FL  FG  E   AK PLLP   +     I
Sbjct: 287 GLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMI 346

Query: 297 FVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRT 356
            +M  +  GW SFGI+ +Y +Q   N+R   PL +   +    I G+ AA+   F + R 
Sbjct: 347 QIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRV 406

Query: 357 SPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMP 416
           SPS  +  AM+AF VGSI+ +  PV +TY+     ++I++ +GMD+SFPA++II S  +P
Sbjct: 407 SPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLP 466

Query: 417 ASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
             +QG+A SLVNT++NYS+S+ LG   T+E Q+      +LKGYR
Sbjct: 467 MEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYR 511

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  305 bits (781), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 177/472 (37%), Positives = 274/472 (58%), Gaps = 17/472 (3%)

Query: 1   MSSKKLNSHEEQDSLL-----LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQ 55
           +S  +L S E++D+ +      QN   + +  +E   I     +QL+ QA   Q++  + 
Sbjct: 42  VSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMN 101

Query: 56  IIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAG 115
           II DSF     G+ +W  ++F L  G+FILI+GR+GD +G KK  + G+L++ +WS+++G
Sbjct: 102 IITDSFK-SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISG 160

Query: 116 FSVYS-NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPG-RKQNMIFSLFGACAPSGFV 173
           F+ YS N IFF   RAFQG+G AF LPN + I+   Y+P  +++N++ S+ GA AP G  
Sbjct: 161 FTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAF 220

Query: 174 VGAVFSSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVA 231
           +G++F+ L+       WPWA++   I   +        IP++ P +          +D  
Sbjct: 221 MGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFA-----MDWI 275

Query: 232 GSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVR- 289
           GS+  V+GLIL NF WNQGP+VGW+ +Y   LLI+    L  F   E + AK P+LPV  
Sbjct: 276 GSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAKSPILPVEV 335

Query: 290 KLSSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMST 349
             +   I ++  +  GW SFGI+ +Y +  + NLR    L +   +   AI G  AA+  
Sbjct: 336 TKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIV 395

Query: 350 EFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATI 409
              + R S S ++  +MIAF +G I+++  PV QTY+     ++I++ +GMDMSFPAA I
Sbjct: 396 GAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAI 455

Query: 410 ILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           ILS  +   +QG+A SL NT++NYS+S+ LG   T+E QI+    ++LKGYR
Sbjct: 456 ILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYR 507

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  304 bits (778), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 172/464 (37%), Positives = 261/464 (56%), Gaps = 17/464 (3%)

Query: 8   SHEEQ---DSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIK 64
            H E+   D    QN   + +   E   I     +QL+ QAG  Q++  + II +SFG  
Sbjct: 45  DHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFG-S 103

Query: 65  NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQI 123
           N    +W  ++F L  G+FILI+GRLGD +G KK   +G++   +WS++ G + YS +  
Sbjct: 104 NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDT 163

Query: 124 FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL 182
           FF   RAFQG+G AF LPN + II   Y  G  ++N++ SL GA AP G  +G +F+ L+
Sbjct: 164 FFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLI 223

Query: 183 --SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGL 240
                  WPWA++   IT  +        IP++ P +          +D  GS  GV+GL
Sbjct: 224 GTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFS-----MDWIGSALGVIGL 278

Query: 241 ILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDT--IF 297
           +L NF WNQ P+ GW+ +Y   LL++   FL  F   E+R AK PLLP R +  D   I 
Sbjct: 279 VLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKSPLLP-RAVLKDRHMIQ 337

Query: 298 VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTS 357
           +M  +  GW SFGI+ +Y +Q   N+R    + +   +    I G+ AA+     + + S
Sbjct: 338 IMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVS 397

Query: 358 PSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPA 417
           PS  + ++M+AF +GSI+ +  PV +TY+     ++I++ +GMD SFPA++II S  +P 
Sbjct: 398 PSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPM 457

Query: 418 SHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
            +QG+A SLVNT++NYS+S+ LG   T+E+ +      +LKGYR
Sbjct: 458 EYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYR 501

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  303 bits (777), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/471 (38%), Positives = 275/471 (58%), Gaps = 19/471 (4%)

Query: 1   MSSKKLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCS---AQLMTQAGLAQSIVPLQII 57
           +  K+ ++     +   QN   + S LKE    + LCS   +QL+ QAG  Q+   + I+
Sbjct: 34  VDEKQCDTQAIDGNQKWQNPEYFDSTLKE---YLFLCSCFVSQLLNQAGAIQTQPIMNIV 90

Query: 58  GDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFS 117
            DS   +N G+ +W  +AF L  G+FILI+GR+GD +G KK  ++G+L+  +WS++ G +
Sbjct: 91  ADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149

Query: 118 VYSN-QIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPG-RKQNMIFSLFGACAPSGFVVG 175
            Y++   FF   RAFQG+G +  LPN + I+   Y  G +++NM+ SL G  AP G  +G
Sbjct: 150 KYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLG 209

Query: 176 AVFSSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGS 233
           AVFS L+   +   WPWA++   IT  +  V    +IP+  P +         ++D  GS
Sbjct: 210 AVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHG-----HKMDWIGS 264

Query: 234 VTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR--AKHPLLPVRKL 291
             GVVGLI+ NF WNQ P+ GW+++Y   LLI+    L AF   E      +PLLP   L
Sbjct: 265 GLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVL 324

Query: 292 SS-DTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTE 350
            S  TI V+  +  GW SFGI+ +Y +    NLR   PL +   +    I G+ AA+   
Sbjct: 325 KSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVG 384

Query: 351 FLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATII 410
           F + +  PS ++ ++M+AF  GSI+++  P+ QTY+      +I++ +GMD+SFPA++I+
Sbjct: 385 FTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSIL 444

Query: 411 LSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           LS  +P  +QG+A SLVNT++NYS+S  LG AG +E  +++   D+LKGYR
Sbjct: 445 LSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYR 495

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  303 bits (777), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 176/451 (39%), Positives = 259/451 (57%), Gaps = 14/451 (3%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           QN   +    +E   I     +QL+ QAG  Q++  + I+ DSFG +   + SW  ++F 
Sbjct: 57  QNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFP 115

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQIFFDCCRAFQGIGP 136
           L  G+FILI+GRLGD +G KK  ++G++   +WS++ G + YS +  FF   RAFQG+G 
Sbjct: 116 LVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGI 175

Query: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193
           AF LPN + II   Y  G  ++N++ S  GA AP G  +G +F+ L+   +   WPWA++
Sbjct: 176 AFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFY 235

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
              I  F+  V     IP   P +          +D  GSV GV+GLIL NF WNQ P+ 
Sbjct: 236 AYSIAAFINFVLSIYAIPSTIPTNIHHFS-----MDWIGSVLGVIGLILLNFVWNQAPIS 290

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDT--IFVMGCIAAGWSSFG 310
           GW  +Y   +LI+   FL  F   E R AK PLLP R +  D   I +M  +  GW SFG
Sbjct: 291 GWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLLP-RAVIKDRHMIQIMLALFFGWGSFG 349

Query: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370
           I+ +Y +Q   N+R    L +   +    I G+ AA+   F +   SPS  +  +M+AF 
Sbjct: 350 IFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFN 409

Query: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430
           VGSI+ +  PV +TY+     ++I++ +GMD+SFPA++II S  +P  +QG+A SLVNT+
Sbjct: 410 VGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTV 469

Query: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           +NYS+S+ LG   T+E+Q++     LLKGYR
Sbjct: 470 VNYSMSLCLGMGATVETQVNSDGKHLLKGYR 500

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  300 bits (767), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 175/451 (38%), Positives = 261/451 (57%), Gaps = 14/451 (3%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           QN + +    +E   I     +QL+ QAG  Q++  + I+ DSFG +   + SW  ++F 
Sbjct: 60  QNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFP 118

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQIFFDCCRAFQGIGP 136
           L  G+FILI+GRLGD +G KK  ++G++   +WS++ G + YS +  FF  CRAFQG+G 
Sbjct: 119 LVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGI 178

Query: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193
           AF LPN + II   Y  G  ++N++ S  GA AP G  +G +F+ L+       WPWA++
Sbjct: 179 AFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFY 238

Query: 194 IMGITCFL-LGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPV 252
              I   +  G++ Y  IP++ P +          +D  GSV GV+GLIL NF WNQ P+
Sbjct: 239 AFSIASLINFGLSIY-AIPNNIPTNIHHF-----SMDWIGSVLGVIGLILLNFVWNQAPI 292

Query: 253 VGWETSYTYALLIVGSAFLAAFGFIES-RAKHPLLPVRKLSS-DTIFVMGCIAAGWSSFG 310
            GW  +Y   +LI+   FLA F   E   AK PLLP   +     I +M  +  GW SFG
Sbjct: 293 SGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFG 352

Query: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370
           I+ +Y +Q   N+R    L +   +    I G+ AA+   F +   SPS  +  +M+AF 
Sbjct: 353 IFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFN 412

Query: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430
           VGSI+ +  PV +TY+     ++I++ +GMD+SFPA++II S  +P  +QG+A SLVNT+
Sbjct: 413 VGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTV 472

Query: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           +NYS+S+ LG   T+E+Q+      LLKGYR
Sbjct: 473 VNYSMSLCLGMGATVETQLDPDGKHLLKGYR 503

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  297 bits (760), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 176/457 (38%), Positives = 263/457 (57%), Gaps = 20/457 (4%)

Query: 12  QDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSW 71
           QD+   QN   W   +  G  +M    +QL+ QA + Q++  + I+  SF   N    +W
Sbjct: 57  QDTTYFQN--RWQEYIFVGTCMM----SQLLNQACIPQTLSLMNILTKSFH-SNAKNQTW 109

Query: 72  FASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRA 130
             ++F L  G+FILI+GR+GD +G K   V G +++ +W++++GF+ Y++   FF   R+
Sbjct: 110 LMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRS 169

Query: 131 FQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAW 187
           FQG+G AF LPN +  +   Y+P   ++N++ SL GACAP G  +GA F+ L+       
Sbjct: 170 FQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDD 229

Query: 188 WPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAW 247
           WPW+++ M I   L  +     IP+H P +          +D  GS   VVGLIL NF W
Sbjct: 230 WPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGF-----SMDWIGSGLAVVGLILLNFVW 284

Query: 248 NQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIFVMGCIAA-- 304
           NQGP+ GW  +Y   LLIV    L  F   E   A  PLLP R ++ +   VM  +A   
Sbjct: 285 NQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLP-RVITQNRHMVMILMALFL 343

Query: 305 GWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMII 364
           GW SFGI+ +Y +  + NLR    + +   +   AI G+ A++     + + S S ++  
Sbjct: 344 GWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFF 403

Query: 365 AMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAA 424
           +MIAF VG I+++  PV QTY+     ++I++ +GMDMSFPAA IILS ++P  +QG+A 
Sbjct: 404 SMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAG 463

Query: 425 SLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           SL NT++NYS+S+ LG   T+ESQI+    DLLKGYR
Sbjct: 464 SLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYR 500

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  296 bits (759), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 176/451 (39%), Positives = 269/451 (59%), Gaps = 14/451 (3%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           QN   + +  +E   I     +QL+ QA   Q++  + II DSF     G+ +W  ++F 
Sbjct: 57  QNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFN-SEGGKETWLIASFP 115

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRAFQGIGP 136
           L  G+FILI+GR+GD +G KK  V G++++ +WSI++G + YS+   FF   RAFQG+  
Sbjct: 116 LVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSI 175

Query: 137 AFTLPNAIAIIARTYRP-GRKQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193
           AF LPN + I+   Y+P   ++N++ S+ GA AP G   G++F+ L+   +   WPWA++
Sbjct: 176 AFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFY 235

Query: 194 IMGI-TCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPV 252
              I + F L ++ Y  IP+  P +          +D  GSV  V+GLIL NF WNQGP+
Sbjct: 236 AFAIASAFNLAISIY-SIPNSVPTNVHGFA-----MDWIGSVLAVIGLILLNFVWNQGPI 289

Query: 253 VGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVR-KLSSDTIFVMGCIAAGWSSFG 310
           VGW+T+Y  ALL+V   FLA F   E + A+ PLLPV    +   I ++  +  GW SFG
Sbjct: 290 VGWQTAYIIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFG 349

Query: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370
           I+ +Y +  + NLR    L +   +   AI G  AA+     + + S + ++ ++M+AF 
Sbjct: 350 IFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFN 409

Query: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430
           +G I+++  PV QTY+     ++I++ +GMDMSFPAA IILS  +   +QG+A SL NT+
Sbjct: 410 IGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTM 469

Query: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           +NYS+S+ LG   T+E QI+   +DLLKGYR
Sbjct: 470 VNYSMSLCLGMGTTVERQINKSGNDLLKGYR 500

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  295 bits (756), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 163/439 (37%), Positives = 256/439 (58%), Gaps = 6/439 (1%)

Query: 27  LKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIK--NPGQLSWFASAFSLTVGTFI 84
           ++E F +++L S+QL+T  G  Q +     + + + I+    G + W  +++ L     +
Sbjct: 36  IREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMV 95

Query: 85  LIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS--NQIFFDCCRAFQGIGPAFTLPN 142
           LIAG+LGD  GHK+  V G++W  +WS++ GFS Y   NQ F+   RA QGIG  F +PN
Sbjct: 96  LIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPN 155

Query: 143 AIAIIARTY-RPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFL 201
           ++AI+ RTY  PG K+ +IFS+FG    +GFV+G  FSSL ++   W W YW +   C L
Sbjct: 156 SLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLTKWAWNYWALACVCVL 215

Query: 202 LGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTY 261
             V   L IP    +H      L +R D  G++TGV GL+LF+ A+ Q   +GW   +TY
Sbjct: 216 YTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSPPHTY 275

Query: 262 ALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIAAGWSSFGIWVYYTWQLMA 321
             LI+G   +    F++ R   PL+P++ L +D + ++ C+  G+ SF IW  + WQ   
Sbjct: 276 ITLIIGVILILIAMFVDWRVDDPLVPLQHLRADVVVILICVYFGFLSFVIWANWFWQFYE 335

Query: 322 NLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLT-RTSPSTVMIIAMIAFTVGSILVATVP 380
            + +  PL  +A+ VP+AI  + AA+ T   L       T+M+I+M+ F V +IL+ATV 
Sbjct: 336 LVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPNILMATVT 395

Query: 381 VSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLG 440
            + TYWAQ FVS I+ P+ +D++ P AT++ S ++    QG+AASL+ T+I+Y+ISIG  
Sbjct: 396 PNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISYAISIGPS 455

Query: 441 FAGTIESQISDGEDDLLKG 459
           +   +   ++   +D   G
Sbjct: 456 YTAMVMWYVAPLGNDSTPG 474

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  296 bits (757), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 177/451 (39%), Positives = 262/451 (58%), Gaps = 14/451 (3%)

Query: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77
           Q+   ++S  KE   I     AQL+ QAG   ++  + ++  SF  ++  Q +W  ++F 
Sbjct: 58  QDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFP 116

Query: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRAFQGIGP 136
           L  G+FILI+GRLGD +G KK  ++G++   +WSI++G S YSN   FF  CRAFQG+G 
Sbjct: 117 LAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGI 176

Query: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193
           AF LPN + ++   Y+ G  ++N++ S+ GACAP+G + G VF  L+   +   WPW ++
Sbjct: 177 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFY 236

Query: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253
              I  F+  +  +  IP++ P +          +D  GS   V+GLILFNF WNQ P+ 
Sbjct: 237 AFSIATFISLLMAWYSIPNNVPTNVHGL-----SMDWTGSTLAVLGLILFNFVWNQAPIA 291

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLP--VRKLSSDTIFVMGCIAAGWSSFG 310
           GW  +Y   LLI+   FL AF   E + A+ PLLP  V K +   I ++  +  GW SFG
Sbjct: 292 GWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTK-NRHMIMILLAVFLGWGSFG 350

Query: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370
           IW +Y      NLR   P+ +   +    I G  AA    F + R  P+ ++  A++AF 
Sbjct: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFD 410

Query: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430
            GSI+ + +PV Q+YW   F    ++ +GMD+SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470

Query: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           INYS S+ LG   T+E QI+    +LLKGYR
Sbjct: 471 INYSASLCLGMGVTVERQINKSGQNLLKGYR 501

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  295 bits (754), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 161/467 (34%), Positives = 268/467 (57%), Gaps = 14/467 (2%)

Query: 2   SSKKLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSF 61
           +   +NS   Q    + + + + +   E   I+    +Q M+QAGL Q++  + I+ +  
Sbjct: 71  NDSDINSENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEEL 130

Query: 62  GIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS- 120
             +   Q +W  ++F+L++G+FIL++GRLGD +G KK  + G+    +WS++ GFS YS 
Sbjct: 131 NAEKSRQ-AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSH 189

Query: 121 NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFS 179
           N  FF   RAFQG+G AF LPN++ +I   Y PG  K+NMI    GA +P G  +G +F+
Sbjct: 190 NDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFA 249

Query: 180 SLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGV 237
            ++   +   WPW+++  GI  F   +  +  IP++ P +          +D  G++ G+
Sbjct: 250 GIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNL-----SMDWIGAILGI 304

Query: 238 VGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDT- 295
            GL++ NF +NQ P+VGW+++Y   LL++    L  F   E + AK PL+P + +SS+  
Sbjct: 305 FGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRG 363

Query: 296 -IFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLT 354
            + ++  +  GW +FG W +Y +  + N+R      +   +    +SG   A    F++ 
Sbjct: 364 MLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMK 423

Query: 355 RTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTA 414
           +  PS ++ I+MI F  G +++   P+ Q+Y+      + V+P G+D+SFPAA+IILS A
Sbjct: 424 KVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDA 483

Query: 415 MPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           +P  +QG+A SLV TI NYS SI LG AG++E+  +D   ++LKGYR
Sbjct: 484 LPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYR 530

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  292 bits (748), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/473 (35%), Positives = 270/473 (57%), Gaps = 22/473 (4%)

Query: 1   MSSKKLNSHE---------EQDSLLLQNSREWTSL-LKEGFAIMVLCSAQLMTQAGLAQS 50
           ++S KL  HE           + +L +      ++  KE   ++++ S Q ++  G  Q 
Sbjct: 10  LTSSKLQPHEPTSPVKVVPSHNEILSKTDEHPLNMQFKEIIIVLLISSGQFISLLGAVQG 69

Query: 51  IVPLQIIGDSFGIKNPGQ---LSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWY 107
           I  +  I  +F ++ P Q   L W  +A++ T  TF++IAG+LGD  GHK  F+ G+ W 
Sbjct: 70  IPQMASIASTFSLR-PDQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFGYAWL 128

Query: 108 ALWSILAGFSVYS--NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFG 165
            LWS+L GFS Y+  N +FF  CR  QGIG AF  P  +A++ + Y P +++N +FS +G
Sbjct: 129 TLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPPCKRKNYVFSFYG 188

Query: 166 ACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLV 225
           AC P G V G+VFS+L ++   W W YW M +TC ++ +  Y+ IP      P  + S  
Sbjct: 189 ACGPFGIVAGSVFSALFTQLTTWAWTYWSMAVTCLIITILSYIFIPKDNT--PKRERSAF 246

Query: 226 ERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPL 285
              D  G   G+ G+ILF+  WNQ P+  ++  Y Y+LLIV   F+     I+SR K PL
Sbjct: 247 YSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSRVKDPL 306

Query: 286 LPVRKLSSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCA 345
           +P + + S+ I  +  +  G+  F IW++Y+W+     ++   LL++A+F+P+ ISG+ A
Sbjct: 307 IPWKSMCSNVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPLGISGIFA 366

Query: 346 AMSTEFLLTRTSPSTV-MIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSF 404
           A  +  LL +  P  + ++ A+ AF + +IL++T+ + +TYW   FV+ +++  G+D++F
Sbjct: 367 ACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIAIGLDVAF 426

Query: 405 PAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLL 457
           P+AT++LS  +    QGLAA+L  T +NY  ++G G A  I   I+   DD L
Sbjct: 427 PSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLI---ITYQCDDCL 476

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  291 bits (745), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 159/429 (37%), Positives = 241/429 (56%), Gaps = 12/429 (2%)

Query: 39  AQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKK 98
           A L+ QAG  Q++  + ++ DS       + +W  ++F+L  G+FIL++GR+GD +G K 
Sbjct: 83  ANLLNQAGQTQTLSTMNVLADSLNSDGAAK-TWLMASFTLASGSFILVSGRIGDIYGLKA 141

Query: 99  FFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-K 156
            F+ G + + +WSIL G S Y+  + FF  CRAFQG+G AF LPN + ++   Y  G  +
Sbjct: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR 201

Query: 157 QNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHP 214
           +N++ S  G  AP G   G ++  L+  S    WPW ++   I  F+  + G   IP+H 
Sbjct: 202 KNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHV 261

Query: 215 PIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAF 274
           P +         ++D  GS+ GV+GLIL NF WNQ P+ GW  +Y   +LIV   FL AF
Sbjct: 262 PTNIYNL-----KMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAF 316

Query: 275 GFIE-SRAKHPLLPVRKLSSDTIF-VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSS 332
              E  +A+ PLLP     +  I  ++  +  GW +FGIW +Y +    NLR   PL + 
Sbjct: 317 FIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAG 376

Query: 333 AQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVS 392
           +      I G   A++  F + +  PS +  ++ I FT G+I+ +     QTYW  +   
Sbjct: 377 STHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGM 436

Query: 393 IIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDG 452
            I++  GMD+SFP ++IILS  +P  +QG++ SLVNTI NY+ S+ LG   T E Q ++G
Sbjct: 437 QIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNG 496

Query: 453 EDDLLKGYR 461
             D+LKGYR
Sbjct: 497 GKDVLKGYR 505

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  273 bits (699), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 175/462 (37%), Positives = 257/462 (55%), Gaps = 13/462 (2%)

Query: 6   LNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKN 65
           ++   E DS   QN   + +  KE   I+    AQL+ QAG  QS+  + ++ D F   N
Sbjct: 63  VDDCHENDSPF-QNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFK-SN 120

Query: 66  PGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIF 124
             +  W  ++F L  G+FILI+GRLGD +G KK   +G++   LWSI+ G + Y+N   F
Sbjct: 121 SSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAF 180

Query: 125 FDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL- 182
           F  CR+FQG+G AF LPN + ++   Y+ G  ++N++ S  G  AP+G  +GA+F  L+ 
Sbjct: 181 FIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIV 240

Query: 183 -SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLI 241
             +   WPW ++  GI  F+  +     IP++ P + +        +D  GS+ GV GL+
Sbjct: 241 TEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNL-----NMDWIGSLLGVSGLL 295

Query: 242 LFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIF-VM 299
           L N  WNQ P+VGW  +Y   LLI+    L  F   E + A  PLLP   L +  I  ++
Sbjct: 296 LLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMIL 355

Query: 300 GCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPS 359
             +  GW SFGIW YY +    NLR   PL +        I G  AA      + +  P+
Sbjct: 356 AALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPA 415

Query: 360 TVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASH 419
            ++  +M+AF  GSI+++  PV QTYW       I++ +GMD+SFPA++IILS  +P  +
Sbjct: 416 VLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQY 475

Query: 420 QGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           QG+A SLVNT++NYS S+ LG   T+E Q +    DLLKGYR
Sbjct: 476 QGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYR 517

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  270 bits (691), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 163/468 (34%), Positives = 261/468 (55%), Gaps = 20/468 (4%)

Query: 7   NSHEEQDSLLLQNSREW------TSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDS 60
            S  E+  ++++   +W       +  +E   +    + QL+ QA   Q++  + ++ DS
Sbjct: 21  KSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDS 80

Query: 61  FGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS 120
           F      Q +W  ++F L  G+FILI+GR+GD +G KK  + G+++  +WS++ GF+ YS
Sbjct: 81  FNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYS 139

Query: 121 -NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVF 178
            +  F    RAFQG+G AFTLPN +  I   Y  G  ++NM+ SL  A AP G  +G  F
Sbjct: 140 KSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAF 199

Query: 179 SSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTG 236
           + L+     + WPW+++   I C    +     IP + P + +       ++D  GS   
Sbjct: 200 AGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNG-----FKMDWIGSALI 254

Query: 237 VVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIE-SRAKHPLLPVRKL--SS 293
           V GLILFNFAWNQGP+VGW+ +Y   LLI+   F+ AF   E + A  PL+  R++  S 
Sbjct: 255 VTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLI-AREITHSR 313

Query: 294 DTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLL 353
           + I  +  +  GW S+GIW +Y +  + NLR   P+ +   +    I G+ A+      +
Sbjct: 314 NMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISI 373

Query: 354 TRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILST 413
            + +   +++ +M+ F VG+ L++  PV Q+Y+  T   + ++  G+D SFPAATIILS 
Sbjct: 374 KKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSD 433

Query: 414 AMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
            +P  +QG+A SL  T++NYS+S+ LG   T+E QI+    D+LKGYR
Sbjct: 434 GLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYR 481

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  247 bits (631), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 153/452 (33%), Positives = 246/452 (54%), Gaps = 11/452 (2%)

Query: 5   KLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIK 64
            L   + QD L   N     S L+E   I+++ S+Q ++ A  +Q+I+ +  I   F + 
Sbjct: 47  NLQPAQAQDQLESMNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDAITAWFQLP 106

Query: 65  NPGQLS--WFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQ 122
               L   W  +AF++T GTFI+ AG+L D  G K  F+ G+ WY LWS+L G S Y+ +
Sbjct: 107 ADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPK 166

Query: 123 ---IFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFS 179
               FF   R  QGIG A   P+++A++ + Y P  K+N++FSL+G C P G VVG VFS
Sbjct: 167 GQATFFFFGRGCQGIGAAALFPSSLALLGKYYPPSCKKNIVFSLYGFCVPLGVVVGGVFS 226

Query: 180 SLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSL-----VERIDVAGSV 234
           ++ ++ A W W YW M I      +     IP    I  +E+        + + D  G+ 
Sbjct: 227 AIFTQLAHWSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTF 286

Query: 235 TGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSD 294
             V  L+LF   WNQ     +++   Y  LIV      A   +E     P++P RK+   
Sbjct: 287 LYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEFYVDDPIIPARKIHPQ 346

Query: 295 TIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLT 354
           TI  +  +   + SF IW++Y W+    +R+   LL +A+FVP++I+G  AA+ +  L++
Sbjct: 347 TIKALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLIS 406

Query: 355 RTSPSTVMIIA-MIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILST 413
              P  + ++A   +F +  IL  T+  +++YWA+ F++II++  G+D+SFP+AT++LS 
Sbjct: 407 TAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSN 466

Query: 414 AMPASHQGLAASLVNTIINYSISIGLGFAGTI 445
            +P   +G++A+LV T +NY   IG   A TI
Sbjct: 467 GVPQELRGISAALVGTALNYGTGIGPPIAQTI 498

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  244 bits (624), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 152/519 (29%), Positives = 262/519 (50%), Gaps = 66/519 (12%)

Query: 7   NSHEEQDSLLLQNSR---EWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGI 63
            SH+   S L++  +      S L +   I ++CS+Q +T A  +Q+I+ +  +   F I
Sbjct: 46  QSHKVTHSSLIRLQKLQSPTNSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKI 105

Query: 64  KNPG--QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVY-- 119
                 QL W  ++F++T G FI++AG+L D    +  F+ G++W++LW+++ GF+ Y  
Sbjct: 106 PPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVP 165

Query: 120 SNQIFFDCCRAFQGIGPAFTLPNAIAIIARTY--------------------RPGRK--- 156
            N IF   CR  QGIG A   P+A+ ++ + Y                     P      
Sbjct: 166 KNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEK 225

Query: 157 ------------------------QNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAY 192
                                   +++ FSL+GACAP G V+G +FS++ ++ A WPW Y
Sbjct: 226 NLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIFTQLATWPWNY 285

Query: 193 WIMGITCFLLGVAGYLVIPHHPPIHP-DEKCSLVER---IDVAGSVTGVVGLILFNFAWN 248
           W M I   LL +  Y  +    P+   D   + ++     D  G + G+  LILF  +W+
Sbjct: 286 WSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWD 345

Query: 249 QGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIAAGWSS 308
           Q  +  ++T + Y  L+       A    E    +P++P+R++   TI  +  +   + S
Sbjct: 346 QATMYKFKTIHVYLTLLFSLVSFIAMIIWEYYFNNPIIPIRQIHPGTIKALLVVFFSYIS 405

Query: 309 FGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIA-MI 367
           F  W++YTW+L   ++D  P+L S +F+P++++G+ +A  +  L+ +  P  + ++A   
Sbjct: 406 FTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGAS 465

Query: 368 AFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLV 427
           +F +  IL+ T  +  +YW   F SII +  G+D+SFP+AT++L+  +P   QG+ A+LV
Sbjct: 466 SFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALV 525

Query: 428 NTIINYSISIGLGFAGTI-----ESQISDGEDD--LLKG 459
            +++NY  +IG   A TI     ES +SD  D    LKG
Sbjct: 526 GSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKG 564

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  243 bits (621), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 150/454 (33%), Positives = 242/454 (53%), Gaps = 17/454 (3%)

Query: 18  QNSRE---WTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFAS 74
           QN R    + +  +E   ++V    Q ++Q GL Q +  + I+ +        Q  W  +
Sbjct: 108 QNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQ-PWLMA 166

Query: 75  AFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRAFQG 133
           AF L +G  ILI+GRLGD FG KK  ++G++   +W+++ GFS Y++    F   R FQG
Sbjct: 167 AFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQG 226

Query: 134 IGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLLSEF--AWWPW 190
           +G A  LPN   +I   Y+P   K+NMIF + GA +P G  +G +F+ L  ++    WPW
Sbjct: 227 LGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPW 286

Query: 191 AYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQG 250
           +++   I  FL G+  +  IP+    +P        ++D  GS  G+ GL++ NF +NQ 
Sbjct: 287 SFYSFAIVAFLNGIIAWFCIPNDIEKNPQGL-----KMDWIGSALGLFGLVVLNFVFNQT 341

Query: 251 PVVGWETSYTYALLIVGSAFLAAFGFIE-SRAKHPLLPVRKLSSD--TIFVMGCIAAGWS 307
           P+ GW ++Y   LL+V    L  F   E + A  PL+P + + S+   I ++  +  GW 
Sbjct: 342 PIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIP-KGIHSNYRLILILLTLFCGWG 400

Query: 308 SFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMI 367
            F IW +Y +    NLR   PL +S+    + ISG    +     + R  P  ++  +M+
Sbjct: 401 GFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSML 460

Query: 368 AFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLV 427
            F  G+IL A  P+ QT++   F S+ + P GM  SFP+A+++ +  +P  ++ +A SLV
Sbjct: 461 GFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLV 520

Query: 428 NTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           N  INY+ SI +G AG+     ++   DLL G+R
Sbjct: 521 NVAINYATSICVGMAGSANVNHNNHGQDLLHGFR 554

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  158 bits (400), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 137/472 (29%), Positives = 230/472 (48%), Gaps = 27/472 (5%)

Query: 1   MSSKKLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPL-QIIGD 59
           +S  + +S E  D      S  +  L KE   +     AQ   QAG    I+PL  ++ D
Sbjct: 22  ISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAG-GTMILPLVNVLSD 80

Query: 60  SFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVY 119
           SF  K      +  +++ +  G+F+LI GRLG+  G+K+  + G++   L S+L G S Y
Sbjct: 81  SFHGK------FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLGGLSRY 134

Query: 120 S-NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYR---PGRKQNMIFSLFGACAPSGFVVG 175
           S + IF+  CRAFQG+G A  LPN  A     Y+      ++ ++ ++ G  A +G  +G
Sbjct: 135 SKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGASTGAFLG 194

Query: 176 AVFSSLL---SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAG 232
              S +    SE + W WAY+   I   L     Y  +P +     ++ C     ++  G
Sbjct: 195 TFLSGICVTRSE-SNWSWAYYTYTIAATLTLALSYYSVPDNIT-KKNKPC-----LNGLG 247

Query: 233 SVTG-VVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRK 290
             +    GL++ N A N   V     S+   LL+V    L  F   E + ++ P+     
Sbjct: 248 WFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKEL 307

Query: 291 LSSDTI-FVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMST 349
            ++ ++  V+  I  GW ++GIW  Y ++ + NLR+  PL + + ++ + I G  A +  
Sbjct: 308 FTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGI 367

Query: 350 EFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATI 409
             L+ RT P   ++ + + FT   I+++  P+ Q+Y+  T  S+I +  G+D SFP++ I
Sbjct: 368 SMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAI 427

Query: 410 ILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461
           IL   +P+ +  + A L N I NY+IS   G   +    +S  E  L+K YR
Sbjct: 428 ILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSSIE--LIKYYR 477

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score = 78.2 bits (191), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 70/126 (55%), Gaps = 3/126 (2%)

Query: 39  AQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKK 98
           +QL+ Q G  Q++  + ++   F      Q    AS   L  G+FIL++G++GD +G K 
Sbjct: 3   SQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVAS-IPLVSGSFILVSGKVGDIYGLKN 61

Query: 99  FFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-K 156
             + G+    +WS + G + Y+  + FF   RAFQG+G AF LPN +  ++  Y  G  +
Sbjct: 62  TLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSIR 121

Query: 157 QNMIFS 162
           +NM+++
Sbjct: 122 KNMVYA 127

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 100/453 (22%), Positives = 184/453 (40%), Gaps = 72/453 (15%)

Query: 33  IMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGD 92
           I + C+  L+  AG+   I  ++ +G+++G++     SW  +++++T    I   GRLGD
Sbjct: 37  IFLGCTFDLLNVAGV---ISVIEDLGETYGLEYT-TASWALTSYAITFAGLIAFMGRLGD 92

Query: 93  TFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYR 152
             G+   F +   +++L+ +L   +V +N   F   RA QGI  A  +P   A+I     
Sbjct: 93  IIGNSVLFTISGFFFSLFCLLC--AVVTNFPAFAVLRALQGIAAAGLVPCGYALIPTLAD 150

Query: 153 PGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGIT---CFLLGVAGYLV 209
           P   Q     LF A      VV   FSS +        A+ +  +     F L  AG L+
Sbjct: 151 PEDVQ-----LFFA------VVSCGFSSTIGIGLIIGGAFALTNVGYKGIFYLSFAGMLL 199

Query: 210 -----------IPHHPPIHPDEKCSL-----VERIDVAGSVTGVVGLILFNFAWNQGPVV 253
                      I  H     D + S+     V  +D  GS+  + G +L      +G   
Sbjct: 200 VSIAAFFFTYRIEEHKFAEQDYEGSIHRPGKVASLDFVGSLIFISGSVLIVVGLTEGGE- 258

Query: 254 GWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDT---------------IFV 298
            W+    Y    +G  F   F       ++ ++ ++KL  DT               +F+
Sbjct: 259 SWKRPVAYVPFTIGMIFFCGFFAWNCSYQNLVIFLKKLGCDTSRYLEKVQVLIPRDVLFM 318

Query: 299 -------MGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAIS-----GLCAA 346
                  +G +  G   +   +Y   Q    +    PLL+  + VP+ I+      +CA+
Sbjct: 319 TNFIPITLGFLCNGGCLYS-NIYIIDQYSQYVDKNSPLLAGVKLVPLIITMVIGNTICAS 377

Query: 347 MSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQT--YWAQTFVSIIVMPWGMDMSF 404
            S      +  P   + +  ++   GSI++  + + +   YW   F S I++ +G  + +
Sbjct: 378 KSV-----KLRPRIGVALGFLSMVCGSIILIQLHLVEENLYWKIMFCSQILVGFGAAIFY 432

Query: 405 PAATIILSTAMPASHQGLAASLVNTIINYSISI 437
           P A  ++    P+  +G+A+ +  T     I +
Sbjct: 433 PYALKLVVGDAPSGAKGIASGVTQTFAQLGIEM 465

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 97/426 (22%), Positives = 168/426 (39%), Gaps = 42/426 (9%)

Query: 70  SWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCR 129
           SW  +++++T   FI   GRLGD  G+   F +    +A+ S+L   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLC--AVMPNFPAFAVFR 124

Query: 130 AFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSL----FGACAPSGFVVGAVFSSLLSEF 185
           A QGI  A  +P A A+I     P  K    FS+    F +    G ++G  F++  ++ 
Sbjct: 125 AIQGICAAGLVPCAYALIP-ILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAA--TKI 181

Query: 186 AWWPWAYWIMGITCFLLGVA---GYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLIL 242
            +    Y    +   +  +A    Y V          +  + V+ +D  GS+  V G IL
Sbjct: 182 GYRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSIL 241

Query: 243 FNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGF------------------IES----R 280
                 +G    W    TY  LI+G   L  FGF                  I++     
Sbjct: 242 IVVGLTEGGE-SWNRPVTYVTLIIG--ILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFE 298

Query: 281 AKHPLLPVRKL-SSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVA 339
               L+PV  L   + I ++   A   +     +Y   Q         PLL+  + VP+ 
Sbjct: 299 KVQLLIPVDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLI 358

Query: 340 ISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPV--SQTYWAQTFVSIIVMP 397
           I  +       F  T+  P   + +       GSI++  + +     +W   F S  ++ 
Sbjct: 359 ICMVVGNALCAFESTKLKPRVGVALGFSLALAGSIILIQLHLIKDNVFWKIFFSSQALVG 418

Query: 398 WGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISD--GEDD 455
           +G+ + +P A  I     P   +G+A+ +  T     I I      ++   I++  G++D
Sbjct: 419 FGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKED 478

Query: 456 LLKGYR 461
            ++ +R
Sbjct: 479 AIQNFR 484

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 99/460 (21%), Positives = 181/460 (39%), Gaps = 58/460 (12%)

Query: 33  IMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQL-----SWFASAFSLTVGTFILIA 87
           IMV C+  L+             ++  +  I+N  Q+     SW  +A+++T   FI   
Sbjct: 30  IMVSCAFDLINVTA---------VLSATRDIENTYQIEFTTASWALTAYAITFAGFIAFL 80

Query: 88  GRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAII 147
           GR+GD  G+   FV     +++ S++   +V +N   F   RA QGI  A  +P+  A+I
Sbjct: 81  GRVGDIIGNSVLFVSSCFLFSILSLIC--AVVNNFGTFAVFRALQGIAAAGIVPSGYALI 138

Query: 148 ARTYRPGRKQNMIFSLFGACAPS-----GFVVGAVFSSLLSEFAWWPWAYWIMGITCFLL 202
                    Q+  F    +C  S     GF++G  F+  L+   +    Y    +   ++
Sbjct: 139 PTLSDEHEVQS--FFAIVSCGFSTSFGIGFIIGGAFT--LTRIGYKGIFYLTFAVM-LVI 193

Query: 203 GVAGYLVI---PHHPPIHPDE----KCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGW 255
            +  Y  I    +  P   D     K S    +D  GS   +   IL      +G    W
Sbjct: 194 SIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFISSTILIVVGLTEGGE-SW 252

Query: 256 ETSYTYALLIVGSAFLAAF-------GFIESRAKHPLLP--------VRKLSSDTIFVMG 300
           +    Y  LIVG A    F       G +    K    P        ++ L    + +M 
Sbjct: 253 KKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNYFRTIQVLIPKDVLMMK 312

Query: 301 ----CIAAGWSSFGIW---VYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLL 353
                  A ++++G     +Y   Q    +    PLL++ + +P+ +S L   +      
Sbjct: 313 NFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSMLIPNVVIAIKS 372

Query: 354 TRTSPSTVMIIAMIAFTVGSILVATVPV--SQTYWAQTFVSIIVMPWGMDMSFPAATIIL 411
              SP   +++      +GSI++  + +     YW   F S  ++ +G  + FP +  IL
Sbjct: 373 DLISPRKAVVLGFFIMFIGSIILIQLHLITDNLYWKIFFCSQSLIAFGAAIFFPYSLNIL 432

Query: 412 STAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISD 451
               P  ++G+A+ ++ T   + + +      +I   I++
Sbjct: 433 IGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINE 472

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 103/240 (42%), Gaps = 19/240 (7%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
           Q+SW A+A+ L+   F  + G+L D FG K   ++  L +AL   + G    +N      
Sbjct: 77  QMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLST 136

Query: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAW 187
            R   GIG          I      P RK+ +   L   C   G   G+V  ++L +   
Sbjct: 137 GRFVAGIGGGGQ-ATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVLQQGIG 195

Query: 188 WPWAYWI---MGITCFLLGVAGYLVIPHHPP--------IHPDEK---CSLVERIDVAGS 233
           W WA+ +   M + C L+ +A  L +P   P        +   ++   C++ E +D  GS
Sbjct: 196 WRWAFLVQVPMALVCALM-IAVVLDLPADSPGRGLLWLELKRGKRLKWCTVTEMVDFVGS 254

Query: 234 VTGVVGLILFNFAWN--QGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKL 291
            T +  +IL   A +    P     TS    L ++ +A    F + E   ++P++P+R L
Sbjct: 255 FTLIASMILLMTAISLLSDP-TQLSTSLWLLLGVLLTASSLQFAYTECTTRNPMVPLRLL 313

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 94/424 (22%), Positives = 169/424 (39%), Gaps = 38/424 (8%)

Query: 70  SWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCR 129
           SW  +++++T   FI   GRLGD  G+   F +    +A+ S+L   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLC--AVMPNFPAFAVFR 124

Query: 130 AFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSL----FGACAPSGFVVGAVFSSLLSEF 185
           A QGI  A  +P A A+I     P  K    FS+    F +    G ++G  F++  ++ 
Sbjct: 125 AIQGICAAGLVPCAYALIP-ILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAT--TKI 181

Query: 186 AWWPWAYWIMGITCFLLGVA---GYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLIL 242
            +    Y    +   +  +A    Y V   +     D+  + V+ +D  GS+  V G IL
Sbjct: 182 GYRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSIL 241

Query: 243 FNFAWNQGPVVGWETSYTYALLIVGSAFLAAF------------GF----IES----RAK 282
                 +G    W    TY  L++G      F            GF    I++       
Sbjct: 242 IVVGLTEGGE-SWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKV 300

Query: 283 HPLLPVRKL-SSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAIS 341
             L+P+  L   + I ++   A   +     +Y   Q         PLL+  + VP+ I 
Sbjct: 301 QLLIPIDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIIC 360

Query: 342 GLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQT--YWAQTFVSIIVMPWG 399
            +       F  T+  P   + I       GSI++  + + +   +W   F +  ++ +G
Sbjct: 361 MVIGNALCAFESTKLRPRVGVAIGFFLALAGSIILIQLHLVKEDLFWKIFFSAQALVGFG 420

Query: 400 MDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISD--GEDDLL 457
           + + +P A  I     P   +G+A+ +  T     I I      ++   I++  G+ + +
Sbjct: 421 VAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKSNAI 480

Query: 458 KGYR 461
           + +R
Sbjct: 481 QKFR 484

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 98/419 (23%), Positives = 164/419 (39%), Gaps = 49/419 (11%)

Query: 70  SWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCR 129
           SW  +++++T   FI   GRLGD  G+   F +   ++A+ S+L   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLC--AVMPNFPAFAVFR 124

Query: 130 AFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSL----FGACAPSGFVVGAVFSSLLSEF 185
           A QGI  A  +P A A+I     P  +    FS+    F +    G ++G  F++  ++ 
Sbjct: 125 AIQGISAAGLVPCAYALIP-MLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAA--TKI 181

Query: 186 AWWPWAYWIMGITCFLLGVAG----YLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLI 241
            +    Y    +  FL+ +      Y V     P   D+  + V  +D  GS+  V G I
Sbjct: 182 GYKGIFYLTFAVM-FLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSI 240

Query: 242 LFNFAWNQGPVVGWETSYTYALLIVGSAF-----------------LAAFGFIESR---A 281
           L      +G    W    TY  L++G                    +   G   SR    
Sbjct: 241 LIVVGLTEGGE-SWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFEK 299

Query: 282 KHPLLPVRKL-SSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAI 340
              L+PV  L   + I ++   A   +     +Y   Q         PL +  + VP+ I
Sbjct: 300 VQLLIPVDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLII 359

Query: 341 -----SGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPV--SQTYWAQTFVSI 393
                +GLCA     F  T+  P   +++       GSI++  + +     +W   F S 
Sbjct: 360 CMVIGNGLCA-----FESTKLKPKVGVVLGFSLALAGSIILTQLHLIKEDMFWKIFFSSQ 414

Query: 394 IVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDG 452
            ++ +G+ + +P A  I     P   +G+A+ +  T     I I      ++   I DG
Sbjct: 415 ALVGFGVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNI-DG 472

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 114/507 (22%), Positives = 194/507 (38%), Gaps = 88/507 (17%)

Query: 5   KLNSHEEQDSLLLQNSREWTSLLKEGFAIMVL---CSAQLMTQAGLAQSIVPLQIIGDSF 61
           KL +  +   L  QNSR      + G  I ++   C+  L+  AG+   I  L   G+++
Sbjct: 7   KLRNGLKCLRLKCQNSR-----YQLGINITLIFFGCTFDLLNVAGVISVIEDL---GETY 58

Query: 62  GIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN 121
            +   G  SW  +++++T   FI   GRLGD  G+   F +    + L+S+L   +V  +
Sbjct: 59  KLGYTGA-SWALTSYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLC--AVVRD 115

Query: 122 QIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSL----FGACAPSGFVVGAV 177
              F   RA QGI  A  +P   A+I     P   Q   FS+    F +    G +VG  
Sbjct: 116 FPTFAVFRALQGISAAGIVPCGYALIPLLAEPQDIQKF-FSIVSCGFSSTIGIGLIVGGA 174

Query: 178 FSSLLSEFAWWPWAYWIMGITCFLLGVAGYLV------------------------IPHH 213
           F+  L++  +        GI  F L  AG LV                        IPH 
Sbjct: 175 FA--LTKVGY-------AGI--FYLSFAGMLVVSIAASFYTYRIEERKFLEVKVEDIPHD 223

Query: 214 PPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAA 273
              HP      V  +D  GS+  V G +L      +G    W     Y    +G     +
Sbjct: 224 ---HPK-----VASLDFVGSLIFVSGSVLIVAGLTEGG-ESWRRPVAYVPFSIGVLLFCS 274

Query: 274 FGFI--------ESRAK-------HPLLPVRKL-SSDTIFVMGCI------AAGWSSFGI 311
           F FI         SR K         L  V+ L   D +F+   I      A   +    
Sbjct: 275 F-FIWNCYYQKMVSRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFIPIILSFACNNACLFS 333

Query: 312 WVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV 371
            +Y   Q    +    PL++  + +P+ +S +    +      +  P   +++  +    
Sbjct: 334 VIYIIDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPKVGVVLGFLFMLC 393

Query: 372 GSILVATVPVSQT--YWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNT 429
           GSI++  +   +   +W   F S I +  G  + +P A  ++    P   +G+A+ +  T
Sbjct: 394 GSIILIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPDGAKGIASGMTQT 453

Query: 430 IINYSISIGLGFAGTIESQISDGEDDL 456
              + + +      ++   I+D ++ L
Sbjct: 454 FAQFGVEVTFSVMVSVLGNITDVKETL 480

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 98/401 (24%), Positives = 172/401 (42%), Gaps = 37/401 (9%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
            +SW A+A+ L+  TF  + G++ D FG K   +   + +AL  ++ G S          
Sbjct: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS--PGLWCLVA 222

Query: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRKQ-------NMIFSLFGACAPSGFVVGAVFSS 180
            R   GIG    L +  +I      P R +       N  F L  AC   G +VG  FS 
Sbjct: 223 GRFIAGIGGG-GLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTAC---GGLVGGWFS- 277

Query: 181 LLSEFAWWPWAYWIM----GITCFLLGVAGYLVIPHHPP---IHPDEKCSLVE---RIDV 230
                  W  A+ I      I+C L  +  YL +P       I  DE   + E   RID 
Sbjct: 278 --EHGGGWRVAFLIQIPLCAISCSL--IVAYLELPKGCKGSGIQSDEDNQISEKLRRIDW 333

Query: 231 AGSVTGVVGLILFNFAWN-QGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPV 288
            G+++ VV L+LF  A +  G  + ++++  YAL +      A F ++E+  +K P+LPV
Sbjct: 334 FGALSLVVFLLLFMLASSLGGKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPV 393

Query: 289 RKLSSDTIFVMGCIAAGW-SSFGIWV--YYTWQLMANLRDQPPLLSSAQFVPVAISGLCA 345
             L + TI  +G   A W S  G+    Y+     A + +  P     + +P   S    
Sbjct: 394 AFLKNRTI--LGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALG 451

Query: 346 AMSTEFLLTRTSPSTVMIIAMIAF-TVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSF 404
           ++   + + +T     +++A  A   VG + ++ +  +   W Q ++ +++  +G+ +  
Sbjct: 452 SLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQ-YILLVIPGFGLSVLI 510

Query: 405 PAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTI 445
               + +  A+P  HQ    S+     +   ++G+   G I
Sbjct: 511 TVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAI 551

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 99/411 (24%), Positives = 171/411 (41%), Gaps = 50/411 (12%)

Query: 67  GQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFD 126
            Q+SW A+++ L+   F  + G+L D FG K   +   L +    IL G + ++  ++  
Sbjct: 67  NQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWML 125

Query: 127 CC-RAFQGIG-------PAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVF 178
           C  R   G+G          T  + I +  R    G   N++F+L   CA SG ++GA  
Sbjct: 126 CIGRFIAGVGGGGLNSLSTITTSDIIPLRQRGVYQGMG-NIVFAL--GCA-SGSLIGA-- 179

Query: 179 SSLLSEFAWWPWAYW----IMGITCFLLGVAGYLVIPHHPP----IHPDEK----CSLVE 226
              L +   W WA+     +  ++C L  +  +L +P   P    I+   K      + E
Sbjct: 180 --FLQQRIGWRWAFLCQVPLSLLSCSL--IMKFLNLPAGSPGRGLINLSNKKITTADVRE 235

Query: 227 RIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFI--ESRAKHP 284
            +D  GS T +  ++L     +        T  T+AL IVG A LA + F+  E    +P
Sbjct: 236 HVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWALFIVGLA-LAGYTFVSTELSVHNP 294

Query: 285 LLPVRKLSSDTIFVMGCIAAGW----SSFGIWVYYT---WQLMANLRD-QPPLLSSAQFV 336
           ++P+R L S+   V+      W    S+F +  YY    WQ + +L+     + + + F 
Sbjct: 295 MVPIRLLGSNRT-VLASSLTNWFFTMSTF-VLAYYVPVFWQTVYHLKPWNIGVRTVSNFF 352

Query: 337 PVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVM 396
            +AI     +M T   + RT     +   +   TV   L+  +    T         ++ 
Sbjct: 353 GIAI----GSMMTGLYMKRTGKYKALSNTLNTVTVAGTLIVYLSTYNTEPKGLLEYFMLF 408

Query: 397 PWGMDMSFPAATIILS--TAMPASHQGLAASLVNTIINYSISIGLGFAGTI 445
             G+  +      +LS   ++  SHQ    S+         ++G+ FAG I
Sbjct: 409 LPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRAIGSTLGVSFAGLI 459

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 116/273 (42%), Gaps = 27/273 (9%)

Query: 12  QDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSW 71
           + SL  Q++ +    +     I++ C   L   A +   IV +  I   F + +  Q  W
Sbjct: 11  KGSLFHQDTLKHLKFI----CILIACGLDL---ASVGAMIVLVTDIETRFNVSHT-QSGW 62

Query: 72  FASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCRAF 131
             +++ +T   FI   GR+GD  G+     +  + + ++S+L   +V  N I F   RAF
Sbjct: 63  ALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLC--AVVPNFIAFTVFRAF 120

Query: 132 QGIGPAFTLPNAIAIIARTYRPGRKQ---NMIFSLFGACAPSGFVVGAVFSSLLSEFAWW 188
           QG+  A  +P A A++ + ++    Q   +++ S+  A A  GF++G  F    +   + 
Sbjct: 121 QGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFGE--TALGYK 178

Query: 189 PWAYWIM-------GITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLI 241
            + Y++         + C L+G    L+  H       EK   V ++DV G +  + G I
Sbjct: 179 SFFYFLFAASLATAAVICVLIGYPELLLNRH----SYKEKFQRVYKLDVIGCLLFISGSI 234

Query: 242 LFNFAWNQGPVVGWETSYTYALLIVGSAFLAAF 274
           L      QG    W     Y  L V    L  F
Sbjct: 235 LLVVGLTQGG-ESWNDPTAYVPLAVSIVLLIIF 266

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 93/407 (22%), Positives = 163/407 (40%), Gaps = 53/407 (13%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
           ++SW A+A+ L+  TF  + G+L D FG +   V   L + L +++ G S   N      
Sbjct: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMS--KNLWVLVL 233

Query: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRKQ-------NMIFSLFGACAPSGFVVGAVFSS 180
            R   GIG    L +  +I      P R +       N+ F L  AC   G +VG +F+ 
Sbjct: 234 GRFVAGIGGG-GLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTAC---GGLVGGLFA- 288

Query: 181 LLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKC--------SLVERIDVAG 232
                  W  A+ +      L   A  L +    P+   +          + +  +D  G
Sbjct: 289 --DRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTG 346

Query: 233 SVTGVVGLILFNFAWNQGPVVGWETSYTYALLIV----GSAFLAAFGFIESRAKHPLLPV 288
           +VT VV L  F    +   + G +  + Y + +V    GS F+    ++   A  P+LP+
Sbjct: 347 TVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIYHELYV---ATDPILPI 400

Query: 289 RKLSSDTIF---------VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVA 339
           R L + ++          +MG +  G   F I VYY     A++ +  P     + VP  
Sbjct: 401 RFLENRSVLAASLSNWFCMMGMMTTG---FYIPVYY-----ASVLNMGPTDIGKRIVPSF 452

Query: 340 ISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV-GSILVATVPVSQTYWAQTFVSIIVMPW 398
            S    ++   + + RT      ++A     V G + ++ V  S + W Q +   ++  +
Sbjct: 453 FSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQ-YCLYMIPGF 511

Query: 399 GMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTI 445
           G  +      + L  A+P  HQ    S+     +   ++G+   G I
Sbjct: 512 GSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGAI 558

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 102/246 (41%), Gaps = 18/246 (7%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
           Q+SW A+++ L+   F  + G+L D FG K   V   L +A+   L G S ++  I+   
Sbjct: 77  QMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCG-SPWTTNIWILS 135

Query: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAW 187
              F        L     I      P RK+ +   L   C   G   G+V  ++L +   
Sbjct: 136 AGRFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSLGCASGSVLGAVLQQGIG 195

Query: 188 WPWAYWIMGITCFLLGVAGYLVIP-------------HHPPIHPDEKCSLVERIDVAGSV 234
           W WA+ I      + G+    V+               H   +  +   + + ID  GS+
Sbjct: 196 WRWAFLIQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQWSKVTKMIDFVGSI 255

Query: 235 TGVVGLILF--NFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKL- 291
           T V+ ++L     ++   P    E S+   +L+V + F A F   E    +P++P+R L 
Sbjct: 256 TLVMSMLLLMITISFLSDPSQLSENSWVVLVLLV-AGFCAKFVHTECTIHNPMVPLRLLW 314

Query: 292 SSDTIF 297
            + T+F
Sbjct: 315 ENRTVF 320

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 100/424 (23%), Positives = 173/424 (40%), Gaps = 46/424 (10%)

Query: 45  AGLAQSIVP--LQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVM 102
           A L  +IV   L  IG  F   +  ++SW A+++ L+  T   + G+L D  G K   V 
Sbjct: 95  AALDGTIVSTLLTRIGSEF--NSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVF 152

Query: 103 GFLWYALWSILAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRK----QN 158
             + +++  ++ G S     +     R   GIG    L    +++     P R+    Q 
Sbjct: 153 SNVVFSIGCLICGMSTSIWWVVVG--RFVSGIG-GCGLTCLASMVISDLVPLRERAVYQG 209

Query: 159 MIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMG----ITCFLLGVAGYLVIPHHP 214
           +   +FG    SG +VGA F         W  A+ I       +C L  +  YL +   P
Sbjct: 210 LCNFIFGLGTASGGLVGAAFQD-------WRMAFTIQCPISLASCAL--IVSYLEL---P 257

Query: 215 PIHPDEK----CSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYT---YALLIVG 267
           P H D+K     S +  +D AG VT V  L LF    + G   G E +Y    +ALL V 
Sbjct: 258 PRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLCVT 314

Query: 268 SAFLAA-FGFIESR-AKHPLLPVRKLSSDTIFVMGCIAAGW---SSFGIWVYYTWQLMAN 322
           +  L + F ++E   A  P+LP+  L   +  V+G   A W    S     YY     A+
Sbjct: 315 TLVLGSIFAYVELYVAVDPVLPIAFLKYRS--VLGSSLANWFAMMSMLTTNYYLPVYWAS 372

Query: 323 LRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV-GSILVATVPV 381
           + +  P     + +P   S    ++     + RT      ++A     + G + +  +  
Sbjct: 373 VLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTP 432

Query: 382 SQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGF 441
           +   W Q ++ ++V  +G+ +      + + +A+P  H     S+     +   ++G+  
Sbjct: 433 ATPVWQQ-YLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSI 491

Query: 442 AGTI 445
              I
Sbjct: 492 GAAI 495

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 90/409 (22%), Positives = 163/409 (39%), Gaps = 43/409 (10%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
           ++SW A+A+ L+  TF  + G+L D FG K   ++  + + +  ++ G +      F+  
Sbjct: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT----PSFWGL 170

Query: 128 --CRAFQGIGP-------AFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVF 178
              R   GIG        + T+ + + +  R    G   N  F L  AC   G VVG  F
Sbjct: 171 VGARFISGIGGGGVTSMCSITISDIVPLRDRALYQG-MCNFFFGLGTAC---GGVVGGWF 226

Query: 179 SSLLSEFAWWPWAYWIM----GITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSV 234
           S        W  A+ I      ++  L+ V   L         P    + +  +D  G+ 
Sbjct: 227 S---DHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGAS 283

Query: 235 TGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAF--GFIESRAKHPLLPVRKLS 292
             VV L LF    + G       S T+  L +GS+   AF  G     AK P+LP+  L 
Sbjct: 284 ALVVFLSLFLVTASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLR 343

Query: 293 SDTIFVMGCIAAGW--------SSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLC 344
           + +  V+G   + W        +S+ + +YY+  L  N     P     + +P   S   
Sbjct: 344 NRS--VLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMN-----PTRVGKRLMPNFFSTAL 396

Query: 345 AAMSTEFLLTRTSPSTVMIIAMIAFT-VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMS 403
            ++   + + RT     + +     + +G + +  +      W Q F+ +++  +G  + 
Sbjct: 397 GSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQ-FILLVIPGFGYSVL 455

Query: 404 FPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDG 452
              A + +  A+P +H     S+     +   ++G+   G I  Q  +G
Sbjct: 456 ITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNG 504

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 117/275 (42%), Gaps = 43/275 (15%)

Query: 55  QIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILA 114
           Q+IG+ F  ++    SW  +A+ +T  +F  + G   DT G ++        +AL  +  
Sbjct: 71  QLIGNEF--EDVKVSSWITTAYLVTCTSFQPLYGSFSDTLGRRRCLFFANTIFALGCLGC 128

Query: 115 GF--SVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGF 172
           G   ++YS  I     RA  GIG    +  +  I+     P +K+ M  S       +G 
Sbjct: 129 GLTSTIYSLIIM----RAVTGIGGGGLITLS-TIVNSDIIPAKKRGMYQSFQNILVGTGA 183

Query: 173 VVGAVFSSLLSEFAWWPWAYWIMGITCFLL--------GVAGYLVIPHHPPIHPDEK--- 221
           VVGA     ++    W W        CFLL         V  YL +     +  + +   
Sbjct: 184 VVGASCGGEIASSMGWRW--------CFLLQVPISIGGAVMAYLFVQDQDVVDKNPRSGA 235

Query: 222 ----CSLVERIDVAGS---VTGVVGLILF---NFAWNQGPVVGWETSYTYALLIVGSAFL 271
                S +++ID  G+   ++G+V  ++F   N +  +G    W +  + AL +V +  L
Sbjct: 236 LPSNVSKIKKIDFLGAFLLISGLVSQLIFLTINSSAQEGKST-WLSGRSLALGLVTAVSL 294

Query: 272 AAFGFIE-SRAKHPLLPVRKLS---SDTIFVMGCI 302
             F ++E +   +P++P   L    S T+ ++G +
Sbjct: 295 ILFAYVEKTTTANPIIPHDLLGQWYSTTVLIVGVL 329

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 5/141 (3%)

Query: 54  LQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSIL 113
           +++I + F  K+  +  W  S +SLT     L+ GR     G K   ++  L +   S++
Sbjct: 142 IEVIAEQF--KDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLI 199

Query: 114 AGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFV 173
           +  S   N +     R   GIG +  + +   +IA T  P R + +I S+         V
Sbjct: 200 SAISNSMNMLIGG--RVVAGIGGS-GIQSLCFVIASTLTPDRSRVIIISVLSCSYAVAAV 256

Query: 174 VGAVFSSLLSEFAWWPWAYWI 194
           VG      L+    W W ++I
Sbjct: 257 VGPFLGGALTTHVTWRWCFYI 277

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 110/266 (41%), Gaps = 31/266 (11%)

Query: 54  LQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSIL 113
           L  IG  F   +  + SW A+++ L+  T   + G+L D  G K   V     +A+  ++
Sbjct: 110 LTHIGSEF--NSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLI 167

Query: 114 AGFSVYSNQIFFDCC-RAFQGIGPAFTLPNAIAIIARTYRPGRK----QNMIFSLFGACA 168
            G    SN I+     R   GIG    L +   +I     P R     Q +   +FG   
Sbjct: 168 CGL---SNSIWAVVAGRFISGIG-GCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT 223

Query: 169 PSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVI------PHHPPIHPDEKC 222
            SG +VGA F         W  A+ +    C +  ++G L++      P     + D   
Sbjct: 224 ASGGLVGAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNKDCWS 273

Query: 223 SLVERIDVAGSVTGVVGLILFNFAWNQ-GPVVGWETSYTYALLIVGSAFLAAFGFIESR- 280
           + + R+D AG+ + +  L LF    +  G  V + +    A+      F A F ++E R 
Sbjct: 274 ARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRV 333

Query: 281 AKHPLLPVRKLSSDTIFVMGCIAAGW 306
           A  P+LPV  L   +  V+G   A W
Sbjct: 334 AADPVLPVTFLRDRS--VLGSSLANW 357

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 80/405 (19%), Positives = 147/405 (36%), Gaps = 28/405 (6%)

Query: 70  SWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCR 129
           SW  +++++T   FI   GRLGD  G+ + F +    +A+ S+L G  +  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCG--LMPNFEAFAVMR 124

Query: 130 AFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEF-AWW 188
           A QGI  A  +    A+I     P  +    FS+      S   +G +       +   +
Sbjct: 125 ALQGIAAAGLVMCGYALIP-ILSPKEQVQEYFSIVSCGFSSTIGIGFIIGGAXXGYKGIF 183

Query: 189 PWAYWIMGITCFLLGVAGYLVIPHHPP-IHPDEKCSLVERIDVAGSVTGVVGLILFNFAW 247
              +  M + C +       V  +    +   E  + V  +D  GS+  + G IL     
Sbjct: 184 YLTFAAMTLICIMAFFFTCDVEKNEEKGLEVKESTATVASLDFIGSLIFITGSILIVVGL 243

Query: 248 NQGPVVGWETSYTYALLIVGSAFLAAF-----------------GFIESR--AKHPLLPV 288
            +G    W  +  Y    +G     +F                 G   ++   K  LL  
Sbjct: 244 TEGG-ESWREAKAYVTFAIGIILFLSFFAWNCFYLKIVNGIRLIGIDTTKYFEKVQLLVP 302

Query: 289 RKLSSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMS 348
             +   T  V+         F   +Y   Q      +  PL++  + VP+ IS +     
Sbjct: 303 LNIHFMTXIVLAFAMNNACPFS-SIYIIDQYSQYKENDSPLMAGVKLVPLIISMIIGNFL 361

Query: 349 TEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQ--TYWAQTFVSIIVMPWGMDMSFPA 406
                TR  P   + +       GSI++  +   +   +W   F + +++ +G+ + +P 
Sbjct: 362 CGIEKTRMRPKFGVTLGFFLALSGSIILTQLRAVKYDVFWKIFFSAEVLVGFGVAIFYPY 421

Query: 407 ATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISD 451
           A  +     P   +G+A+ +  T     I I      ++   I +
Sbjct: 422 AQQLAVGRAPDEAKGIASGVAQTFGQLGIEIAFSIMASVLGNIEE 466

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 95/439 (21%), Positives = 171/439 (38%), Gaps = 61/439 (13%)

Query: 55  QIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILA 114
           Q IG+ F   N    SW  +A+ +T  +F  + G   D  G +         + +  +  
Sbjct: 80  QTIGNEFNHMNIS--SWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLAC 137

Query: 115 GFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVV 174
           G S   N +     RA  GIG    +  +  I+     P  K+ +  +        G + 
Sbjct: 138 GLS--PNIVVLSFMRALTGIGGGGLITLS-TIVNSDMIPSSKRGIFQAFQNLLLGLGAIC 194

Query: 175 GAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPP---------IHPDEKCSLV 225
           GA F   ++    W W +++    C    +     +P+             HP +   ++
Sbjct: 195 GASFGGSIASSIGWRWCFFVQVPICITNSLIMSSYVPNQKEYEDREIGFLFHPKK---IL 251

Query: 226 ERIDVAGSVTGVVGLILFNFAWNQGPV---VGWETSYTYALLIVGSAFLAAFGFIESR-A 281
           + IDV GSV  ++GL L     + G     V W +     LL      L  F + E++ +
Sbjct: 252 KDIDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIILVLFVYNEAKTS 311

Query: 282 KHPLLPVRKLSSDTIFVMGCIA--AGWSS----FGIWVYYTWQL-----MANLRDQPPLL 330
              ++P+  + S   FV+  I+   G++S    F + +++   L      A LR   P L
Sbjct: 312 ARAIIPLELMRSSFSFVVLTISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSL 371

Query: 331 SSAQFVPVA--ISGLCAAMSTEFLLTRTSPSTVMIIA-MIAFTVGSILVATVPVSQTYWA 387
               F PV   I+G+C        ++R +   +++ A +    +G+ L   +      W 
Sbjct: 372 ----FTPVGGLITGIC--------MSRYNCLQILLYAGVFLMALGNFLFLFIEKGSPNW- 418

Query: 388 QTFVSIIVMP--WGMDMSFPAATIILSTAMPASHQGLAASL------VNTIINYSISIG- 438
              V + ++P   G  ++FPA       A P S Q  A S       + ++   ++S G 
Sbjct: 419 --LVGLFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLYLFRSIGSVWGVAMSTGV 476

Query: 439 --LGFAGTIESQISDGEDD 455
             L F  ++ S + D  D+
Sbjct: 477 IQLYFGKSLRSNLKDLLDE 495

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 87/387 (22%), Positives = 155/387 (40%), Gaps = 44/387 (11%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
            +SW A+A+ L+  TF  + G++ D FG +   ++  L++ L  ++ G S   N      
Sbjct: 97  HISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS--KNLWTLVA 154

Query: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFA- 186
            R   GIG    + +  +I A    P R + +   +F      G  +G +     SE   
Sbjct: 155 GRFIAGIGGG-GVTSLGSITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWFSESKN 213

Query: 187 WWPWAYWIMGITC---------FLL---GVAGYLVIPHHPPIHPDEKCSLVERIDVAGSV 234
            W  A+ +    C         FL    G  G  ++ +      D K  L +RID  GS+
Sbjct: 214 GWRMAFLVQVPLCAISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKL-KRIDWLGSL 272

Query: 235 TGVVGLILFNFAWNQGPVVGWETSYT---YALLIV-----GSAFLAAFGFIESRAKHPLL 286
           + V  L  F  A + G   G E  Y    + LL+V     G+AF+    +I   +  P+L
Sbjct: 273 SLVTFLFAFMLASSLG---GKEIPYNSNIFKLLVVATILSGTAFIYVELYI---SDDPIL 326

Query: 287 PVRKLSSDTIFVMGCIAAGW------SSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAI 340
           P+R L++ +I  +G   A W       +   +V   W  + NL+   P     +  P   
Sbjct: 327 PIRFLTNRSI--LGASFANWFCMMSGVTLAFYVPVYWSSVQNLK---PTDMGKRIAPNFF 381

Query: 341 SGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV-GSILVATVPVSQTYWAQTFVSIIVMPWG 399
           S    ++   + + +T      ++      V G + V  +    + W Q ++ + +  +G
Sbjct: 382 STAFGSIGAGYYMKKTGRYYGFLLKFTGLMVLGQLQVLLMKPDISTWRQ-YILLPLPHFG 440

Query: 400 MDMSFPAATIILSTAMPASHQGLAASL 426
             +      + +  A+P  HQ    S+
Sbjct: 441 SSVLITVTLLAMIAAVPHEHQAATTSI 467

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 59/144 (40%), Gaps = 5/144 (3%)

Query: 51  IVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALW 110
           I   + IG+ F  K+  ++ W  + ++L    F L+ GRL    G K       + + + 
Sbjct: 28  ITLYETIGEKF--KDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIG 85

Query: 111 SILAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPS 170
           S++   S     I     R   G G +  + + + ++  +    R + M+ ++ G     
Sbjct: 86  SLIVAVSNSMGMIIGG--RVVAGCGGS-GIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 171 GFVVGAVFSSLLSEFAWWPWAYWI 194
            F VG V     +E   W W ++I
Sbjct: 143 AFAVGPVIGGAFTENVSWRWCFYI 166

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 78/355 (21%), Positives = 138/355 (38%), Gaps = 60/355 (16%)

Query: 50  SIVPLQIIGDSFGIK--NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWY 107
            IV +  + D+ GIK  + G + W  + ++L+   F+L+ GRL +  G K+  ++  + +
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVF 83

Query: 108 ALWSILAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSL---F 164
            + S+++  S  ++       R   G G +     A  +     R   +  MI +L   +
Sbjct: 84  EIGSLISALS--NSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISY 141

Query: 165 GACAPSGFVVGAVFSSLLSEFAWWPWAYWI---MGITCF-LLGVAGYLVIPHHPPIHPDE 220
                 G  +G  F+  LS    W W ++I   +G   F +L        PH     P +
Sbjct: 142 VIAEGVGPFIGGAFNEHLS----WRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSK 197

Query: 221 -------------KCS--------LVERIDVAGSVTGVVGLILF---------NFAWNQG 250
                        K S        LV ++D+ G +    G  L          NF WN G
Sbjct: 198 IKKIMNYDYGELLKASFWKNTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSG 257

Query: 251 PVVGWETSYTYALLIVGS---AFLAAFGF-IESRAKHPLLPVRKLSSDTIFV------MG 300
            ++ + T     LL+  +    FL+  G   +++   PLL     S+  IF       + 
Sbjct: 258 IIICFFTVGPILLLLFCAYDFHFLSLSGLHYDNKRIKPLLTWNIASNCGIFTSSITGFLS 317

Query: 301 CIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTR 355
           C A    S      Y  QL   +  + P L+S     ++I  + A M+  +L ++
Sbjct: 318 CFAYELQS-----AYLVQLYQLVFKKKPTLASIHLWELSIPAMIATMAIAYLNSK 367

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 63/160 (39%), Gaps = 29/160 (18%)

Query: 69  LSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYAL-----------WSILAGFS 117
           +SW A+++ L+   F  + G+L D FG K   +   L + L           W +LAG  
Sbjct: 189 ISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAG-- 246

Query: 118 VYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAV 177
                      R   GIG    L +  +II     P R +     LF  C   G  +G  
Sbjct: 247 -----------RFVAGIGGG-GLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGS 294

Query: 178 FSSLLSEFAWWPWAYWIMGITCFLLG--VAGYLVIP--HH 213
               L+E+  W   + +  +   + G  +  +L++P  HH
Sbjct: 295 MGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHH 334

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 76/182 (41%), Gaps = 9/182 (4%)

Query: 64  KNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI 123
           K   ++ W A++F LT   F  I G+L D  G +   V+    Y+L+ +    + Y+  I
Sbjct: 79  KESHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLA---YSLFLLGCLVTAYARNI 135

Query: 124 F-FDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLL 182
           + F   RA  GIG A  +P    I        ++Q++  S        G V+GA    + 
Sbjct: 136 WEFAFGRAICGIG-AGGIPTMCVITMGDMFSVKEQSIYQSYAHIIYTIGEVLGAPIGGIA 194

Query: 183 SEFAWWPWAYW----IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVV 238
            E   W   +     ++ I  +L      L   H PP         + R+D++GS+  ++
Sbjct: 195 LETVGWRAIFLAQVPVLTICIYLTLCDDDLAQQHIPPHGERLTWKNISRMDLSGSILLII 254

Query: 239 GL 240
            L
Sbjct: 255 SL 256

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 11/186 (5%)

Query: 57  IGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGF 116
           + + F   +  Q  W A++F LT   F  + G+L D  G +   +    ++ L  ++  F
Sbjct: 63  VAEEFSESSKKQ--WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCF 120

Query: 117 SVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPS-GFVVG 175
           +   N   F   RA  GIG      NAI+ IA +     ++  ++  +       G ++G
Sbjct: 121 A--RNVTEFSIARAVCGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQLLG 176

Query: 176 AVFSSLLSEFAWWPWAYWI---MGITCFLLGVAGY-LVIPHHPPIHPDEKCSLVERIDVA 231
           A    +  E   W   + +   M I C +L +    + + H PP+        + RID+ 
Sbjct: 177 APLGGIFIETIGWRALFGVQVPMIIVCSILAIKNINIKLFHVPPMKERYTLKNLSRIDIF 236

Query: 232 GSVTGV 237
           GS++ V
Sbjct: 237 GSLSLV 242

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 84/195 (43%), Gaps = 27/195 (13%)

Query: 54  LQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHK-------KFFVMGFLW 106
           +  + + F   +  Q  W  ++F LT   F  + G+L D  G K        FF++G L+
Sbjct: 64  MNKVAEEFEESDKKQ--WIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVGCLF 121

Query: 107 YALWSILAGFSVYSNQIFFDCCRAFQGIGP-AFTLPNAIAI--IARTYRPGRKQNMIFSL 163
            AL   L  FS+          RA  G+G    +  ++I++  I      G  Q     +
Sbjct: 122 TALSRNLVEFSI---------ARAVCGMGAGGISALSSISVSDICTPKERGVYQGYANVV 172

Query: 164 FGACAPSGFVVGAVFSSLLSEFAWWP-WAYWI-MGITCFLLGVAGYLV-IPHHPPIHPDE 220
           FG  +  G   G +   L+  F W   +A  + + +TC  LG     + + H PP H   
Sbjct: 173 FGTGSMLG---GPIGGWLMDSFGWKVIFAGQVPLIMTCMFLGYRNVNIKLLHVPPRHERY 229

Query: 221 KCSLVERIDVAGSVT 235
           +   ++RID+ GS++
Sbjct: 230 RWENIKRIDLGGSIS 244

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 75/172 (43%), Gaps = 9/172 (5%)

Query: 71  WFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCRA 130
           W A++F LT   F  + G+L D  G K   ++   ++ L  +L  F+   N   F   RA
Sbjct: 75  WIATSFLLTNTAFQPLYGKLSDITGRKSALLIAQFFFGLGCLLTCFA--RNVTEFSIARA 132

Query: 131 FQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPS-GFVVGAVFSSLLSEFAWWP 189
             GIG      NAI+ IA +     ++  ++  +       G ++GA    +  E   W 
Sbjct: 133 ICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQLLGAPLGGVFIETIGWR 190

Query: 190 WAYWI---MGITCFLLGVAGY-LVIPHHPPIHPDEKCSLVERIDVAGSVTGV 237
             + +   M + C +L +    + + H PP+        + RID+ GS++ V
Sbjct: 191 ALFGVQVPMIMLCTILAIKNINIKLFHVPPMKERYTLKNLSRIDLFGSLSLV 242

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 70/182 (38%), Gaps = 11/182 (6%)

Query: 54  LQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSIL 113
           + ++ + FG  N  +  W  + +SL      LI GR     G +   ++  L +   S++
Sbjct: 61  IDVVAEQFG--NYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLI 118

Query: 114 AGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFV 173
           A  +   N + F   R   G+G +  L     +I  T    R + ++ S+         +
Sbjct: 119 AALASSMNMLIFG--RVVAGVGGS-GLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAI 175

Query: 174 VGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGS 233
           VG +     +    W W ++I       L + G  +I        + K  L +  D  G+
Sbjct: 176 VGPIIGGAFTTHVTWRWCFYIN------LPIGGLAIIMFLLTYKAENKGILQQIKDAIGT 229

Query: 234 VT 235
           ++
Sbjct: 230 IS 231

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 101/250 (40%), Gaps = 26/250 (10%)

Query: 52  VPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWS 111
           V +  + + F   N  Q  W A+++ LT   F  + GRL D  G K   ++   ++ + S
Sbjct: 88  VIMNRVAEDFNASNQKQ--WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGS 145

Query: 112 ILAGFSVYSNQIFFDCCRAFQGIGPAFTLPN-AIAIIARTYRPGRKQNMIFSLFGACAPS 170
            L  FS    Q       A  G G    + + A++ I      G  Q      +GA    
Sbjct: 146 FLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKERGMYQGYANIFYGAGQLI 205

Query: 171 GFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDV 230
           G  +G +    +   A + +   ++ +  FL      + + H PP     K   + ++D+
Sbjct: 206 GAPIGGLLIDRIGWRALFAFQVPMVAVAMFLSFTYLNIKLAHLPPKEERYKWKHLSKLDI 265

Query: 231 AGSVT-----GVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGF---IES-RA 281
            GS+T     G+  +IL +   N+              +++G+  L +FG    IE    
Sbjct: 266 FGSITLVITIGICIVILSDNGLNR--------------MVLGAMGLLSFGLFLIIEKYYT 311

Query: 282 KHPLLPVRKL 291
           KH +LP++ L
Sbjct: 312 KHQILPLKCL 321

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 88/215 (40%), Gaps = 17/215 (7%)

Query: 45  AGLAQSIVP--LQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVM 102
           A +  SIV   +  I + F   +  Q  W A++F LT   F  + GR  D  G K   ++
Sbjct: 57  ASIDASIVANIMNKIAEEFHESDKKQ--WMATSFLLTNAAFQPLYGRCSDIVGRKCALLI 114

Query: 103 GFLWYALWSILAGFSVYSNQIFFDCCRAFQGIGPAFTLPN---AIAIIARTYRPGRKQNM 159
              ++ L ++L  F+   N   F   RA  G+G           ++ I  T   G  Q  
Sbjct: 115 AQSFFLLGTLLTCFA--RNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKERGMYQGY 172

Query: 160 IFSLFGACAPSGFVVGAVFSSLLSEFAWWP--WAYWIMGIT-CFLLGVAGY-LVIPHHPP 215
              +FGA    G V+GA    L+ E   W   +A  ++ I  C +L      L + H PP
Sbjct: 173 ANVIFGA----GQVLGAPVGGLIMETFNWRIIFAAQVVAIMICMILAYRNINLKLLHIPP 228

Query: 216 IHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQG 250
            H       + RID+ GS      L+ F   ++ G
Sbjct: 229 FHQRFTRKNLSRIDLFGSSMLSCSLVSFLMLFSSG 263

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 37.4 bits (85), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 79/186 (42%), Gaps = 11/186 (5%)

Query: 57  IGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGF 116
           + + F   +  Q  W A++F LT   F  + G+L D  G K   +    ++ L  +L  F
Sbjct: 63  VAEEFSESSKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGLGCLLTCF 120

Query: 117 SVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPS-GFVVG 175
           +   N   F   RA  GIG      NAI+ IA +     ++  ++  +       G ++G
Sbjct: 121 A--RNVTEFSIARAICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQLLG 176

Query: 176 AVFSSLLSEFAWWPWAYWI---MGITCFLLGVAGY-LVIPHHPPIHPDEKCSLVERIDVA 231
           A    +  E   W   + I   + + C +L +    + + H PP+        + RID+ 
Sbjct: 177 APLGGVFIETIGWRALFGIQVPVIMLCSVLAIKNINIKLFHVPPMKERYTLKNLSRIDIF 236

Query: 232 GSVTGV 237
           GS++ V
Sbjct: 237 GSLSLV 242

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 57/135 (42%), Gaps = 19/135 (14%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           I+G L D FG +   + G L Y + SI LA    Y   IF  C    Q IG + T+  + 
Sbjct: 155 ISGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRC---IQSIGISPTIAISS 211

Query: 145 AIIARTYRPGRKQNMI-----FSLFGACAPSGFVVGAVFSSLLSEFAWWPWA--YWIMGI 197
            ++        +   +     F L G C   G ++GAV +      A W W   +W + I
Sbjct: 212 GVVGDFTLKHERGTFVGATSGFVLLGQCF--GSLIGAVLT------ARWDWRSIFWFLTI 263

Query: 198 TCFLLGVAGYLVIPH 212
            C    +  +LV+P 
Sbjct: 264 GCGSCFLIAFLVLPE 278

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 64/145 (44%), Gaps = 15/145 (10%)

Query: 55  QIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILA 114
           + IG+ F   N   + W  + +SL+   F L+ GR+    G K   ++  L + + S++A
Sbjct: 68  ETIGEKFNDYN--DVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIA 125

Query: 115 GFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMI-----FSLFGACAP 169
             +V ++       R   G G +  + + + I+  +    R + M+     F+  G+ A 
Sbjct: 126 --AVSNSMGMLIAGRVVAGAGGS-GIQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAG 182

Query: 170 SGFVVGAVFSSLLSEFAWWPWAYWI 194
                G +    L+E A W W ++I
Sbjct: 183 -----GPILGGALNEHASWRWCFFI 202

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 87/418 (20%), Positives = 162/418 (38%), Gaps = 46/418 (11%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
           ++SW A+A+ L+  TF  I G++ D FG K   +   + + + S++ G    S    +  
Sbjct: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGL---SPSFEWLV 213

Query: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRK----QNMIFSLFGACAPSGFVVGAVFSSLLS 183
              F        + +  +I      P R     Q +    FG     G VVG  FS    
Sbjct: 214 AGRFIAGIGGGGITSMSSITTSDIVPLRNRALYQGICNFYFGLGTALGGVVGGWFSD--- 270

Query: 184 EFAWWPWAYWIMGITCFL--LGVAGYLVIPHHPP-----IHPDEKCSLVERIDVAGSVTG 236
               W  ++ I     F   + +  +L +P         +  +   ++  R+     + G
Sbjct: 271 RSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWI-G 329

Query: 237 VVGLILFNFAWN-QGPVVGWETSYT----YALLIVGSAFLAAFGFIESR-AKHPLLPVRK 290
              L+LF F++     + G E  YT      L +V       FG+ E + AK P+LP+R 
Sbjct: 330 ATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRF 389

Query: 291 LSSDTIFVMGCIAAGW---SSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAM 347
           L   +  V+G   + W    +     YY     A + +  P     + +P   S    ++
Sbjct: 390 LKDRS--VLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSL 447

Query: 348 STEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSI------IVMP-WGM 400
              + + +T      +I+         ++A++   Q  W Q  +S+      + +P  G 
Sbjct: 448 GAGYYMKKTGKYYWFVISFC-------VLASIGCLQIVWIQPDISVFKQYTLMFIPGLGA 500

Query: 401 DMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLK 458
            +    A + +  A+P +HQ +  S+     +   ++G+   G I     +  D+LLK
Sbjct: 501 SVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAI---FRESLDNLLK 555

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 115/282 (40%), Gaps = 33/282 (11%)

Query: 71  WFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCRA 130
           W A+++ LT   F  + G+L D  G K   +    ++AL  +L  F+    Q  F   RA
Sbjct: 81  WIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCLLTCFAQNVTQ--FSIARA 138

Query: 131 FQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACA-PSGFVVGAVFSSLLSEFAWWP 189
               G      NA++ I  T     ++  ++  +      +G ++GA     L +   W 
Sbjct: 139 I--CGIGGGGINAMSSITVTDICSARERGVYQGYANVVFGTGQLLGAPIGGFLLDSIGWR 196

Query: 190 WAYWI---MGITCFLLGVAGY-LVIPHHPPIHPDEKCSLVERIDVAGSVTGVVG----LI 241
             + I   M + C +L +    + + H PP +       + RID+ GS++ V      L 
Sbjct: 197 SIFGIQVPMLMLCSVLALKNVNIKLVHIPPRNERFTWKNLSRIDIFGSISLVATISGILF 256

Query: 242 LFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGC 301
           L +  WN+  ++G  T  +++L I    ++         AK  ++P   L     F +  
Sbjct: 257 LTSSNWNKS-LLGIFTVLSFSLFIYIELYV---------AKERIMPFELLKGS--FGLSS 304

Query: 302 IAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGL 343
           IA   +SF I+          +   P  L   Q V V ++GL
Sbjct: 305 IATVITSFIIY--------GEIFRSPIYLQLIQNVSVTVTGL 338

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 75/189 (39%), Gaps = 17/189 (8%)

Query: 57  IGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGF 116
           + + F   +  Q  W A++F LT   F  + G+L D  G K   +    ++ L  +L  F
Sbjct: 70  VAEEFAESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCLLTCF 127

Query: 117 SVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACA-PSGFVVG 175
           +    Q  F   RA  G+G      NA++ I  +     ++  IF  +       G V+G
Sbjct: 128 AQNVTQ--FSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYANIVFGMGQVLG 183

Query: 176 AVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIP-------HHPPIHPDEKCSLVERI 228
           A    L  +   W   +   GI   ++    YL I        H PP         + RI
Sbjct: 184 APLGGLFLDHIGWRTLF---GIQVPMIMFCSYLTITNVNIKLLHVPPRKERFTWKNLSRI 240

Query: 229 DVAGSVTGV 237
           D+ GS++ V
Sbjct: 241 DIFGSLSLV 249

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 74/177 (41%), Gaps = 19/177 (10%)

Query: 71  WFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCRA 130
           W A++F LT   F  + G+L D  G K   +    ++ +  +L  F+   N   F   RA
Sbjct: 75  WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFA--RNVTEFSIARA 132

Query: 131 FQGIGP-AFTLPNAIAI--IARTYRPGRKQ---NMIFSLFGACAPSGFVVGAVFSSLLSE 184
             GIG        +IA+  I      G  Q   N++F L       G ++GA    +  E
Sbjct: 133 ICGIGAGGLNAIGSIAVSDICTARERGVYQGYANIVFGL-------GQLLGAPLGGVFIE 185

Query: 185 FAWWPWAYWI---MGITCFLLGVAGY-LVIPHHPPIHPDEKCSLVERIDVAGSVTGV 237
              W   + +   + + C +L +    + + H PP+        + RID+ GS++ V
Sbjct: 186 TIGWRALFGVQVPVIMLCSVLAIKNINIKLFHVPPMKERYTLKNLSRIDIFGSLSLV 242

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 60/133 (45%), Gaps = 15/133 (11%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           ++G L D FG +   + G L Y + SI LA    Y   IF  C ++  GI P   + + +
Sbjct: 155 VSGGLADCFGRRPIILAGMLIYVIASIGLACAPSYGVIIFLRCIQSI-GISPTIAISSGV 213

Query: 145 AIIARTYRPGRKQNMIFSLFGACAPSGFVV-GAVFSSLLSEF--AWWPWA--YWIMGITC 199
            +   T +  R      +  GA   SGFV+ G  F SL+     A W W   +W + I C
Sbjct: 214 -VGDFTLKHERG-----TFVGAT--SGFVLLGQCFGSLIGAVLTARWDWRAIFWFLTIGC 265

Query: 200 FLLGVAGYLVIPH 212
               +  +L++P 
Sbjct: 266 GSCFLIAFLILPE 278

>Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138C
           (TPO2) -  [contig 96] FULL
          Length = 597

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 154 GRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGIT--CFLLGVAGYLVIP 211
            +++ +  SLF A    G V+G +  SLLS +  W W YW M I   C    +A ++   
Sbjct: 241 NKERGVAMSLFSAAPFLGPVMGPIVGSLLSVYCSWRWVYWFMVILSGCLYAVMAVFMPET 300

Query: 212 HH 213
           HH
Sbjct: 301 HH 302

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 57/135 (42%), Gaps = 19/135 (14%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           ++G L D FG +   + G L Y + SI LA    Y   IF  C    Q IG + T+  + 
Sbjct: 154 VSGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRC---IQSIGISPTIAISS 210

Query: 145 AIIARTYRPGRKQNMI-----FSLFGACAPSGFVVGAVFSSLLSEFAWWPWA--YWIMGI 197
            ++        +   +     F L G C   G ++GAV +      A W W   +W + I
Sbjct: 211 GVVGDFTLKHERGTFVGATSGFVLLGQCF--GSLIGAVLT------ARWDWRSIFWFLTI 262

Query: 198 TCFLLGVAGYLVIPH 212
            C    +  +L++P 
Sbjct: 263 GCGSCFLIAFLILPE 277

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 170/407 (41%), Gaps = 53/407 (13%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
           ++SW A+++ L+  TF  + G++ D FG K   V   + + +  ++ G S   +  +   
Sbjct: 147 KVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS--KSFWWLVI 204

Query: 128 CRAFQGIG-------PAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSS 180
            R   G+G        + T+ + + +  R    G   N+ + L  AC   G +VG  FS 
Sbjct: 205 ARFVAGVGGGGLTSMSSITITDLVPLRERAMYQG-ICNVFYGLGTAC---GGIVGGWFS- 259

Query: 181 LLSEFAWWPWAYWIM----GITCFLLGVAGYLVIPHHPPIHPDEKCSLVER----IDVAG 232
                  W  A+ I      I+  LL +  +L +P        +    ++R    ID  G
Sbjct: 260 --DNKGGWRMAFLIQVPLSAIS--LLVIILHLKLPSKRATRNQDNS--IKRKLLAIDWLG 313

Query: 233 SVTGVVGLILFNFAWNQGPVVGWETSY---TYALLIVGSAF-LAAFGFIESR-AKHPLLP 287
           + T V+ L+LF    + G   G E +Y   T+AL+++ S      F ++E R A  P+LP
Sbjct: 314 ASTLVIFLVLFLLTASLG---GKEIAYGSRTFALMLISSLLSCLVFIYVELRVAADPILP 370

Query: 288 VRKLSSDTIFVMGCIAAGW--------SSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVA 339
           +R L+  +  V+G   + W        +S+ + +Y++  L     +  P     + +P  
Sbjct: 371 LRFLAIRS--VLGSSLSNWFCMMATMTTSYYLPIYFSGVL-----NMSPTDVGKRLMPNF 423

Query: 340 ISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV-GSILVATVPVSQTYWAQTFVSIIVMPW 398
            S    ++   + + +T       +   A  V G + +  +      W Q ++ ++V   
Sbjct: 424 FSVAFGSLGAGYYMKKTRKYYWFSLIFCAVAVLGQLQILLIDPKIPTWRQ-YILLLVPGV 482

Query: 399 GMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTI 445
           G  +    A + +  A+P  HQ    S+     +   ++G+   G I
Sbjct: 483 GTSVLITVALLAMIAAVPHEHQAATTSISYAFRSAGCTLGVSIGGAI 529

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 100/244 (40%), Gaps = 26/244 (10%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
           ++ W A+++ L+   F  + G+L D FG K   +   L +    I+ G S   N + +  
Sbjct: 433 KVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWG- 491

Query: 128 CRAFQGIG-------PAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSS 180
            R   GIG          T+ + + + +R       Q +    FG     G V+G +F  
Sbjct: 492 -RFVAGIGGGGITSMTTITVSDIVPLRSRAVY----QGICNFFFGLGTAFGGVIGGIF-- 544

Query: 181 LLSEFAWWPWAYW----IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTG 236
            +     W   +W    + G++  L  +  +LV+P            L+ R+D  GS++ 
Sbjct: 545 -VDHQYGWRMVFWSQVPVSGLSTLL--ICSFLVVPRIKNYEVSLGRKLM-RVDWLGSISM 600

Query: 237 VVGLILFNFAWNQ--GPVVGWETSYTYALLIVGSAFLAAFGFIES-RAKHPLLPVRKLSS 293
           ++ L  F        G  +  ++   + L++  S     F   E   A  P+LP+R LS+
Sbjct: 601 ILWLTSFLLITTMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSN 660

Query: 294 DTIF 297
            ++ 
Sbjct: 661 RSVL 664

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 75/348 (21%), Positives = 132/348 (37%), Gaps = 52/348 (14%)

Query: 50  SIVPLQIIGDSFGIK--NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWY 107
            IV +  + D+ GIK  + G + W  + ++LT   F+L+ GRL +  G  +  ++  + +
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIF 83

Query: 108 ALWSILAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSL---F 164
            + S+++  S     +     R   G G +     A  +     +   +  MI +L   +
Sbjct: 84  EVGSLISALSNSMGTLI--SGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSY 141

Query: 165 GACAPSGFVVGAVFSSLLSEFAWWPWAYWI-MGITCFLLGVAGYLVIPHH--PPI----- 216
                 G  +G  F+  LS    W W ++I + I  F L +  +        P +     
Sbjct: 142 VIAEGVGPFIGGAFNEHLS----WRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSK 197

Query: 217 -------HPDE--KCS--------LVERIDVAGSVTGVVGLILF---------NFAWNQG 250
                    DE  K S         V ++D+ G      G  L          NFAWN  
Sbjct: 198 IKSIMSYKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSS 257

Query: 251 PVVGWETSYTYALLIVGS---AFLAAFGF-IESRAKHPLLPVRKLSSDTIFVMGCIAAGW 306
            ++   T     L++  +    FL   G   E++   PLL     S+  IF    +   +
Sbjct: 258 TIISLFTVGPILLILFCAYDFHFLPLLGLRYENKRTKPLLTWSIASNSGIFT-SSVTGFF 316

Query: 307 SSFG--IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFL 352
           S F   +   Y  QL   +  + P L+S     ++I  + A M+  +L
Sbjct: 317 SCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSIPAIIATMAIAYL 364

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 15/133 (11%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           I+G L D +G +   +MG L Y   SI LA    Y   +F  C ++  GI P   + N+ 
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFLRCLQS-AGISPIIAI-NSG 198

Query: 145 AIIARTYRPGRKQNMIFSLFGACAPSGF-VVGAVFSSL----LSEFAWWPWAYWIMGITC 199
            +   T +  R      +  GA   SGF ++G  F SL    L+    W   +W + I C
Sbjct: 199 VVGDFTLKHERG-----TFVGAV--SGFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGC 251

Query: 200 FLLGVAGYLVIPH 212
               +  +L++P 
Sbjct: 252 GTCMIINFLILPE 264

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 59/150 (39%), Gaps = 25/150 (16%)

Query: 173 VVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGY-LVIPHH------------PPIHPD 219
           V G + SSL    A + W  W  GI C ++  +   LV+P+             PP    
Sbjct: 198 VSGNIVSSLAGSVAPYKWR-WGYGIFCIIVPFSTLILVLPYAYAQYISWRNGTLPPFKLK 256

Query: 220 EKC--------SLVERIDVAGSV--TGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSA 269
           EK            E I++ G +  T  + L+L       G    W   Y  A+++VG  
Sbjct: 257 EKGQNLRQTIWKFAEDINLIGIILFTAFLVLVLLPLTIAGGATSKWREGYIIAMIVVGGF 316

Query: 270 FLAAFGFIESR-AKHPLLPVRKLSSDTIFV 298
               F   E R AK+P +P   L   TI+V
Sbjct: 317 LGFIFLIWELRFAKNPFIPRVYLGDPTIYV 346

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 79/201 (39%), Gaps = 27/201 (13%)

Query: 57  IGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGF 116
           + + F   +  Q  W A++F LT   F  + G+L D  G K   +    ++ L   L  F
Sbjct: 67  VAEEFEESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFLTCF 124

Query: 117 SVYSNQIFFDCCRAFQGIGPAFTLPNA-----IAIIARTYRPGRKQ---NMIFSLFGACA 168
           +    Q  F   RA  GIG      NA     ++ I  T   G  Q   N++F L     
Sbjct: 125 AQNITQ--FSIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGL----- 175

Query: 169 PSGFVVGAVFSSLLSEFAWWPWAYWI---MGITCFLLGVAGYLV-IPHHPPIHPDEKCSL 224
             G ++GA    L  +   W   + +   M + C  L      V + H PP         
Sbjct: 176 --GQLLGAPLGGLFIDSVGWRVIFGVQVPMLLLCSTLATRNINVKLAHIPPRKERFTWKN 233

Query: 225 VERIDVAGS--VTGVVGLILF 243
           + RID+ GS  + G +  +LF
Sbjct: 234 LSRIDIFGSLALVGTISSLLF 254

>KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {ON}
           weakly similar to uniprot|P53283 Saccharomyces
           cerevisiae YGR138C TPO2 Polyamine transport protein
          Length = 606

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 154 GRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGI--TCFLLGVAGYLVIP 211
            +++ +  SLF A    G V+G +  SLLS    W W YW M I   C    +A +L   
Sbjct: 254 NKERGVAMSLFSAAPFLGPVMGPIVGSLLSVKCSWRWVYWFMVIFSGCLYAVMAVFLPET 313

Query: 212 HH 213
           HH
Sbjct: 314 HH 315

>YML049C Chr13 complement(174220..178305) [4086 bp, 1361 aa] {ON}
           RSE1Protein involved in pre-mRNA splicing; component of
           the pre-spliceosome; associates with U2 snRNA; involved
           in ER to Golgi transport
          Length = 1361

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 8/56 (14%)

Query: 299 MGCIAAGWSSFGIWVYYTWQ---LMANLRDQPPLLSSAQFV--PVAISGLCAAMST 349
           M C+    SS   WV YTW+    +  L+DQ  +LS ++FV   VAI+G+C+  S+
Sbjct: 816 MSCVVCHSSS--TWVSYTWKNVWTIRQLKDQ-NMLSCSKFVNADVAINGVCSISSS 868

>KLTH0A01034g Chr1 (100382..101902) [1521 bp, 506 aa] {ON} similar
           to uniprot|P53322 Saccharomyces cerevisiae YGR260W TNA1
           High affinity nicotinic acid plasma membrane permease
          Length = 506

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 44/115 (38%), Gaps = 9/115 (7%)

Query: 129 RAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLS----- 183
           R F G+  + T      I++  Y P + Q      F +   +G   G++   + +     
Sbjct: 155 RVFLGVAESATFGLIFYILSSYYTPRQAQRRFSCFFSSVTLAGAAGGSIARQIYTGIGNK 214

Query: 184 EFAWWPWAYWIMGITCFLLGVAGYLVIPHHPP----IHPDEKCSLVERIDVAGSV 234
             A W W + I G     +    + + P  P     + P+EK  L E++ +   V
Sbjct: 215 HLANWRWIFIIEGAATVFIAFLLFFITPDFPETAKFLKPNEKAFLKEKLQLYSRV 269

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 15/133 (11%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           + G L D FG +   + G L Y + S+ LA    Y   IF  C ++  GI P   + + +
Sbjct: 155 VCGGLADCFGRRPIILGGMLVYVVASVGLACAPSYGVIIFLRCVQSI-GISPTIAISSGV 213

Query: 145 AIIARTYRPGRKQNMIFSLFGACAPSGFVV-GAVFSSLLSEF--AWWPWA--YWIMGITC 199
            +   T +  R      +  GA   SGFV+ G  F SL+     A W W   +W + I C
Sbjct: 214 -VGDFTLKHERG-----TFVGA--TSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGC 265

Query: 200 FLLGVAGYLVIPH 212
               +  + ++P 
Sbjct: 266 GTCFLIAFFILPE 278

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 79/191 (41%), Gaps = 21/191 (10%)

Query: 57  IGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGF 116
           + + F   +  Q  W A++F LT   F  + G+L D  G K   ++   ++ L  +L  F
Sbjct: 78  VAEEFQESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCLLTCF 135

Query: 117 SVYSNQIFFDCCRAF-QGIGPAFTLPNAIAI--IARTYRPGRKQ---NMIFSLFGACAPS 170
           +   N   F   RA     G   +  ++I +  I      G  Q   N++FS       +
Sbjct: 136 A--RNVTEFSIARAICGIGGGGISAMSSITVSDICTARERGAYQGYANVVFS-------T 186

Query: 171 GFVVGAVFSSLLSEFAWWPWAYWI---MGITCFLLGVAGY-LVIPHHPPIHPDEKCSLVE 226
           G ++GA       +   W   + +   M + C +LG     + + H PP+        + 
Sbjct: 187 GQLLGAPLGGFALDRIGWRAIFGLQVPMLLICMVLGYRNVNIKLAHVPPLEERFTWKNLS 246

Query: 227 RIDVAGSVTGV 237
           RID+ GS+T V
Sbjct: 247 RIDIGGSITLV 257

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query: 128 CRAFQGI---GPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSE 184
           CR F G+    P   +P A A +  T   G K   +FSLF    P   ++  VF S +++
Sbjct: 294 CRFFSGVIGSAPMAVVPAAFADMFDTNLRG-KAICLFSLFVFVGP---ILSPVFGSYMAQ 349

Query: 185 FAWWPWAYWIMGITCFLLGVAGYLVI-----PHHPPI 216
              W W  +++GI     GV   L++      HHP I
Sbjct: 350 RTTWRWLEYVVGI---FAGVVFVLIVLFYEETHHPSI 383

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 58/134 (43%), Gaps = 17/134 (12%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           I+G L D FG +   ++G L Y + SI LA    Y   +F    R  Q IG + T+  + 
Sbjct: 145 ISGGLADVFGRRPVILIGMLIYVVASIGLACAPSYGVIVFL---RIIQSIGISPTIAISS 201

Query: 145 AIIARTYRPGRKQNMI-----FSLFGACAPSGFVVGAVFSSLLSEFAW-WPWAYWIMGIT 198
            ++        +   +       L G C   G ++GAV ++     AW W   +W + I 
Sbjct: 202 GVVGDFTLKHERGTFVGATSGLVLLGQCF--GSLIGAVLAA-----AWNWRAIFWFLTIG 254

Query: 199 CFLLGVAGYLVIPH 212
           C    +  +L++P 
Sbjct: 255 CGTSFIIAFLLLPE 268

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 67/170 (39%), Gaps = 9/170 (5%)

Query: 54  LQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSIL 113
           L  I D F   +  ++ W  + +SL+   F L+ GR    FG K   ++  + + + S++
Sbjct: 44  LNTIADKFNAYS--KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLV 101

Query: 114 AGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFV 173
              S   + I     R   G G A  +   +  IA +      +  I +L          
Sbjct: 102 IAVSNSMDMII--GGRVIAGCG-ASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAVASA 158

Query: 174 VGAVFSSLLSEFAWWPWAYWI-MGITCFLLGVAGYLVIPHHPPIHPDEKC 222
           +G      L+E+  W W ++I + I    LGV     + ++P      KC
Sbjct: 159 LGPYIGGALTEYVTWRWCFYINLPIGGLALGV---FYLSYNPAQRKVLKC 205

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 147 IARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAG 206
           IA +  P   ++ I S+F      G  +G   SS+ SE   + W Y  + +TCF  G+A 
Sbjct: 496 IAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSV-SEDPKYVWLYTGLAVTCFCAGIAF 554

Query: 207 YLVIPHH 213
           +    H+
Sbjct: 555 WFTFKHY 561

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/128 (19%), Positives = 53/128 (41%), Gaps = 5/128 (3%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           I+G L D +G +   + G L + + SI +A    Y   +F  C ++  GI P   + + +
Sbjct: 145 ISGGLADVYGRRPVILGGMLIFVVASIGIAKAPSYGVIVFLRCIQSI-GISPTIAISSGV 203

Query: 145 AIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGV 204
                 +   R++             G  +G +  ++++    W   +W + I C    +
Sbjct: 204 V---SDFTVKRERGTFVGATSGLVLIGQGIGPLLGAVITAALHWRAVFWFLTIGCGSCMI 260

Query: 205 AGYLVIPH 212
            G+ ++P 
Sbjct: 261 IGFFLLPE 268

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 167 CAPSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPH 212
           C+  G V+G +F  L+ E   W W +WI  I   +  V  + ++P 
Sbjct: 248 CSVGGTVIGPIFGGLMEEHLSWHWNFWIQLIFNGVTQVLHFFIVPE 293

>KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {ON}
           uniprot|Q701Q9 Kluyveromyces lactis KLLA0F10043g jen2
           Carboxylic acid permease
          Length = 528

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 7/96 (7%)

Query: 85  LIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCRAFQGI--GPAFTLPN 142
           LI G LGD +G K  FV+      +  I  GF V S   F   CRA  GI  G  F + +
Sbjct: 132 LIFGYLGDRYGRKYSFVLTMALIIVIQIGTGF-VNSFSAFLG-CRAIFGIIMGSVFGVAS 189

Query: 143 AIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVF 178
           A A+      P + ++++  +F      G+++G VF
Sbjct: 190 ATAL---ENAPNKAKSILSGIFQEGYAFGYLLGVVF 222

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 59/133 (44%), Gaps = 15/133 (11%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           I+G L D +G +   + G L Y + SI LA  + Y   +F  C ++  GI P   + + +
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFLRCVQS-AGISPLIAISSGV 210

Query: 145 AIIARTYRPGRKQNMIFSLFGACAPSGF-VVGAVFSSL----LSEFAWWPWAYWIMGITC 199
            +   T +  R      S  GA   SGF ++G  F SL    L+    W   +W + I C
Sbjct: 211 -VGDFTTKSERG-----SFVGAV--SGFALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 200 FLLGVAGYLVIPH 212
               V  + ++P 
Sbjct: 263 GTCFVINFFLLPE 275

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 15/133 (11%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           I+G L D +G +   ++G L Y   SI LA  + Y   +F  C ++  GI P   + N+ 
Sbjct: 141 ISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFLRCLQS-AGISPIIAI-NSG 198

Query: 145 AIIARTYRPGRKQNMIFSLFGACAPSGF-VVGAVFSSL----LSEFAWWPWAYWIMGITC 199
            +   T +  R      +  GA   SGF ++G  F SL    L+    W   +W + I C
Sbjct: 199 VVGDFTVKQERG-----TFVGAV--SGFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGC 251

Query: 200 FLLGVAGYLVIPH 212
               +  +L++P 
Sbjct: 252 GTCMLVNFLLLPE 264

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 227 RIDVAG--SVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKH 283
           ++D+ G  S+  ++GLIL       G    W T+     LI+G  ++  F F E+R A H
Sbjct: 288 KLDIFGVLSLMIILGLILTPLTLAGGETAEWRTAKVIVPLILGFCWIPVFAFWENRIATH 347

Query: 284 PLLPVRKLSSDTIF 297
           P+ P        ++
Sbjct: 348 PIAPTDMFRDRGVY 361

>KLTH0C00330g Chr3 (25162..26811) [1650 bp, 549 aa] {ON} similar to
           uniprot|Q12235 Saccharomyces cerevisiae YLL055W
           Hypothetical ORF
          Length = 549

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 62/151 (41%), Gaps = 13/151 (8%)

Query: 91  GDTFGHKKFFV--MGFLWYALWSILAGF--SVYSNQIFFDCCRAFQGIGPAFTLPNAIAI 146
           G+ F  +KF +  + F+  ALWSI+     + Y+ Q  +   R F G   +  +P+    
Sbjct: 144 GNLFFLQKFPLSRVMFVMTALWSIIIFLHCTAYNYQGVY-ALRFFLGFVESIGVPSLNTT 202

Query: 147 IARTYRPGRKQNMIFSLFGACA----PSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLL 202
           + +   P  K       + AC     P GF+   V +   S    W     I+G   FL 
Sbjct: 203 MGQFLTPQEKSATAPVFYAACMGVTIPVGFIAYGVLNITNSSIPTWKIFSIIIGCCTFLS 262

Query: 203 GVAGYLVIPHHPP----IHPDEKCSLVERID 229
            V  +LV P +P     +   EK  ++ R+ 
Sbjct: 263 SVLIFLVYPSNPTDAKFLSKKEKIWVIRRVQ 293

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 2/91 (2%)

Query: 45  AGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGF 104
           A L  +IV   +   +   +    ++W A+A+ LT      + G++ D  G +K  + G 
Sbjct: 73  AALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGE 132

Query: 105 LWYALWSILAGFSVYSNQIFFDCCRAFQGIG 135
           + +AL  +L  F+    Q+     RA  GIG
Sbjct: 133 VIFALGVLLCNFANTIPQLAI--ARAICGIG 161

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 73/184 (39%), Gaps = 11/184 (5%)

Query: 57  IGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGF 116
           + + F   +  Q  W A++F LT   F  + G+L D  G K   +M + +  +  +L   
Sbjct: 62  VAEEFSESDKKQ--WIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLLTCL 119

Query: 117 SVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFS-----LFGACAPSG 171
           +   N   F   RA    G      NA + I  +     K+  I+      +FG     G
Sbjct: 120 A--RNVTEFAVARAI--CGIGGGGINACSSITVSDICTAKERGIYQGYANIVFGMGQMLG 175

Query: 172 FVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVA 231
             +G +F   +   A +     ++ ++ FL      + + H PPI        + RID  
Sbjct: 176 APLGGLFIDTIGWRAIFGIQVPVVMVSAFLAYRNVNIKLSHVPPISERFTRKNLSRIDFL 235

Query: 232 GSVT 235
           GSVT
Sbjct: 236 GSVT 239

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 63/153 (41%), Gaps = 11/153 (7%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
           ++ W  + +SL     +LI GR+    G K   +   + + + S+++  +   N +    
Sbjct: 97  EIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLI--G 154

Query: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAW 187
            R   GIG    + +   +I  T     K+ M+ ++  +      VVG     + +    
Sbjct: 155 GRVIAGIGGC-GIQSLSFVIGSTLVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSVT 213

Query: 188 WPWAYWI---MGITCFLLGVAGYLVIPHHPPIH 217
           W W ++I   +G   F L      V+ ++P +H
Sbjct: 214 WRWCFYINLPIGGLAFFL-----FVLFYNPGLH 241

>SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]
           {ON} weakly similar to uniprot|Q06451 Saccharomyces
           cerevisiae YPR156C TPO3 Polyamine transport protein
          Length = 621

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 154 GRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGI--TCFLLGVAGYLVIP 211
            +++ +  S+F A    G V+G +  SLLS    W W YW M I   C    +  +L   
Sbjct: 259 NKERGVAMSVFSAAPFMGPVMGPIVGSLLSVKCSWRWVYWFMLIFSACLYGVMVVFLPET 318

Query: 212 HH 213
           HH
Sbjct: 319 HH 320

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 79/194 (40%), Gaps = 11/194 (5%)

Query: 55  QIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILA 114
           Q IG+ F   +    SW  +++ +T  +F  + G   D  G +K      + +++  +  
Sbjct: 92  QTIGNEFNHMDLS--SWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGC 149

Query: 115 GFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVV 174
           G S+  N ++    RAF GIG    +  +  I+     P  K+ +  +        G + 
Sbjct: 150 GISI--NILWLSFMRAFTGIGGGGLITLS-TIVNSDMIPTSKRGIFQAFQNLLLGLGAIC 206

Query: 175 GAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPI------HPDEKCSLVERI 228
           GA F  +++    W W + +         + G+L + +             +   +++ I
Sbjct: 207 GASFGGVITSSIGWRWCFLLQVPISLAGALIGHLYVRNQDEYERRKSKESSQTKEMLKHI 266

Query: 229 DVAGSVTGVVGLIL 242
           D +G+   ++GL L
Sbjct: 267 DFSGAFLIIIGLTL 280

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 73/179 (40%), Gaps = 9/179 (5%)

Query: 64  KNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI 123
           +   +  W A+++ LT   F  + G+L D  G K   +    ++ L  +L  F+    Q 
Sbjct: 69  QESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANSVTQ- 127

Query: 124 FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPS-GFVVGAVFSSLL 182
            F   RA  G+G      NA++ I  +    +++  I+  +       G ++GA    L 
Sbjct: 128 -FAIARAICGVGGGGI--NAMSSITVSDICTQRERGIYQGYANIVFGLGQILGAPIGGLF 184

Query: 183 SEFAWWPWAYWIMGITCFLLGVAGY----LVIPHHPPIHPDEKCSLVERIDVAGSVTGV 237
            +   W   + +   T  L     +    + + H  P+    K S + RID+ GS T V
Sbjct: 185 IDTLGWRILFGLQVPTILLCSSLVHKNVNIKLSHLLPVEERFKWSNLSRIDILGSSTLV 243

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 87  AGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIA 145
            G L D FG +   + G L Y + SI LA  + Y   +F  C ++  GI P  ++ +  A
Sbjct: 147 CGGLADLFGRRPVILTGMLIYTVASIGLACSNSYGVIVFLRCLQS-AGISPTISISSG-A 204

Query: 146 IIARTYRPGRKQNMIFSLFGACAPSGFVV-GAVFSSL----LSEFAWWPWAYWIMGITCF 200
           +   T +  R      +  GA   SG V+ G  F SL    L+    W   +W + I C 
Sbjct: 205 VGDFTVKSERG-----TFVGAV--SGLVLLGQAFGSLIGAALAASFNWRAIFWFLTIGCG 257

Query: 201 LLGVAGYLVIPH 212
           +  +  + V+P 
Sbjct: 258 VSMMVAFFVLPE 269

>NCAS0H01880 Chr8 complement(361743..363464) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 250 GPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIAAG 305
           G V GW+T  T +  +  + FL  FG   S  KH L  VR     +IF +GC   G
Sbjct: 79  GFVFGWDTG-TISGFVAQTDFLQRFGQHHSNGKHYLSKVRMGLIVSIFNIGCAVGG 133

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 4/117 (3%)

Query: 88  GRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAII 147
           G +GD +G K  F++   +  +  I+ GF +  N  +F   RAF G+       N+ A  
Sbjct: 131 GYIGDRYGRKVSFIINLFFMMVLEIITGF-IKHNFKYFLIARAFFGVVLGGIFGNSAAQC 189

Query: 148 ARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFA--WWPWAYWIMGITCFLL 202
                P    + I   F      G+++  +F+  L++     W   +W      FLL
Sbjct: 190 FDDC-PPEAHSFISGFFQQGYTLGYLLAVIFTRALADTTKDRWRSCFWFAAGITFLL 245

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 362 MIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQG 421
           ++I ++ + VG+I+  +   +Q  W Q F+  I+  WG+      A +++S   P   +G
Sbjct: 148 LMIVIVLYVVGTIIQIS---AQDKWYQYFIGKIIYGWGVGGVSVLAPMLISETAPKHLRG 204

Query: 422 LAASLVNTIINYSISIG 438
              S    ++ + I +G
Sbjct: 205 TLISCYQLMVTFGIFLG 221

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 223 SLVERIDVAGSV--TGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR 280
            +  +ID+ G+V  T  +GLIL       G    W      A L++G A L  F F E++
Sbjct: 272 DIFNQIDIVGTVLVTAALGLILVPLTLAGGVSERWHEPGIIATLVIGIALLLVFLFWEAK 331

Query: 281 -AKHPLLPVRKLSS 293
            AK+  LP   L  
Sbjct: 332 FAKNAALPFNLLKD 345

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 92/371 (24%), Positives = 158/371 (42%), Gaps = 60/371 (16%)

Query: 57  IGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDT-FGHKKFFVMGFLWYALWSILAG 115
           I + F   +  Q  W A++F LT   F  + G+L D   G K   ++   ++ L  I++ 
Sbjct: 67  IAEEFQESDKKQ--WIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGLIISC 124

Query: 116 FSVYSNQIFFDCCRAFQGI-GPAFTLPNAIAI--IARTYRPGRKQNMIFSLFGACAPSGF 172
           F+    Q  F   RA  GI G   +  ++IA+  I      G  Q     +FG+    G 
Sbjct: 125 FAQNVTQ--FAIGRAVCGIGGGGVSAMSSIAVSDICTAKERGMYQGYANIVFGSGQLLGA 182

Query: 173 VVGAVFSSLLSEFAWWPWAYWI---MGITC-FLLGVAGYLVIPHHPPIHPDEKCSLVERI 228
            +G +  + +     W   + I   M + C FL G    + + H P  +       + R+
Sbjct: 183 PLGGLLITTIG----WRAIFAIQVPMALFCMFLTGRNVNIKLAHLPSRNERFTLKNLSRL 238

Query: 229 DVAGSVTGVVG----LILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHP 284
           D+ GS T V+     L LF+ + N+  +  + T  T+A+ I    F          AK  
Sbjct: 239 DLLGSCTLVLSISGLLFLFSTSMNRTWISAF-TIVTFAIFIYNERFW---------AKER 288

Query: 285 LLPVRKLSSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGL- 343
           ++P         F + C  +G +S  + V  ++ +  ++   P  L   Q V +A SG+ 
Sbjct: 289 IIP---------FDLLCGTSGITSL-LTVLSSFIMFGDVFRSPIYLQIVQNVSLAKSGIF 338

Query: 344 -------CAAMS--TEFLLTRTS----PSTVMIIAMIAF--TVGS----ILVATVPVSQT 384
                  CAA S  T +++ RT+      T +I+ ++ F   VG+    IL+A +  + T
Sbjct: 339 ILFGSVACAATSVLTGWIIRRTTMDLVKCTYLIVLVMIFLQLVGTASNAILIANLIPNNT 398

Query: 385 YWAQTFVSIIV 395
            +A   V+I V
Sbjct: 399 TYADKDVAIKV 409

>TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.395
           YHR094C
          Length = 571

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 250 GPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIAAG 305
           G V GW+T  T +  +  S FL  FG + S  +H L  VR      IF +GC   G
Sbjct: 77  GFVFGWDTG-TISGFVNQSDFLRRFGQVNSEGEHYLSKVRMGLIVAIFNVGCAIGG 131

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 54/131 (41%), Gaps = 11/131 (8%)

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
           +  W  + +SL      L+ GR+    G K   +   + + + S+++G +   N +    
Sbjct: 114 KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLI--G 171

Query: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLL----S 183
            R   G+G +  + +   +I       R++ +I     AC  S F V +V    L    +
Sbjct: 172 GRVIAGVGGS-GIQSLAFVIGSNLVDERRRGLII----ACMSSAFAVASVIGPFLGGAFT 226

Query: 184 EFAWWPWAYWI 194
             A W W ++I
Sbjct: 227 THATWRWCFYI 237

>Kwal_33.15276 s33 (1039883..1041541) [1659 bp, 552 aa] {ON} YLR004C
           - 1:1 [contig 94] FULL
          Length = 552

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 93/230 (40%), Gaps = 23/230 (10%)

Query: 8   SHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPG 67
           SHE    LL +        L   + +M L  A L   A +    +   + GD F   N G
Sbjct: 96  SHELDSKLLRKVDWYILPFLCCTYLLMFLDKALLNYAASMG---IKKHLKGDEFS--NLG 150

Query: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127
            +   A  F+    TF +    +    G    F+M  LW A+ +  +    Y++ +    
Sbjct: 151 TIFSAAYIFAEPFVTFCIQRYPVSKVMG---VFIM--LWGAVLACHSACKSYASLMIV-- 203

Query: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLL----- 182
            R   G+  + +    IAI +  Y    +Q+     +   A +G++VG + S        
Sbjct: 204 -RTLLGLFESSSAVGCIAI-SGMYYTKSEQSARIGFWATQAGTGYIVGGLISFGFLHYHG 261

Query: 183 SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPP----IHPDEKCSLVERI 228
           +EF  W   + ++G+   L G+A ++ +P +      ++ DEK  ++  I
Sbjct: 262 TEFTSWQIMFLVVGLVTVLFGIATFVYLPDNVTNAWFLNEDEKVEVLRHI 311

>Skud_14.207 Chr14 complement(380245..382257) [2013 bp, 670 aa] {ON}
           YNL125C (REAL)
          Length = 670

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 6/80 (7%)

Query: 144 IAIIARTYRPG-----RKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGIT 198
           I + A T  PG     R   M  SL G  A  G V G   + +LS+F    W   I+GI+
Sbjct: 320 IFVPATTVLPGWFLKKRAVAMGVSLLGTGA-GGVVYGLATNKMLSDFGNTRWCLRILGIS 378

Query: 199 CFLLGVAGYLVIPHHPPIHP 218
           C L  +    ++    P  P
Sbjct: 379 CSLSVLVAIALLKERNPTPP 398

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 50  SIVPLQIIGDSFGIK--NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWY 107
            IV +  + D+ GIK  + G + W  + ++L+   F+L+ GRL +  G  +  ++  + +
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 108 ALWSILAGFS 117
            + S+++  S
Sbjct: 84  EIGSLISALS 93

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 55/135 (40%), Gaps = 19/135 (14%)

Query: 86  IAGRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI 144
           I G L D+ G +   +   L Y    I LA    Y+  I   C +A  GI P   + + I
Sbjct: 133 IMGGLADSMGRRPVVLSSVLVYCCACIGLACSHTYAQIIVLRCLQA-AGISPVIAINSGI 191

Query: 145 --AIIARTYRPGRKQNMIFSLFGACAPSGF-VVGAVFSSLLSE--FAWWPWA--YWIMGI 197
              I  R  R G    +          SGF V+G+ F +L+     A W W   +W + I
Sbjct: 192 MGDITTRAERGGYVGYV----------SGFQVIGSAFGALIGAGLSATWSWRSIFWFLAI 241

Query: 198 TCFLLGVAGYLVIPH 212
              +  VA  +++P 
Sbjct: 242 GSGVCLVASIIILPE 256

>SAKL0E11110g Chr5 (933600..935456) [1857 bp, 618 aa] {ON} similar
           to uniprot|P53918 Saccharomyces cerevisiae YNL125C ESBP6
           Protein with similarity to monocarboxylate permeases
           appears not to be involved in transport of
           monocarboxylates such as lactate pyruvate or acetate
           across the plasma membrane
          Length = 618

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 1/86 (1%)

Query: 133 GIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAY 192
           GIG +F    A  ++   +   R  +M  SL G  A  G       ++L+       WA 
Sbjct: 264 GIGISFIFVPATTVLPGWFLKKRSFSMGISLIGTGA-GGVTYSLSVNALIQRTGDQKWAL 322

Query: 193 WIMGITCFLLGVAGYLVIPHHPPIHP 218
             + ITC +  +   L+I    P+ P
Sbjct: 323 RTLAITCTVTCIVAILLIKQRVPLKP 348

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 63/151 (41%), Gaps = 10/151 (6%)

Query: 51  IVPLQIIGDSFGIK-NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYAL 109
           IV L ++  +  +  N  +++W  +   +T     ++ G +GD FG K  F++     ++
Sbjct: 63  IVSLNVVKIAEDLNVNDEKVTWGMTIALMTRTIGAVLYGYIGDQFGQKASFMINIGMISI 122

Query: 110 WSILAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAP 169
             +L GF+  +   +F  CRA+ G+        A         P   ++ +   F     
Sbjct: 123 LQLLTGFA--TTFPYFIACRAYFGVELGGCFGTATTQCLDDL-PENARSWVSGGFQQAYS 179

Query: 170 SGFVVGAVFSSLLSEFAWWPWAYWIMGITCF 200
            GF+V  + + +L++     W       TCF
Sbjct: 180 LGFLVATILTRVLADTTEKRWR------TCF 204

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 63/152 (41%), Gaps = 17/152 (11%)

Query: 55  QIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILA 114
           Q+IG+ FG  +    SW  +A+ +T  +F  + G   DT G +         +AL     
Sbjct: 68  QLIGNEFG--DVKLSSWITTAYLITCTSFQPLYGSFSDTLGRRHCLFFANTIFALGCFGC 125

Query: 115 G--FSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGF 172
           G   ++YS  +     RA  GIG    +  +  II     P +K+ +  +       +G 
Sbjct: 126 GTTTTIYSLILM----RALTGIGGGGLITLS-TIINSDIIPAKKRGIYQAFQNVLLGTGA 180

Query: 173 VVGAVFSSLLSEFAWWPWAYWIMGITCFLLGV 204
           VVGA    L++    W W        CFLL V
Sbjct: 181 VVGASCGGLIATTMGWRW--------CFLLQV 204

>ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 538

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 50/128 (39%), Gaps = 9/128 (7%)

Query: 88  GRLGDTFGHKKFFVMGFLWYALWSI-LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAI-- 144
           G + DT G +   ++  L Y +  + +A  + YS  I   C +A  GI P   + + +  
Sbjct: 109 GNMADTLGRRPVILVSVLIYFVACLGIASCNTYSQLIGLRCLQA-AGISPVIAINSGMMT 167

Query: 145 AIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGV 204
            I  R  R G            C   G   GA+  + LS    W   +W + I   +  V
Sbjct: 168 DITTRAERGG-----YVGYTSGCQVLGSAFGALIGAGLSSRWGWRSVFWFLSIGSGICLV 222

Query: 205 AGYLVIPH 212
              L++P 
Sbjct: 223 ISTLLLPE 230

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,992,243
Number of extensions: 1697702
Number of successful extensions: 5709
Number of sequences better than 10.0: 222
Number of HSP's gapped: 5662
Number of HSP's successfully gapped: 232
Length of query: 498
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 384
Effective length of database: 40,409,475
Effective search space: 15517238400
Effective search space used: 15517238400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)