Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A04631g8.272ON57957926940.0
SAKL0H16808g8.272ON65760115580.0
ZYRO0C01430g8.272ON59058715160.0
TDEL0F039908.272ON63158814900.0
Kpol_543.448.272ON64359314700.0
KLTH0G13464g8.272ON59360314210.0
Kwal_56.237548.272ON58960013890.0
AGR076C8.272ON68654413930.0
TPHA0A017508.272ON63660013550.0
Kwal_26.6669singletonON59054412421e-164
TBLA0F030408.272ON90652512091e-155
Ecym_42988.272ON6785269621e-121
KLLA0F17776gna 1ON5535248201e-102
SAKL0C02178gsingletonON5655537624e-93
SAKL0E04246gna 1ON5655197005e-84
Smik_4.3638.272ON7655134584e-48
Kwal_26.6697singletonON5775454322e-45
YDR119W (VBA4)8.272ON7685704312e-44
Suva_13.2652.473ON5615764215e-44
Smik_13.2722.473ON5615554206e-44
Skud_13.2442.473ON5625454197e-44
YMR088C (VBA1)2.473ON5625224082e-42
NCAS0A078102.473ON5686154022e-41
Suva_2.2798.272ON7755193984e-40
KLTH0H05456gna 2ON5685343863e-39
Skud_4.3798.272ON7595273913e-39
CAGL0J01375g2.473ON5645813844e-39
TDEL0A024902.473ON5544803837e-39
NDAI0H022002.473ON5716073838e-39
KNAG0E025602.473ON5785533741e-37
Suva_4.553na 3ON5625583731e-37
SAKL0A07480gsingletonON5735563732e-37
Skud_2.423na 3ON5605473713e-37
SAKL0E02992g2.473ON5705543615e-36
ZYRO0G03234g2.473ON5625633608e-36
KLTH0E16720gsingletonON5745003572e-35
TPHA0G031502.473ON6005463459e-34
Kpol_467.242.473ON3703763341e-33
TDEL0C00120singletonON5695483394e-33
ZYRO0G21868gna 2ON6205723405e-33
Kwal_14.1585na 2ON5705483395e-33
Kwal_26.77552.473ON5595023131e-29
KLTH0D05434g2.473ON5764983131e-29
YBR293W (VBA2)na 3ON4744783063e-29
KLLA0F13684g2.473ON5713113051e-28
ABL040W2.473ON5674722934e-27
Smik_2.434na 3ON4744542871e-26
ZYRO0A00330gsingletonON5765562872e-26
ZYRO0G21890gsingletonON5764732863e-26
Ecym_73992.473ON5634672802e-25
KLTH0B00132gsingletonON5685102091e-16
Smik_6.22singletonON6365182046e-16
KLTH0B10142gsingletonON5684561884e-14
Skud_6.14singletonON6365021822e-13
Suva_10.9singletonON6375131725e-12
YPR198W (SGE1)singletonON5432361699e-12
SAKL0A00726gsingletonON5983001652e-11
KLTH0C10120gsingletonON6511521618e-11
Skud_16.503singletonON5432791609e-11
SAKL0C05588gsingletonON6771311546e-10
Smik_17.11singletonON5441551537e-10
KLTH0D16962gsingletonON5711761538e-10
Smik_16.81na 4ON6251941521e-09
Smik_11.368singletonON5805121502e-09
KNAG0K01020singletonON5993461493e-09
NDAI0J012808.272ON6943201483e-09
Kwal_14.728singletonON5684631465e-09
YKR105C (VBA5)singletonON5825441449e-09
Kwal_26.9616singletonON5623361431e-08
KLTH0C10142gsingletonON5732701422e-08
TDEL0G03260singletonON6121771384e-08
NCAS0C03460na 4ON6301601385e-08
CAGL0B02079gna 4ON6241731386e-08
Skud_18.3singletonON5901761376e-08
SAKL0F00198gsingletonON5372031351e-07
SAKL0B12716gsingletonON6321811341e-07
SAKL0A08228gsingletonON569731332e-07
ZYRO0G07414gsingletonON7074611332e-07
KLLA0D19941gsingletonON6115261304e-07
Skud_18.6singletonON6104991295e-07
YCL073C (GEX1)singletonON6152991252e-06
Skud_7.560na 4ON6421601252e-06
SAKL0G06600gsingletonON6291101243e-06
YKR106W (GEX2)singletonON6152991225e-06
KLTH0B00110gsingletonON6275231215e-06
KLLA0E09879gsingletonON6305391206e-06
YGR224W (AZR1)na 4ON6131531126e-05
KLTH0B00594gsingletonON6181541101e-04
YHL047C (ARN2)singletonON620811072e-04
Suva_13.4678.843ON5431321063e-04
TDEL0G05000singletonON1861451014e-04
KLLA0C00220gsingletonON6241551046e-04
KAFR0C02660singletonON5911291046e-04
KLTH0D00110gsingletonON6201521037e-04
KLTH0B10450gsingletonON6201521037e-04
Kpol_416.5singletonON6071311020.001
TDEL0H00130singletonON621771020.001
NCAS0B020108.570ON5302351010.001
NCAS0A11500singletonON614811010.001
Skud_5.24na 5ON6274531000.002
Kpol_1053.243.84ON620171990.002
CAGL0B02343g8.843ON53749990.002
KLTH0D18150gsingletonON607188990.002
KLTH0H16214gsingletonON55197990.003
Suva_8.12na 6ON633294990.003
KNAG0J02980singletonON636356980.003
TBLA0F00470singletonON732117980.003
SAKL0F00792gsingletonON61784980.003
Kwal_23.2794singletonON61972980.003
KAFR0B03930singletonON55593970.003
Smik_8.1na 6ON627204980.003
SAKL0F00440gsingletonON544145960.004
SAKL0C11066gsingletonON580115960.005
Suva_13.278.843ON553115950.006
TPHA0G03780singletonON612140950.006
Kwal_14.722singletonON611565950.006
KLLA0C19272gsingletonON62381950.007
SAKL0C12122gna 7ON61184940.009
Kwal_23.6547na 8ON511120930.010
KLLA0F03311g2.242ON542188930.010
Skud_13.258.843ON53789930.011
Kpol_1003.112.241ON581137930.011
AFR343C3.84ON571154930.011
KAFR0B039408.843ON54788930.011
Kpol_513.33singletonON62684930.011
TBLA0A08515singletonON632111920.014
Smik_11.369singletonON16881880.014
NDAI0I02650na 5ON63884920.015
Kpol_541.168.843ON528221920.016
YMR279C8.843ON54087920.017
KNAG0H031808.272ON67785920.017
Suva_8.435na 8ON51551910.017
TBLA0C01040singletonON66968920.018
YHL040C (ARN1)na 6ON627203910.019
Kwal_34.15746na 9ON518145900.026
YOR378Wna 8ON51551900.027
Smik_15.560na 8ON51651900.028
Skud_15.545na 8ON51651890.030
TBLA0A08520singletonON632111900.031
TBLA0D03280singletonON58092890.033
SAKL0G03300gsingletonON61681890.033
YML116W (ATR1)8.843ON542113890.034
YEL065W (SIT1)na 5ON62884890.037
Smik_5.22na 5ON62884890.039
KAFR0J009302.242ON566114890.039
Suva_10.11singletonON54097880.043
TDEL0C045902.242ON52973880.048
SAKL0E00132gsingletonON620117880.049
Suva_5.2na 5ON627453880.053
NDAI0A02050singletonON61784880.053
TDEL0B005508.843ON53786870.054
SAKL0D01386g8.843ON521120870.054
TDEL0G04740singletonON601128870.054
Kpol_358.4na 5ON61784870.055
KLTH0C10560gna 8ON51551870.058
YOL103W (ITR2)3.84ON609101870.058
Skud_6.16na 10ON549119870.060
Kpol_1017.33.503ON62180870.060
Skud_15.513.84ON587101870.064
TPHA0C047908.843ON55699870.067
KLTH0A07964gsingletonON61972870.069
TBLA0A085304.30ON615111860.072
KNAG0I019102.242ON598156860.074
Suva_9.712.241ON561183860.075
TPHA0M00120singletonON61984860.082
CAGL0I07447g3.84ON570174860.083
KLTH0A01562gna 7ON615139860.084
Kwal_27.102458.843ON515119860.086
NCAS0C047603.84ON60752860.088
Kwal_56.227243.84ON57836850.093
Kwal_34.15711na 6ON61872860.094
NDAI0H00140na 6ON632285850.097
TPHA0A006203.84ON634153850.097
Kpol_1039.192.242ON573115850.11
CAGL0E04092gna 6ON64560850.11
KAFR0A028408.843ON52065850.11
Suva_15.623.84ON609119850.12
SAKL0H09328g8.570ON596158850.12
Skud_8.3na 6ON631113850.12
Smik_15.543.84ON61136840.13
Skud_14.2672.242ON562126840.13
NCAS0C004008.843ON51793840.14
KNAG0J002608.843ON55093840.14
NDAI0K004008.843ON55393840.15
NCAS0A02540singletonON53993840.15
TBLA0B044808.570ON608174840.15
Smik_13.188.843ON54569840.16
TPHA0K02330singletonON631129830.17
SAKL0F00110gsingletonON62072830.17
TBLA0A04910singletonON575135830.17
KLTH0D06710gna 11ON611114830.18
NCAS0G029902.242ON58177830.18
KLLA0C18931gna 9ON55379830.20
TDEL0D06610singletonON49797830.20
KLTH0G09372g2.242ON551154830.20
TBLA0B083103.84ON638119820.22
NCAS0D02350na 5ON63484820.22
Smik_6.24na 10ON544116820.22
KAFR0I01560singletonON63256820.24
TDEL0D06500na 12ON542186820.24
NDAI0E002808.843ON54949810.28
YNL065W (AQR1)2.242ON58678810.30
KNAG0G034308.843ON54249810.31
NDAI0D010202.242ON59276810.32
ZYRO0F08228gsingletonON649116810.32
NCAS0I025203.84ON58736810.34
KNAG0K006303.84ON618153810.35
KLLA0B00352gna 8ON49873800.36
SAKL0C09350g3.84ON578119810.36
KLTH0C09372g3.84ON608217810.37
KNAG0E01160singletonON572133800.37
Kwal_23.48242.242ON553116800.38
ZYRO0E04092g1.427ON1062139810.38
Smik_14.2622.242ON56178800.38
Suva_14.2762.242ON56278800.46
KLLA0E14609gsingletonON639132800.46
KLLA0C12309g3.84ON569182800.47
Kwal_23.5241na 7ON59177800.47
CAGL0E03674g4.30ON57788800.47
Kpol_416.6singletonON597108800.47
NCAS0C057804.30ON56788790.48
Skud_9.482.241ON599177790.49
KAFR0C014803.84ON57788790.53
TDEL0B019008.446ON687126790.53
Smik_9.492.242ON542180790.54
NDAI0A071103.84ON60236790.54
KAFR0F02800singletonON551141790.58
ZYRO0D00286gsingletonON508125790.59
Skud_2.3068.570ON572198790.59
NDAI0D00820singletonON562132790.59
Smik_9.482.241ON591180780.71
KAFR0I014004.30ON589143780.78
NDAI0D05020singletonON573170780.81
YIL120W (QDR1)2.242ON563137770.85
TPHA0B00180singletonON63368770.86
NDAI0B037702.242ON571128770.86
SAKL0E08756g2.242ON565104770.95
TBLA0D032708.843ON550134770.96
KAFR0J016202.242ON570131771.0
KNAG0I030804.30ON592121771.1
ZYRO0C00374gna 13ON564101771.1
KLTH0E06138g4.30ON61488771.1
KAFR0E02030singletonON548109761.1
TBLA0G025502.242ON61381771.1
KAFR0F04080singletonON549109761.1
Kpol_495.213.109ON108566771.2
KLTH0C03806g8.843ON52551761.2
YBR180W (DTR1)8.570ON57271761.3
Kwal_33.150205.180ON597112761.3
NCAS0I00110na 6ON45281761.3
NOTE: 2 genes in the same pillar as KLLA0A04631g were not hit in these BLAST results
LIST: NCAS0B03780 KAFR0B05450

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A04631g
         (579 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...  1042   0.0  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...   604   0.0  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...   588   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   578   0.0  
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...   570   0.0  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...   551   0.0  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   539   0.0  
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...   541   0.0  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   526   0.0  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   483   e-164
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   470   e-155
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...   375   e-121
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...   320   e-102
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...   298   4e-93
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...   274   5e-84
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...   181   4e-48
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...   171   2e-45
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...   170   2e-44
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...   166   5e-44
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...   166   6e-44
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...   166   7e-44
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...   161   2e-42
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...   159   2e-41
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...   157   4e-40
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...   153   3e-39
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...   155   3e-39
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...   152   4e-39
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...   152   7e-39
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...   152   8e-39
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...   148   1e-37
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...   148   1e-37
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...   148   2e-37
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...   147   3e-37
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...   143   5e-36
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...   143   8e-36
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...   142   2e-35
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...   137   9e-34
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...   133   1e-33
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}        135   4e-33
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...   135   5e-33
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...   135   5e-33
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...   125   1e-29
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...   125   1e-29
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...   122   3e-29
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...   122   1e-28
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...   117   4e-27
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...   115   1e-26
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...   115   2e-26
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...   114   3e-26
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...   112   2e-25
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    85   1e-16
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    83   6e-16
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    77   4e-14
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    75   2e-13
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    71   5e-12
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    70   9e-12
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    68   2e-11
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    67   8e-11
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    66   9e-11
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    64   6e-10
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    64   7e-10
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    64   8e-10
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    63   1e-09
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    62   2e-09
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    62   3e-09
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....    62   3e-09
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    61   5e-09
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    60   9e-09
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    60   1e-08
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    59   2e-08
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               58   4e-08
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    58   5e-08
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    58   6e-08
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    57   6e-08
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    57   1e-07
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    56   1e-07
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    56   2e-07
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    56   2e-07
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    55   4e-07
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    54   5e-07
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    53   2e-06
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    53   2e-06
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    52   3e-06
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    52   5e-06
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    51   5e-06
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    51   6e-06
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    48   6e-05
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    47   1e-04
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    46   2e-04
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    45   3e-04
TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON}                44   4e-04
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    45   6e-04
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}               45   6e-04
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    44   7e-04
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    44   7e-04
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    44   0.001
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       44   0.001
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     44   0.001
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...    44   0.001
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    43   0.002
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    43   0.002
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...    43   0.002
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    43   0.002
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    43   0.003
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    43   0.003
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              42   0.003
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               42   0.003
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    42   0.003
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    42   0.003
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...    42   0.003
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    42   0.003
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    42   0.004
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    42   0.005
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    41   0.006
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...    41   0.006
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    41   0.006
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    41   0.007
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    41   0.009
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...    40   0.010
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    40   0.010
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    40   0.011
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    40   0.011
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    40   0.011
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    40   0.011
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    40   0.011
TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possi...    40   0.014
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...    39   0.014
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               40   0.015
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    40   0.016
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...    40   0.017
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    40   0.017
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...    40   0.017
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               40   0.018
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    40   0.019
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    39   0.026
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...    39   0.027
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...    39   0.028
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...    39   0.030
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             39   0.031
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    39   0.033
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    39   0.033
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    39   0.034
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    39   0.037
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    39   0.039
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    39   0.039
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    39   0.043
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    39   0.048
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    39   0.049
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       39   0.053
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    39   0.053
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...    38   0.054
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    38   0.054
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    38   0.054
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    38   0.055
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...    38   0.058
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...    38   0.058
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    38   0.060
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    38   0.060
Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {...    38   0.064
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    38   0.067
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    38   0.069
TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4...    38   0.072
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    38   0.074
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    38   0.075
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                38   0.082
CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly...    38   0.083
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...    38   0.084
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    38   0.086
NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84      38   0.088
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    37   0.093
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    38   0.094
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       37   0.097
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    37   0.097
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    37   0.11 
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    37   0.11 
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...    37   0.11 
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...    37   0.12 
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    37   0.12 
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    37   0.12 
Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W (...    37   0.13 
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    37   0.13 
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843       37   0.14 
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    37   0.14 
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                37   0.15 
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...    37   0.15 
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    37   0.15 
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...    37   0.16 
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              37   0.17 
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    37   0.17 
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...    37   0.17 
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...    37   0.18 
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    37   0.18 
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    37   0.20 
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    37   0.20 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    37   0.20 
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...    36   0.22 
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               36   0.22 
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    36   0.22 
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      36   0.24 
TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON}             36   0.24 
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843       36   0.28 
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    36   0.30 
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...    36   0.31 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    36   0.32 
ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} simila...    36   0.32 
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    36   0.34 
KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3....    36   0.35 
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...    35   0.36 
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    36   0.36 
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    36   0.37 
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               35   0.37 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    35   0.38 
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    36   0.38 
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    35   0.38 
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    35   0.46 
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    35   0.46 
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    35   0.47 
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    35   0.47 
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    35   0.47 
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    35   0.47 
NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa] ...    35   0.48 
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    35   0.49 
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    35   0.53 
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    35   0.53 
Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W (...    35   0.54 
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    35   0.54 
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               35   0.58 
ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON...    35   0.59 
Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W ...    35   0.59 
NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {O...    35   0.59 
Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W (...    35   0.71 
KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {O...    35   0.78 
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    35   0.81 
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    34   0.85 
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       34   0.86 
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    34   0.86 
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    34   0.95 
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    34   0.96 
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    34   1.0  
KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.3...    34   1.1  
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    34   1.1  
KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} simila...    34   1.1  
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               34   1.1  
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    34   1.1  
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    34   1.1  
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    34   1.2  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...    34   1.2  
YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putati...    34   1.3  
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    34   1.3  
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         34   1.3  
KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.5...    34   1.4  
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    34   1.4  
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    33   1.5  
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    33   1.5  
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    33   1.6  
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}          32   1.6  
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...    33   1.6  
ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON...    33   1.7  
KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.3...    33   1.7  
KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]...    33   1.9  
Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W ...    33   2.1  
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 33   2.2  
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    33   2.2  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...    33   2.2  
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    33   2.5  
Ecym_3618 Chr3 complement(1181343..1183211) [1869 bp, 622 aa] {O...    33   2.6  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...    33   2.7  
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    33   2.8  
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...    33   2.9  
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    33   2.9  
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    33   3.1  
TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.2...    33   3.1  
AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON} N...    33   3.1  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    33   3.1  
TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30 ...    33   3.1  
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    32   3.6  
ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {...    32   3.6  
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    32   3.6  
YHL029C Chr8 complement(45929..47968) [2040 bp, 679 aa] {ON}  OC...    32   3.8  
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    32   4.0  
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    32   4.1  
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    32   4.1  
ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} simila...    32   4.1  
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    32   4.3  
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        32   4.3  
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    32   4.3  
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    32   4.5  
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    32   4.6  
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    32   4.7  
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...    32   4.8  
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    32   4.8  
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    32   4.8  
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    32   4.9  
Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028...    32   5.1  
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    32   5.1  
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    32   5.3  
KLTH0B00484g Chr2 complement(51712..53412) [1701 bp, 566 aa] {ON...    32   5.5  
CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {...    32   5.7  
Ecym_7063 Chr7 complement(130980..132842) [1863 bp, 620 aa] {ON}...    32   5.9  
KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {O...    32   5.9  
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    32   6.6  
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    32   6.7  
NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa] ...    31   7.7  
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    31   7.8  
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       31   7.9  
TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.2...    31   8.4  
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    31   8.4  
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    31   8.4  
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    31   8.7  
NCAS0B05570 Chr2 (1052241..1057049) [4809 bp, 1602 aa] {ON} Anc_...    31   9.1  
Kwal_33.12950 s33 complement(12899..14599) [1701 bp, 566 aa] {ON...    31   9.6  
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...    31   9.9  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    31   9.9  
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    31   10.0 

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/579 (90%), Positives = 523/579 (90%)

Query: 1   MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARL 60
           MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARL
Sbjct: 1   MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARL 60

Query: 61  HIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKIS 120
           HIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKIS
Sbjct: 61  HIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKIS 120

Query: 121 DIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPL 180
           DIFGRRPLIIISNLFFILGCLICGLSKNLWTLV            VTSLGSITASDIVPL
Sbjct: 121 DIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPL 180

Query: 181 RSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXX 240
           RSRALYQ                   WFSESKNGWRMAFLVQVPLCAISLVLIIIF    
Sbjct: 181 RSRALYQGIFNFFFGLGIAIGGLIGGWFSESKNGWRMAFLVQVPLCAISLVLIIIFLKLP 240

Query: 241 XXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFK 300
                   VSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFK
Sbjct: 241 PGCKGLGLVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFK 300

Query: 301 LLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVY 360
           LLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVY
Sbjct: 301 LLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVY 360

Query: 361 WSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXX 420
           WSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFT            
Sbjct: 361 WSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTGLMVLGQLQVLL 420

Query: 421 XKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGV 480
            KPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGV
Sbjct: 421 MKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGV 480

Query: 481 SVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQ 540
           SVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQ
Sbjct: 481 SVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQ 540

Query: 541 CYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579
           CYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK
Sbjct: 541 CYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/601 (53%), Positives = 402/601 (66%), Gaps = 29/601 (4%)

Query: 4   SDRTSLLQPVRNALNPELSEGLPAYVGAEV------------------------AETEHL 39
           ++ T  LQP+R  L  + +  LP +V  E+                          T   
Sbjct: 48  TETTPFLQPIRRELVLDPTSDLPGFVAGELEEQEERCAEEQTNASGYDSIKKNTVATAKT 107

Query: 40  LESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHIS 99
           ++ E  + E    + +S AR+ II+ SM LG FLA+LDNTIV+TLL+HIASEFNE+ HIS
Sbjct: 108 IDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHIS 167

Query: 100 WIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXX 159
           WIATAYLLSSATFQPLYGKISDIFGR+PL+I SN+ F LGCLICGLS  LW LV      
Sbjct: 168 WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFIA 227

Query: 160 XXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAF 219
                 +TS+ SIT SDIVPLR+RALYQ                   WFSE   GWR+AF
Sbjct: 228 GIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGGGWRVAF 287

Query: 220 LVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLF 279
           L+Q+PLCAIS  LI+ +            + +D+D +  I +KL+RIDW G+LSLV FL 
Sbjct: 288 LIQIPLCAISCSLIVAYLELPKGCKGSG-IQSDEDNQ--ISEKLRRIDWFGALSLVVFLL 344

Query: 280 AFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGA 339
            FMLASSLGGKE+P+ SN F  L VA ++ G  F+YVE Y+S DPILP+ FL NR+ILG+
Sbjct: 345 LFMLASSLGGKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGS 404

Query: 340 SFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGR 399
           S ANWF MM  +T ++++PVYW+ V N+KPTDMGKR  P+FFSTA GS+GAGYYMKKTG+
Sbjct: 405 SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK 464

Query: 400 YYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHE 459
           Y   L+ F              +P+I+ WRQYILL +P FG SVLITVTLLAMIAAVPHE
Sbjct: 465 YKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHE 524

Query: 460 HQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQA 519
           HQAATTSISYAFRSTG TLGVS+G A+FR  L   L  +VMK  SDK+ +E L  II  A
Sbjct: 525 HQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSA 584

Query: 520 SESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIF-AWISCGVIKEYKLHTSMER 578
           + SS+Y+H +AP+F++  LI+ Y  AC++T+ FC L SIF A +SC  +KEYKLHTSM+R
Sbjct: 585 AHSSDYIHDSAPEFVRQALIESYHFACRNTYKFC-LASIFCALLSCIAVKEYKLHTSMDR 643

Query: 579 K 579
           +
Sbjct: 644 Q 644

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/587 (52%), Positives = 400/587 (68%), Gaps = 19/587 (3%)

Query: 4   SDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHL-----------LESEDEAREGLQV 52
           + RT+ L PVR+ +  + S  +P +V  E+ E E L           +++ED++R+G+  
Sbjct: 11  TSRTNFLNPVRDDILQDASTDIPGFVAEELEEREELYRECQGTDYGSIDNEDDSRDGVAS 70

Query: 53  SEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATF 112
           S +   +L +I  SM LG FLAA D T+V+T+++HIASEFNEL  ISWIATAYLLSSATF
Sbjct: 71  SPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATF 130

Query: 113 QPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSI 172
           QPLYGK+SDIFGR+PL++++N+ F++GCL+CGL+ + W LV            VTS+ SI
Sbjct: 131 QPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISGIGGGGVTSMCSI 190

Query: 173 TASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVL 232
           T SDIVPLR RALYQ                   WFS+   GWRMAFL+QVPL A+S +L
Sbjct: 191 TISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWRMAFLIQVPLSALSSLL 250

Query: 233 IIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEI 292
           I +F             S   +    IK+KL  +DW+G+ +LV FL  F++ +SLGGKEI
Sbjct: 251 IAVFMKLPPR-------SKRVNSPASIKNKLLSVDWIGASALVVFLSLFLVTASLGGKEI 303

Query: 293 PYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVT 352
            +NS  F  L + + L+   FI VELY + DPILP+ FL NRS+LG+SF+NWFCMM+ +T
Sbjct: 304 AFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMT 363

Query: 353 LAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXX 412
            ++Y+P+Y+S V N+ PT +GKR+ PNFFSTA GS+GAGYYMK+TG+YY   + F     
Sbjct: 364 TSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSL 423

Query: 413 XXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFR 472
                    KPDI+TWRQ+ILL +P FG SVLITV LLAMIAAVPH H AATTSISYAFR
Sbjct: 424 LGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFR 483

Query: 473 STGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPK 532
           STGSTLGVS+G A+FR  L+G L   V+KF +DK+ ++ LL II++AS+SSE+VH +AP+
Sbjct: 484 STGSTLGVSIGGAIFRQSLNGLLSRKVLKF-ADKHPRKELLEIIEKASKSSEWVHDSAPE 542

Query: 533 FIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579
           FI+ TLI CY  ACK TF FC L SI    S  +IKEYKLH S++RK
Sbjct: 543 FIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRK 589

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/588 (51%), Positives = 400/588 (68%), Gaps = 18/588 (3%)

Query: 3   ESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLE---SEDEAREGLQVSE----- 54
           E    SLL P++  +  + S  LP +V  E+ + E +     S  +  +G   SE     
Sbjct: 42  EPIEASLLLPIKPEILQDPSTDLPGFVAEEIGQQEEVANGYGSITDPHDGDNKSERPVST 101

Query: 55  ---MSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSAT 111
              +S ARL +I+ SM LG FLAA+DNTIV+T  +H+ASEFN+LS +SWIAT+YLLSSAT
Sbjct: 102 AEEISGARLRVIMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIATSYLLSSAT 161

Query: 112 FQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGS 171
           FQPLYGK+SDIFGR+ L++ +N+ F++GCL+CGLSK+ W LV            +TS+ S
Sbjct: 162 FQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGGGGLTSMSS 221

Query: 172 ITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLV 231
           IT +D+VPLR RA+YQ                   WFS++K GWRMAFL+QVPL AISL+
Sbjct: 222 ITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKGGWRMAFLIQVPLSAISLL 281

Query: 232 LIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKE 291
           +II+              + ++D    IK KL  IDWLG+ +LV FL  F+L +SLGGKE
Sbjct: 282 VIILHLKLPSKR-----ATRNQDN--SIKRKLLAIDWLGASTLVIFLVLFLLTASLGGKE 334

Query: 292 IPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGV 351
           I Y S  F L++++++LS   FIYVEL ++ DPILP+RFL  RS+LG+S +NWFCMM+ +
Sbjct: 335 IAYGSRTFALMLISSLLSCLVFIYVELRVAADPILPLRFLAIRSVLGSSLSNWFCMMATM 394

Query: 352 TLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXX 411
           T ++Y+P+Y+S V N+ PTD+GKR+ PNFFS AFGS+GAGYYMKKT +YY F L F    
Sbjct: 395 TTSYYLPIYFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRKYYWFSLIFCAVA 454

Query: 412 XXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAF 471
                      P I TWRQYILL +P  G+SVLITV LLAMIAAVPHEHQAATTSISYAF
Sbjct: 455 VLGQLQILLIDPKIPTWRQYILLLVPGVGTSVLITVALLAMIAAVPHEHQAATTSISYAF 514

Query: 472 RSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAP 531
           RS G TLGVS+G A+FR  LS      V+++ S ++ KE LL II +ASESSE+VH +AP
Sbjct: 515 RSAGCTLGVSIGGAIFRESLSKLTTRYVLRYISKEHPKEELLKIIDKASESSEWVHHSAP 574

Query: 532 KFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579
            FI+ TL++CY +ACK+TF FCF+ SI   +S  +IKE KLH+S++RK
Sbjct: 575 DFIRQTLLECYHKACKNTFLFCFICSILTLVSFSIIKEKKLHSSLDRK 622

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/593 (50%), Positives = 398/593 (67%), Gaps = 27/593 (4%)

Query: 3   ESDRTSLLQPVRNALNPELSEGLPAYVGAEV---------AETEHL--LESEDEAREGLQ 51
           E D  S+L P+R+ L  + S  LP ++ AE+           + H   +ES   + +G  
Sbjct: 55  EDDENSVLLPIRDELLQDPSTELPGFIAAEIEEGEQEYEETRSGHYGAIESRRISSKG-- 112

Query: 52  VSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSAT 111
            +E+S ARL II+ SM LG FLAALDNTIV+TLL+HIASEFNEL  ISW+ATAYLLSSAT
Sbjct: 113 -TELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSAT 171

Query: 112 FQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGS 171
           FQP+YGKISDIFGR+ ++I  N+ F +G LICGLS +   LV            +TS+ S
Sbjct: 172 FQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSS 231

Query: 172 ITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLV 231
           IT SDIVPLR+RALYQ                   WFS+   GWRM+FL+Q+P+   S +
Sbjct: 232 ITTSDIVPLRNRALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMSFLIQLPIAFFSTI 291

Query: 232 LIIIFXXXXXXXXXXXXVSNDKDGKVD------IKDKLKRIDWLGSLSLVTFLFAFMLAS 285
           LII+F             S  +  +VD      IK +L  +DW+G+ +LV FLF+FM+ +
Sbjct: 292 LIILFLRLPKE-------SKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITA 344

Query: 286 SLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWF 345
           SLGGKEIPY S+ F  L V T++    F Y EL I+ DPILP+RFL +RS+LG+S +NWF
Sbjct: 345 SLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWF 404

Query: 346 CMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLL 405
           CMM+ +T+++Y+P+Y++ V N+KPTD+GKRI PNFFSTAFGS+GAGYYMKKTG+YY F++
Sbjct: 405 CMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVI 464

Query: 406 KFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATT 465
            F              +PDIS ++QY L+ +P  G+SVLITV LLAMIAAVPH HQA TT
Sbjct: 465 SFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTT 524

Query: 466 SISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEY 525
           SISYAFRSTG TLGVS+G A+FR  L   L   V+KF+S ++S++ L+ II +AS+S+E+
Sbjct: 525 SISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEW 584

Query: 526 VHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMER 578
           V  ++P FI+ TLI CY  ACK+ F FC L +I A  S  +IKE++LH +++R
Sbjct: 585 VQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDR 637

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/603 (47%), Positives = 383/603 (63%), Gaps = 37/603 (6%)

Query: 1   MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLL------------------ES 42
           MV+S+ + LL PV      + S  LP +V  ++ + +HLL                  E+
Sbjct: 1   MVQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSEN 60

Query: 43  EDEAREGLQVSEMSRA-------RLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNEL 95
           E E   G  V+    A       R+ II+ SM LG FLAALD TIV+TLL+HI SEFN L
Sbjct: 61  EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL 120

Query: 96  SHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXX 155
              SWIAT+YLLSS+T QPLYGK+SD  GR+PL++ SN  F +GCLICGLS ++W +V  
Sbjct: 121 DKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG 180

Query: 156 XXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGW 215
                     +TSL ++  SD+VPLR RA+YQ                   +F +    W
Sbjct: 181 RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----W 236

Query: 216 RMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLV 275
           R+AF++Q P+  +S +LI+++             +++KD       +L+R+DW G+ SL+
Sbjct: 237 RLAFILQCPISVLSGILIVVYLELPPRAS-----ASNKDCW---SARLRRLDWAGATSLI 288

Query: 276 TFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRS 335
            FLF FML SS+GG  + Y S +F  +  AT++ G  F+YVEL ++ DP+LP+ FL +RS
Sbjct: 289 AFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS 348

Query: 336 ILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMK 395
           +LG+S ANWFCMMS +T  FY+PVYWSSV  +K TD+GKR  P+FFS AFGS+GAG YMK
Sbjct: 349 VLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMK 408

Query: 396 KTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAA 455
           +TG+YY FLL F               P +  WRQY+L  +P FG SVLITVTLLAMIAA
Sbjct: 409 RTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAA 468

Query: 456 VPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSI 515
           VPHEH AATTSISYAFRSTG+TLGVSVGAA+FR+ L+  L   VM+F SD +S+  L  I
Sbjct: 469 VPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGI 528

Query: 516 IKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTS 575
           I  A+ SS++VH +AP F++ATL++CY  A ++TF FC    + A +SC +IKE+KLHTS
Sbjct: 529 IASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTS 588

Query: 576 MER 578
           ++R
Sbjct: 589 IKR 591

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/600 (47%), Positives = 379/600 (63%), Gaps = 33/600 (5%)

Query: 1   MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSE------ 54
           M   +RTS L P+   +  + S GL  +V  EV + ++   +  ++     V +      
Sbjct: 1   MSPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTGHDSYGATAVDDRTATSA 60

Query: 55  ---------------MSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHIS 99
                          +S +R+ II+ SM LG FLAALD TIV+TLL+ I SEFN L  +S
Sbjct: 61  RCDLTFPPSETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVS 120

Query: 100 WIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXX 159
           WIAT+YLLSS+T QPLYGK+SD  GR+PL++ SN+ F +GCLICG+S ++W +V      
Sbjct: 121 WIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVS 180

Query: 160 XXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAF 219
                 +T L S+  SD+VPLR RA+YQ                    F +    WRMAF
Sbjct: 181 GIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD----WRMAF 236

Query: 220 LVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLF 279
            +Q P+   S  LI+ +              +DKD       KL+ +DW G ++LV FLF
Sbjct: 237 TIQCPISLASCALIVSYLELPPRH------EDDKDRH--WTSKLRDLDWAGVVTLVCFLF 288

Query: 280 AFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGA 339
            FML SSLGGKEI Y+S +F LL V T++ G+ F YVELY++ DP+LPI FL  RS+LG+
Sbjct: 289 LFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS 348

Query: 340 SFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGR 399
           S ANWF MMS +T  +Y+PVYW+SV N+KPTD+GKR  P+FFS AFGS+GAG YMK+TG+
Sbjct: 349 SLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK 408

Query: 400 YYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHE 459
           YY FLL F               P    W+QY+LL +P FG SVLITVTLLAMI+AVPHE
Sbjct: 409 YYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHE 468

Query: 460 HQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQA 519
           H AATTSISYAFRSTG+TLGVS+GAA+FR+ L+  L + V++F SD++ +E LL II  A
Sbjct: 469 HHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNA 528

Query: 520 SESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579
           + S+ +VH  AP+F++ATL++CY  A KSTF FC +  I A  SC +I+E+ LHT+++R 
Sbjct: 529 AHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRD 588

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/544 (53%), Positives = 360/544 (66%), Gaps = 16/544 (2%)

Query: 32  EVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASE 91
           EV  T   +E+  E   GL  +     R  ++++SMCLG FLAALD TIVTTLL HIASE
Sbjct: 116 EVYLTATAVEAAKEDAGGLGAT-----RRRVVMASMCLGVFLAALDGTIVTTLLDHIASE 170

Query: 92  FNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWT 151
           FNEL  ISWIATAYLLSSATFQPLYGK+SDIFGRRPL++ SNL F LG LICG+SKNLW 
Sbjct: 171 FNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV 230

Query: 152 LVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSES 211
           LV            +TS+ SIT +DIVPLRSRALYQ                    F++ 
Sbjct: 231 LVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGLFADR 290

Query: 212 KNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIK--DKLKRIDWL 269
             GWRMAFLVQVPL  +S   I +F             ++   G+  I    KL+ +DW 
Sbjct: 291 AVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVD-----AHKGAGQRSIPWTTKLRMVDWT 345

Query: 270 GSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIR 329
           G+++LV FLF F L  SL G+++P+      L+ V  +LSG+ FIY ELY++ DPILPIR
Sbjct: 346 GTVTLVVFLFCFTLVCSLYGEDLPH----LYLIFVVILLSGSYFIYHELYVATDPILPIR 401

Query: 330 FLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIG 389
           FL NRS+L AS +NWFCMM  +T  FY+PVY++SV N+ PTD+GKRI P+FFSTAFGS+G
Sbjct: 402 FLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLG 461

Query: 390 AGYYMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTL 449
           AGYYMK+TG+YY FLL F               P ISTWRQY L  +P FGS+VL+TVTL
Sbjct: 462 AGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSAVLLTVTL 521

Query: 450 LAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSK 509
           LA+I AVP  HQAATTSISYAFRSTGSTLGVS+G A+FRN LS  L+  +M  +S ++  
Sbjct: 522 LALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPA 581

Query: 510 EYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKE 569
             LL II++A+ S+E+VH  AP+F +  LI CY  A + TF FC    + A ++C  I E
Sbjct: 582 SELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVE 641

Query: 570 YKLH 573
           YKLH
Sbjct: 642 YKLH 645

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/600 (46%), Positives = 374/600 (62%), Gaps = 22/600 (3%)

Query: 2   VESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQ---------- 51
           V+ D++ LL  +R  L  + S  LP +V AE+ E E L      A               
Sbjct: 22  VQEDKSPLLHAIRGELLQDSSFSLPGFVAAEIEEREELYREASIASNQHHDYGSVANSII 81

Query: 52  ----VSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLL 107
                + +S  RL + +SSM LG FL+ALDNTIV+TLL+ I SEFNEL  ISWIATAYLL
Sbjct: 82  LDNDKNNLSPTRLRLAMSSMYLGIFLSALDNTIVSTLLARIGSEFNELPRISWIATAYLL 141

Query: 108 SSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVT 167
           SSATFQPLYGKISDIFGR+ ++   N+ F +GCLICG +K+ W LV            +T
Sbjct: 142 SSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISGVGGGGIT 201

Query: 168 SLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCA 227
           S+ +IT SDI+PLR+RALYQ                   WF+E    WR AFL QVPL  
Sbjct: 202 SMSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIGGWFTEKLGSWRGAFLFQVPLSV 261

Query: 228 ISLVLIIIF------XXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAF 281
           IS V ++++                   S++   +  I  KLK IDW G++SLV FL +F
Sbjct: 262 ISTVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLLSF 321

Query: 282 MLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASF 341
           M+ SS GG +I   SN F  L + ++ S  +FIY+EL  + DPILP+ FL +RS+LG+S 
Sbjct: 322 MILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELKFAKDPILPLVFLKDRSVLGSSL 381

Query: 342 ANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYY 401
           +NWF MM  +T+++Y+P+Y++SV  +   D+GKR  PNFFS AFGS+GAGYYMKKTG+YY
Sbjct: 382 SNWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPNFFSVAFGSLGAGYYMKKTGKYY 441

Query: 402 GFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQ 461
            F+  F                 IS WRQY+L  +P  G++VLIT+ LL+MI AVPHE+Q
Sbjct: 442 WFVTFFCLVVVIGCLQIYLINDGISVWRQYLLSFVPGLGAAVLITIALLSMIVAVPHEYQ 501

Query: 462 AATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKF--ESDKYSKEYLLSIIKQA 519
           A TTSISYAFRSTG TLGVS+GAALFR+ L+  L   +++   ++  YS++ LL II  A
Sbjct: 502 AVTTSISYAFRSTGCTLGVSIGAALFRDSLNKYLRAKILELGSQNGNYSEKELLQIIDHA 561

Query: 520 SESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579
           S+S ++VH  AP+F + T+++CY  ACK  F FC + S+ A +S  +IKE+KLH+S++RK
Sbjct: 562 SKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALLSISMIKEHKLHSSLDRK 621

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  483 bits (1242), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 252/544 (46%), Positives = 350/544 (64%), Gaps = 21/544 (3%)

Query: 44  DEAREGL---------QVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNE 94
           D+AR G           +S++   R+ +I +SM LG FLAALDNTIV+TLL HI SE N+
Sbjct: 55  DKARNGNDSATDFSSNNLSDLMSRRIFMISASMFLGIFLAALDNTIVSTLLPHIGSELND 114

Query: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVX 154
           + ++S +AT+Y+ S A FQPL+GK SD+FGR+PL+I SNL F  GCL CGLSK +W L+ 
Sbjct: 115 MPNVSLVATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLIL 174

Query: 155 XXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNG 214
                      +TS+ +I  +DIVPLR+RA+YQ                    FSE  NG
Sbjct: 175 GRLVTGIGGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNG 234

Query: 215 WRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKD--GKVDIKDKLKRIDWLGSL 272
           WRMAF++Q+P C +S + II++            +S+DK   G+  +  KL+ IDWLG+L
Sbjct: 235 WRMAFMIQLPFCFLSTISIIVYLD----------LSDDKQDLGRSSLYCKLRLIDWLGAL 284

Query: 273 SLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLT 332
           +LVTFL  F++  ++GG+ +PY S  F LL VA   SG A  YVE+++++DPILPI FL 
Sbjct: 285 TLVTFLLLFLVTMTIGGQHVPYGSLRFFLLCVAVCASGLALAYVEIFLANDPILPISFLR 344

Query: 333 NRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGY 392
           N+++LG+S ANWFCMM  +T+ +Y+P+YWSSV N  P  +GK+  P+FFS A GS G  Y
Sbjct: 345 NKNVLGSSLANWFCMMGMMTITYYLPIYWSSVSNQGPIQVGKKSIPSFFSMALGSFGTAY 404

Query: 393 YMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAM 452
           Y++K G YY  L+                 P++  WRQYILL +P FG S+LITVTLLAM
Sbjct: 405 YVQKNGTYYRLLMTSCLIIIFGQLQIVYITPEMPQWRQYILLAVPGFGVSILITVTLLAM 464

Query: 453 IAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYL 512
           IAAVPH+HQAATTS+SYAFR+TG  +G S+  A+F+N L  ++  +VMKF  D++SK+ L
Sbjct: 465 IAAVPHKHQAATTSLSYAFRTTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKEL 524

Query: 513 LSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKL 572
             +I++A  SS++V+  +P+F+   L++CYE AC  TF FC L  +   ISC  I E  L
Sbjct: 525 NLVIEKALRSSDWVNNGSPEFVHEALLKCYENACGQTFRFCLLCFLLTVISCSFITEINL 584

Query: 573 HTSM 576
            T++
Sbjct: 585 PTTL 588

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  470 bits (1209), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 245/525 (46%), Positives = 347/525 (66%), Gaps = 11/525 (2%)

Query: 54  EMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQ 113
           EMS  +++II+ SM LG FLAALDNT+V+TL++HI SEFN++  + W+AT+YLLSSA FQ
Sbjct: 390 EMSNMKMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQ 449

Query: 114 PLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSIT 173
           PLYGK+SDIFGR+ L+I SNL F  GC+ICG+S +L  LV            +TS+ +IT
Sbjct: 450 PLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIGGGGITSMTTIT 509

Query: 174 ASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLI 233
            SDIVPLRSRA+YQ                    F + + GWRM F  QVP+  +S +LI
Sbjct: 510 VSDIVPLRSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVFWSQVPVSGLSTLLI 569

Query: 234 IIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASS-LGGKEI 292
             F            V   K+ +V +  KL R+DWLGS+S++ +L +F+L ++ +GG  +
Sbjct: 570 CSF----------LVVPRIKNYEVSLGRKLMRVDWLGSISMILWLTSFLLITTMMGGISL 619

Query: 293 PYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVT 352
             +S+ F  L++ + +S   F+  EL+++ DP+LP+RFL+NRS+LGAS  N+FC+M  +T
Sbjct: 620 DIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNFFCVMGFMT 679

Query: 353 LAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXX 412
           + FY+P+Y++SV ++ PT +GKR+APNF  TA GS+GAG YMK+TG+YY F++ F     
Sbjct: 680 ICFYLPIYFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGKYYWFVVLFALVST 739

Query: 413 XXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFR 472
                       +S   QY+L+ LP  GSS++I V LLAMIAAVPH+HQAATTSISYAFR
Sbjct: 740 LGHYYLTLIPLTVSITVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQAATTSISYAFR 799

Query: 473 STGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPK 532
           STG TLGV++G+++F   L   L   V+++ S ++ ++ LL IIK+AS S+E+VH  AP 
Sbjct: 800 STGGTLGVALGSSVFHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHSTEWVHRKAPT 859

Query: 533 FIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSME 577
           FI+ TLI CY+ AC   F FC   ++ A IS  +I+E +L T + 
Sbjct: 860 FIRDTLITCYDVACHDVFVFCTACALLAAISLALIREERLATGLR 904

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score =  375 bits (962), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 216/526 (41%), Positives = 307/526 (58%), Gaps = 8/526 (1%)

Query: 54  EMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQ 113
            +S+ R   I+SS+ +G FL +LD TI++TLL +IASEF  L +ISWIA +YLLS+  FQ
Sbjct: 145 NISQIRFAAIVSSLVVGVFLGSLDGTILSTLLDYIASEFEALPYISWIAASYLLSACIFQ 204

Query: 114 PLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSIT 173
           PLYGK+SDIFGR+ +++ SNL F LGCL+CG +  +W L+            +TS+ SI 
Sbjct: 205 PLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSII 264

Query: 174 ASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLI 233
            SDIVPLRSRA YQ                   W +E   GWR+ FL+QV    IS   I
Sbjct: 265 ISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGWRLVFLLQVVAALISGCFI 323

Query: 234 IIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIP 293
             F               +K+    +K KL  +DWLG+  LV FL +  L  SL    + 
Sbjct: 324 QAFLILPKVHHGNGIALANKE---SLKTKLYMMDWLGTFCLVIFLASLTLTCSL----VD 376

Query: 294 YNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTL 353
            N N   LL++   +SG  F+Y EL I+ DPIL +  LT+R++L +S AN+FCM++ V  
Sbjct: 377 LNFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHLLTDRNVLASSLANFFCMLNDVLT 436

Query: 354 AFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXX 413
            FYVP+Y++SV  + P ++GKR   +F  T+ GS G GYY+K+ G+Y  F+         
Sbjct: 437 IFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKYRTFICLACIIGIL 496

Query: 414 XXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRS 473
                   KP ISTWRQY+LL +P   ++ + T  L+++IAAVP+++Q A  SISY FRS
Sbjct: 497 GQLQIALIKPSISTWRQYLLLLIPILYTTTVRTSLLISLIAAVPYKNQTAAASISYTFRS 556

Query: 474 TGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKF 533
           TG+ LG S+G  +FR+ L   L  ++M  ES+ + K  LL II +A+ S+++VH  +P++
Sbjct: 557 TGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEY 616

Query: 534 IQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579
               LI CY   CK  F F  +  +F  ISC  +KEY +H S  ++
Sbjct: 617 AIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYPVHASQPQE 662

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score =  320 bits (820), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/524 (36%), Positives = 287/524 (54%), Gaps = 11/524 (2%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I+ ++ +GS+LAALD TIVTTLL  IASE +  + +SWIAT+YLLS + FQPLYGK+SD+
Sbjct: 34  IVFALFVGSYLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 123 FGRRPLIIISNLFFILGCLICG--LSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPL 180
           FGR+PL+I SNL F  GC++CG   +K+LW L             + SL +IT SDI+PL
Sbjct: 94  FGRKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPL 153

Query: 181 RSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXX 240
           R R +YQ                    F + + GWR AFL QVPL  +S  LI+ F    
Sbjct: 154 RQRGVYQGMGNIVFALGCASGSLIGA-FLQQRIGWRWAFLCQVPLSLLSCSLIMKFLNLP 212

Query: 241 XXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFK 300
                   + N  + K+   D  + +D+ GS +L+T +   M+  S+           + 
Sbjct: 213 AGSPGRGLI-NLSNKKITTADVREHVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWA 271

Query: 301 LLVVATILSGTAFIYVELYISDDPILPIRFL-TNRSILGASFANWFCMMSGVTLAFYVPV 359
           L +V   L+G  F+  EL +  +P++PIR L +NR++L +S  NWF  MS   LA+YVPV
Sbjct: 272 LFIVGLALAGYTFVSTELSV-HNPMVPIRLLGSNRTVLASSLTNWFFTMSTFVLAYYVPV 330

Query: 360 YWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGF--LLKFTXXXXXXXXX 417
           +W +V +LKP ++G R   NFF  A GS+  G YMK+TG+Y      L            
Sbjct: 331 FWQTVYHLKPWNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGTLIVY 390

Query: 418 XXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGST 477
                 +     +Y +L LP  G + ++T+TLL++IA+V   HQA  TSI YAFR+ GST
Sbjct: 391 LSTYNTEPKGLLEYFMLFLPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRAIGST 450

Query: 478 LGVSVGAALFRNKLSGSLFDSVM--KFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQ 535
           LGVS    ++++KL  SL  +++  K  +DKYS   L    +   E++ +  +  P  ++
Sbjct: 451 LGVSFAGLIYQSKLQTSLLRNIVENKTLNDKYSTHQLRKWCQTLLENNSFDVSFDP-LLE 509

Query: 536 ATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579
           +     ++   +    F  L SI   +S   I+E+ LHT ++R+
Sbjct: 510 SLAKISFQGGSRLVLGFAVLASILGLLSSLFIREHVLHTDIQRR 553

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score =  298 bits (762), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 193/553 (34%), Positives = 295/553 (53%), Gaps = 46/553 (8%)

Query: 53  SEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATF 112
           SE+   ++ I + ++ +GSFL+ALD TIV TLL  IAS+ +  S +SWIATAYLLS + F
Sbjct: 33  SELPPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDASSQMSWIATAYLLSCSAF 92

Query: 113 QPLYGKISDIFGRRPLIIISNLFFILGCLICG--LSKNLWTLVXXXXXXXXXXXXVTSLG 170
           QPLYGK+SDIFGR+ L+I+SNL F LGC ICG   + N+W L               +L 
Sbjct: 93  QPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLSTGRFVAGIGGGGQATLS 152

Query: 171 SITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISL 230
           +IT SDI+PLR R +YQ                      +   GWR AFLVQVP+  +  
Sbjct: 153 TITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVLQQGI-GWRWAFLVQVPMALVCA 211

Query: 231 VLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKR------------IDWLGSLSLVTFL 278
           ++I +             +  D  G+  +  +LKR            +D++GS +L+  +
Sbjct: 212 LMIAV----------VLDLPADSPGRGLLWLELKRGKRLKWCTVTEMVDFVGSFTLIASM 261

Query: 279 FAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFL-TNRSIL 337
              M A SL       +++++ LL V    S   F Y E   + +P++P+R L  NR++ 
Sbjct: 262 ILLMTAISLLSDPTQLSTSLWLLLGVLLTASSLQFAYTEC-TTRNPMVPLRLLWENRTVC 320

Query: 338 GASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKT 397
            +SF NWF  M+  T+ +YVPV+W +V    P D+G R   NF   A GS+ AG YMK+T
Sbjct: 321 ASSFTNWFMTMTTFTVMYYVPVFWHTVYKFTPWDIGVRSMSNFVGIASGSMLAGMYMKRT 380

Query: 398 GRYYGFLLK----FTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMI 453
           G+Y+ F +     F               P      +Y+L+ LP FG + ++TVTLLA+I
Sbjct: 381 GKYWSFSVATNSLFAVGVLSLFAFSFKGSPQGVV--EYLLMFLPGFGYATMLTVTLLALI 438

Query: 454 AAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVM-------KFESDK 506
           A+V  EHQA  TSI YAFR+TGSTLGV++ + ++++ L   L+++V+       ++ S +
Sbjct: 439 ASVSVEHQAQVTSIQYAFRATGSTLGVALASLIYQSCLQSRLYNNVLTDGPLLAQYGSRR 498

Query: 507 YSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGV 566
              ++  SI++  S    + H  A    Q      ++ + +    F F++ +   +S   
Sbjct: 499 L-MDWCQSILQDNSFDISFDHRLAELVRQG-----FQFSNQCALGFAFVVCVLGVLSSCF 552

Query: 567 IKEYKLHTSMERK 579
           ++E+ LHTS+ RK
Sbjct: 553 MREHVLHTSVSRK 565

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score =  274 bits (700), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 182/519 (35%), Positives = 275/519 (52%), Gaps = 20/519 (3%)

Query: 19  PELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDN 78
           P+ ++ L A   + + E      S D A      S ++  +  II+ ++ LGSFL+ALD 
Sbjct: 2   PQETDLLLAPCLSPIPEIPTFDSSYDAAANH---SVLTETKTRIIVIALFLGSFLSALDT 58

Query: 79  TIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFIL 138
           TIV+TLL  IAS+ +  S +SWIAT+YLLS + FQPLYGK+SDIFGR+ L++ SNL F +
Sbjct: 59  TIVSTLLPTIASDLDASSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAI 118

Query: 139 GCLICG--LSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXX 196
           GC +CG   + N+W L             +T+L +IT SDI+PLR R +YQ         
Sbjct: 119 GCALCGSPWTTNIWILSAGRFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSL 178

Query: 197 XXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXV--SNDKD 254
                        +   GWR AFL+QVP+  IS +LI+              +   + + 
Sbjct: 179 GCASGSVLGAVLQQGI-GWRWAFLIQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARG 237

Query: 255 GKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFI 314
                    K ID++GS++LV  +   M+  S        + N + +LV+        F+
Sbjct: 238 NTFQWSKVTKMIDFVGSITLVMSMLLLMITISFLSDPSQLSENSWVVLVLLVAGFCAKFV 297

Query: 315 YVELYISDDPILPIRFL-TNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMG 373
           + E  I  +P++P+R L  NR++  +SF NWF  MS   + +Y+PV+W +V    P D+G
Sbjct: 298 HTECTI-HNPMVPLRLLWENRTVFASSFTNWFMTMSTFAVMYYIPVFWQTVFKFTPYDIG 356

Query: 374 KRIAPNFFSTAFGSIGAGYYMKKTGRYYGF-----LLKFTXXXXXXXXXXXXXKPDISTW 428
            R   NF   A GS+ AG YMK TG+Y+ F     +L FT                +   
Sbjct: 357 FRSISNFVGIATGSMLAGVYMKCTGKYWNFSLVTNILYFTGILSLFACTFRNTPQGV--- 413

Query: 429 RQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFR 488
            +Y+L+ LP FG + ++TVTLLA+IA+V  EHQA  TSI YAFR+TGSTLGVS+   +++
Sbjct: 414 LEYLLMFLPGFGYATMLTVTLLALIASVDFEHQAQVTSIQYAFRATGSTLGVSLAGLIYQ 473

Query: 489 NKLSGSLFDSVMKFES--DKYSKEYLLSIIKQASESSEY 525
             L   L+  ++  ++   KY ++ L    K+  + + +
Sbjct: 474 ASLQYKLYRDILGDQTLLGKYGQDQLRKWCKEILQDNSF 512

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score =  181 bits (458), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 136/513 (26%), Positives = 239/513 (46%), Gaps = 30/513 (5%)

Query: 52  VSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSAT 111
           V +++R R  I  S MC   F  A+D++I+  + S IASEF+EL  +S + + YLL +A 
Sbjct: 248 VHDLTRKR--IFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISVYLLGNAI 305

Query: 112 FQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGS 171
            Q ++ K+S + G + L+ ++   FILG  +   S + WT +            + +L S
Sbjct: 306 GQLMFLKLSLVSGVKLLLCVAQFSFILGSYLSWSSIHFWTFILARSVTGFGSGSLIALKS 365

Query: 172 ITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKN--GWRMAFLVQVPLCAI- 228
            T  +    ++   Y                     F +S +  GW+ AFL+ VP C + 
Sbjct: 366 -TIMNRFSQKNENQYPLSTSMTVFSLGVAVGPFLVSFFDSSHGSGWKNAFLIPVPFCLVN 424

Query: 229 -SLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGS----LSLVTFLFAFML 283
            S++L  I+              + +     ++ + K++ W       L+L  FL  F+ 
Sbjct: 425 ASIMLADIYSVKNTI--------HHEGPTTTLQKRFKKVLWSPDLYEILTLALFLLCFVQ 476

Query: 284 ASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELY-ISDDPILPIRFLTNRSILGASFA 342
           A+SL    + +++ I +++    I+ G  F  +E   +  + +  +    ++ ++     
Sbjct: 477 ATSLDSTRLEHSTMIQEIIFSVIIICGVLFFVIEKSDVRMNSVFSLSLQGDKHLIWTMMG 536

Query: 343 NWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYG 402
            +FC  + + +  +   Y+  V NL   ++ +R+ P FFS   G     Y+     + Y 
Sbjct: 537 IFFCFAALMCIIPFGTTYFMIVLNLDTLEIAERLLPFFFSIVVGYFSVCYFWNSERQNYL 596

Query: 403 FLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQA 462
           F    +                +S W+QY  L LP  GSS+++T     +++ + HE+  
Sbjct: 597 FKFVLSGVTLLLYVALMGMNLSLSVWKQYTCLSLPLLGSSMILT-----LLSTLYHEYHV 651

Query: 463 A-----TTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIK 517
                 + SI+Y F + G T+GVS    +F   L  ++ + VMKF    Y K+ L  IIK
Sbjct: 652 QRKSPISGSIAYCFAAMGGTIGVSSAGYVFHKTLVRTMNEEVMKFSKQGYLKKDLFKIIK 711

Query: 518 QASESSEYVHANAPKFIQATLIQCYEQACKSTF 550
            A++SS +VH +APKFI  TLI+CY QAC++ F
Sbjct: 712 HATQSSNWVHKSAPKFIFRTLIECYLQACRNVF 744

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score =  171 bits (432), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 146/545 (26%), Positives = 242/545 (44%), Gaps = 49/545 (8%)

Query: 40  LESEDEAREGLQVSEMS-RARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHI 98
           +++E+   E L  S  + R R+ +I +++    FL+ LD+TI  ++   I +EF ++   
Sbjct: 24  IQTEETTTEPLAPSSWTERNRILLIETALFTNVFLSGLDSTITASIYQLIGNEFEDVKVS 83

Query: 99  SWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXX 158
           SWI TAYL++  +FQPLYG  SD  GRR  +  +N  F LGCL CGL+  +++L+     
Sbjct: 84  SWITTAYLVTCTSFQPLYGSFSDTLGRRRCLFFANTIFALGCLGCGLTSTIYSLIIMRAV 143

Query: 159 XXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMA 218
                  + +L +I  SDI+P + R +YQ                     + S  GWR  
Sbjct: 144 TGIGGGGLITLSTIVNSDIIPAKKRGMYQSFQNILVGTGAVVGASCGGEIASSM-GWRWC 202

Query: 219 FLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIK-DKLKRIDWLGSLSLVT- 276
           FL+QVP+     V+  +F              N + G +     K+K+ID+LG+  L++ 
Sbjct: 203 FLLQVPISIGGAVMAYLFVQDQDVVD-----KNPRSGALPSNVSKIKKIDFLGAFLLISG 257

Query: 277 ----FLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLT 332
                +F  + +S+  GK    +     L +V T +S   F YVE   + +PI+P     
Sbjct: 258 LVSQLIFLTINSSAQEGKSTWLSGRSLALGLV-TAVSLILFAYVEKTTTANPIIP----- 311

Query: 333 NRSILGASFANWF---CMMSGVTLAFY-------VPVYWSSVQNLKPTDMGKRIAPNFFS 382
              +LG     W+    ++ GV + F        +P+Y+  V      + G R+    F 
Sbjct: 312 -HDLLG----QWYSTTVLIVGVLVGFVSYAYIFTLPLYFQVVVGDTAAEAGLRLTVPSFC 366

Query: 383 TAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSS 442
           T  G +  G  MK   R  G L+                KP    W   +LL   + G  
Sbjct: 367 TPIGGVIMGISMKDPKRLPGLLIVGISLMLFGNLCFLLIKPTTPYWLTSLLLVPANIGQG 426

Query: 443 VLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKF 502
           +    TL + + A P   QA  T+  Y FRS G   GV+          + SL  SV++ 
Sbjct: 427 ITFPSTLFSFLFAFPPYKQATATATLYLFRSVGCVWGVAG---------TSSLIQSVVRK 477

Query: 503 ESDK-----YSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLIS 557
           ++ K      + E + S++ + S  +  +    P  ++A ++  YE + KST+ F  ++ 
Sbjct: 478 QATKRLQGILTDEEIKSLLVKLSHKTSLIE-KLPDNVRAAVLTSYEISIKSTYFFSVILC 536

Query: 558 IFAWI 562
           + A I
Sbjct: 537 LIAII 541

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score =  170 bits (431), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 165/570 (28%), Positives = 254/570 (44%), Gaps = 52/570 (9%)

Query: 13  VRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSF 72
           V N LNP   E                  S DE      V +++R R  I  S MC   F
Sbjct: 224 VENGLNPPYVEN----------------TSSDEL-----VHDLTRRR--IFSSCMCTYLF 260

Query: 73  LAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIIS 132
             A+D++I+  + S IASEF+EL  +S + +AYLLS+A  Q ++ K+S I   + L+ I+
Sbjct: 261 FIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQLVFLKLSLISSVKLLLCIA 320

Query: 133 NLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLR-SRALYQXXXX 191
              FILG  +   S + WT +            + +L S   +       SR        
Sbjct: 321 QFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMI 380

Query: 192 XXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAI--SLVLIIIFXXXXXXXXXXXXV 249
                          + S   +GWR AFL+ VP C +  S++L  ++             
Sbjct: 381 TFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLYGRPTPT 440

Query: 250 SNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILS 309
              +      K+ L   D    L+L  FL  F+  +SL    +  N+ I  LL    I+ 
Sbjct: 441 LWKR-----FKNTLLSPDLYEILTLTLFLLCFVQVTSLDLTGLKNNTMIQALLFSVIIVC 495

Query: 310 GTAFIYVELYISD---DPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQN 366
           G  F  +E   SD   + ++ +    ++ ++       FC  + + +  +   Y+  V N
Sbjct: 496 GILFFLIE--TSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIVLN 553

Query: 367 LKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKF--TXXXXXXXXXXXXXKPD 424
           L    + +R++P FFS   G     Y+ K  G+   FLLKF  +               +
Sbjct: 554 LSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQ--NFLLKFVLSGATLLLYVALMGVSLN 611

Query: 425 ISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAA--TTSISYAFRSTGSTLGVSV 482
           +  W+QYI L LP  GSS+++  TLL+ +    HE + +  + SI Y F + G T+G+S+
Sbjct: 612 LPVWKQYICLSLPFLGSSMIL--TLLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGISL 669

Query: 483 GAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCY 542
           G  +F   L   + + VM F    Y K+ LL IIK A+ESS++VH +APKF+  TLI+CY
Sbjct: 670 GGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECY 729

Query: 543 EQACKSTFAFCFL--------ISIFAWISC 564
            QAC++ F    L        I IF  I C
Sbjct: 730 LQACRNVFKLSTLFFTITVVAIFIFNRIHC 759

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  166 bits (421), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 162/576 (28%), Positives = 254/576 (44%), Gaps = 81/576 (14%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARLHI----IISSMCLGSFLAALDNTIVTTLLSHIAS 90
           ET +LL + +EA       +     L +    I+ S+ LGSFL++LD+TIV  +++ +A 
Sbjct: 6   ETANLLPAPEEAEVLPLEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAE 65

Query: 91  EFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLW 150
           EF+E S   WIAT++LL++  FQPLYGK+SDI GRRP ++ +  FF LGCL+   ++N+ 
Sbjct: 66  EFSESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCFARNVT 125

Query: 151 TLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSE 210
                          + ++ SI  SDI   R R +YQ                    F E
Sbjct: 126 EFSIARAVCGIGAGGLNAISSIAVSDICTARERGVYQGYANIVFGFGQLLGAPLGGIFIE 185

Query: 211 SKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLG 270
           +  GWR  F VQVP+  +  +L I              V   K+ +  +K+ L RID  G
Sbjct: 186 TI-GWRALFGVQVPMIIVCSILAI-----KNINIKLFHVPPMKE-RYTLKN-LSRIDIFG 237

Query: 271 SLSLVTFLFAFMLASSLGGKEIPYNSNIFKL-LVVATILSGTAFIYVELYISDDPILPIR 329
           SLSLV         +++ G     +S++ K+ L + TI S   F+ VE Y + + ILP  
Sbjct: 238 SLSLV---------ATISGVLFLCSSHMNKIYLALFTIGSFIVFVLVERYYATERILPFE 288

Query: 330 FLTNRSILGASFANWFCMMSGVTL---------AFYVPVYWSSVQNLKPTDMGKRIAPNF 380
            LT            FC+ S VT+          F  P+Y   +QN+  T  G  +    
Sbjct: 289 LLTGS----------FCLSSAVTVISSFVVFGEIFRSPIYLQLLQNISVTKTGLFLIFPS 338

Query: 381 FSTAFGSIGAGYYMKKTGR---------YYGFLLKFTXXXXXXXXXXXXXKPDI------ 425
            S A GS+  G+ ++ T            +G ++                 PD       
Sbjct: 339 ISVAVGSLVTGWVLRNTKMNLAHCAYQIIFGGMVTQLLGLGMGYLLLGHLYPDYTVYDML 398

Query: 426 --------STWRQYILL---PLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRST 474
                   S W + I +    L  FG + L+  TL++++  V    Q   T + Y +RS 
Sbjct: 399 ESITFKSHSIWWKLIYVFASVLVSFGYACLLVATLVSIVFTVEKSQQGTMTGVFYLWRSI 458

Query: 475 GSTLGVSVGAALFRNKLSGSLFDSVMKFESDK---YSKEYLLSIIKQASESSEYVHANAP 531
           G+ LG S+    + N LS  L+  + + + D    ++K+   S+I   ++SS     N P
Sbjct: 459 GNVLGASLTLVSYENSLSSMLWSYMFERKRDDGYHFTKKQYYSLI---NDSSYLRKPNFP 515

Query: 532 KFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVI 567
             I   ++  Y++A        FLIS    I+  V+
Sbjct: 516 TDIFVRILDVYKKA--------FLISYLPNIALAVV 543

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  166 bits (420), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 161/555 (29%), Positives = 254/555 (45%), Gaps = 73/555 (13%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I+ S+ LGSFL++LD TIV  +++ +A EF+E S   WIAT++LL++  FQPLYGK+SDI
Sbjct: 38  ILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+  ++ ++ FF +GCL+   ++N+                + ++GSI  SDI   R 
Sbjct: 98  TGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGLNAIGSIAVSDICTARE 157

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXX 242
           R +YQ                    F E+  GWR  F VQVP+  +  VL I        
Sbjct: 158 RGVYQGYANIVFGLGQLLGAPLGGVFIETI-GWRALFGVQVPVIMLCSVLAI-----KNI 211

Query: 243 XXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKL- 301
                 V   K+ +  +K+ L RID  GSLSLV         +++ G     +S++ KL 
Sbjct: 212 NIKLFHVPPMKE-RYTLKN-LSRIDIFGSLSLV---------ATISGVLFLCSSHLNKLY 260

Query: 302 LVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTL-------- 353
           L + TI S   FI VE Y + + ILP+  LT RS         FC+ S VT+        
Sbjct: 261 LTLFTIGSFIVFILVERYYATEKILPLELLT-RS---------FCLSSAVTVISSFVVFG 310

Query: 354 -AFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTG---------RYYGF 403
             F  P+Y   +QN+  T  G  +     S A GS+  G+ ++ T            +G 
Sbjct: 311 EIFRSPIYLQLLQNISVTKTGLFLIFPSVSVAVGSLVTGWLLRNTKINLAHCAYQIIFGG 370

Query: 404 LLKFTXXXXXXXXXXXXXKPDI--------------STWRQYILL---PLPHFGSSVLIT 446
           ++                 PD               S W + I +    L  FG + L+ 
Sbjct: 371 MITQLLGLGLGYLLLAYLNPDYTIYDMLESITFESDSIWWKLIYVFASVLVSFGYACLLV 430

Query: 447 VTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFE-SD 505
            TL++++  V    Q   T + Y +RS G+ LG S+    + N LS  L++ + + + SD
Sbjct: 431 ATLVSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFETKRSD 490

Query: 506 KY--SKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWIS 563
           KY  +K+   S+I   +++S     N P  I   ++  Y++A    F   +L +I   + 
Sbjct: 491 KYHFTKKQYYSLI---NDTSYLRGPNFPTDIFVRILDIYKKA----FLISYLPNIVLAVV 543

Query: 564 CGVIKEYKLHTSMER 578
             V+  Y +H + +R
Sbjct: 544 GIVLSFYLVHHTYKR 558

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score =  166 bits (419), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 156/545 (28%), Positives = 245/545 (44%), Gaps = 79/545 (14%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I+ S+ LGSFL++LD+TIV  +++ +A +F+E S   WIAT++LL++  FQPLYGK+SDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+  ++I+  FF LGCL+   ++N+                + ++ SI  SDI   R 
Sbjct: 98  TGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXX 242
           R +YQ                    F E+  GWR  F VQVP+  +  +L I        
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIETI-GWRALFGVQVPMIMLCTILAI-----KNI 211

Query: 243 XXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKL- 301
                 V   K+ +  +K+ L RID  GSLSLV         +++ G     +S++ KL 
Sbjct: 212 NIKLFHVPPMKE-RYTLKN-LSRIDLFGSLSLV---------ATISGVLFLCSSHLNKLY 260

Query: 302 LVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTL-------- 353
           L + TI S   F+ VE Y + + ILP   LT            FC+ S VT+        
Sbjct: 261 LSLFTIGSFIVFVLVERYYATERILPFELLTPS----------FCLSSAVTVISSFVVFG 310

Query: 354 -AFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTG---------RYYGF 403
             F  P+Y   +QN+  T  G  +     S A GS+  G+ ++ T            +G 
Sbjct: 311 EIFRSPIYLQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTKINLAHCAYQIIFGG 370

Query: 404 LLKFTXXXXXXXXXXXXXKPDI--------------STWRQYILL---PLPHFGSSVLIT 446
           ++                 PD               S W + I +    L  FG + L+ 
Sbjct: 371 MVTQLLGLGLGYLLLAHLNPDYTVYDMLESITFKSNSIWWKLIYVFASVLVSFGYACLLV 430

Query: 447 VTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDK 506
            TL++++  V    Q   T + Y +RS G+ LG S+    + N LS  L++ + K + + 
Sbjct: 431 ATLVSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKSKRED 490

Query: 507 ---YSKEYLLSIIKQASESSEYVHANA-PKFIQATLIQCYEQACKSTFAFCFLISIFAWI 562
              +SK+   S+I    + S Y+  N  PK++   ++  Y++A        FLIS    I
Sbjct: 491 EYHFSKKQYYSLI----DDSSYLRGNNFPKYVFVRILDVYKKA--------FLISYIPNI 538

Query: 563 SCGVI 567
           +  VI
Sbjct: 539 ALAVI 543

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score =  161 bits (408), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 152/522 (29%), Positives = 235/522 (45%), Gaps = 69/522 (13%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I+ S+ LGSFL++LD+TIV  +++ +A EF+E S   WIAT++LL++  FQPLYGK+SDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+  ++ +  FF LGCL+   ++N+                + ++ SI  SDI   R 
Sbjct: 98  TGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXX 242
           R +YQ                    F E+  GWR  F +QVP+  +  VL I        
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIETI-GWRALFGIQVPVIMLCSVLAI-----KNI 211

Query: 243 XXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKL- 301
                 V   K+ +  +K+ L RID  GSLSLV         +++ G     +S + KL 
Sbjct: 212 NIKLFHVPPMKE-RYTLKN-LSRIDIFGSLSLV---------ATISGVLFLCSSQLNKLY 260

Query: 302 LVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTL-------- 353
           L + TI S   FI VE Y + + ILP   LT RS         FC+ S VT+        
Sbjct: 261 LALFTIGSFIVFILVERYYATEKILPFELLT-RS---------FCLSSAVTVISSFVVFG 310

Query: 354 -AFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTG---------RYYGF 403
             F  P+Y   +QN+  T  G  +     S A GS+  G+ ++ T            +G 
Sbjct: 311 EIFRSPIYLQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTKINLAHCAYQIIFGG 370

Query: 404 LLKFTXXXXXXXXXXXXXKPDI--------------STWRQYILL---PLPHFGSSVLIT 446
           ++                 PD               S W + I +    L  FG + L+ 
Sbjct: 371 MIMQLLGLGLGYFLLSHLNPDYTIYDMLESITFRSNSIWWKLIYVFASVLVSFGYACLLV 430

Query: 447 VTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDK 506
            TL++++  V    Q   T + Y +RS G+ LG S+    + N LS  L++ + K + D 
Sbjct: 431 ATLVSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKTKRDD 490

Query: 507 ---YSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQA 545
              ++K+   S+I   ++SS     N P  I   ++  Y++A
Sbjct: 491 EYHFTKKQYYSLI---NDSSYLRGPNFPTDIFVRILDVYKKA 529

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score =  159 bits (402), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 161/615 (26%), Positives = 268/615 (43%), Gaps = 94/615 (15%)

Query: 5   DRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIII 64
           D TS L P+R+++              E  E ++ LE      E      +S  +  I++
Sbjct: 5   DETSSLLPIRSSI--------------EDGEEDNGLE------EQYHEYNLSLPKFPILL 44

Query: 65  SSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFG 124
           S + LGSFL++LD+TIV  +++ +A EF E     WIAT++LL++  FQPLYGK+SDI G
Sbjct: 45  S-LWLGSFLSSLDSTIVANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITG 103

Query: 125 RRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRA 184
           R+  ++ S+ FF LGC +   ++N+                V ++ SIT SDI   R R 
Sbjct: 104 RKFAVLTSHFFFGLGCFLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRERG 163

Query: 185 LYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXX 244
           +YQ                    F +S  GWR+ F VQVP+  +   L            
Sbjct: 164 IYQGYANIVFGLGQLLGAPLGGLFIDSV-GWRVIFGVQVPMLLLCSTL-----ATRNINV 217

Query: 245 XXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVV 304
               +   K+ +   K+ L RID  GSL+LV  + + +  +S    +I        +L +
Sbjct: 218 KLAHIPPRKE-RFTWKN-LSRIDIFGSLALVGTISSLLFLTSTTLNKI--------VLTL 267

Query: 305 ATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYV------- 357
           + I S   FI++ELY + + ILP        +L  SF    C +  V  +F V       
Sbjct: 268 SMIASFILFIWIELYYAKERILPF------DLLKGSFG--LCSLVTVASSFVVFGDIFRS 319

Query: 358 PVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRY-----YGFLLKFT---- 408
           P+Y   VQ++  T  G  +     + A GS+  G+ ++ T +      YG +L       
Sbjct: 320 PIYLQLVQDISVTKTGLFLVFPSIAVAGGSLVTGWILRHTKKNLSHCAYGIILGGVCIQL 379

Query: 409 -----------------XXXXXXXXXXXXXKPDISTWR--QYILLPLPHFGSSVLITVTL 449
                                          P+   W+    + L L  +G + L+  TL
Sbjct: 380 CGLVIAYYLIKNLKPAMVHIDDSAMAFFTFTPNSIMWKIIYALALILVSYGYASLLVATL 439

Query: 450 LAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSL----FDSVMKFESD 505
           ++++  +    Q   T I Y +RS G+ LG S+   ++ N L+  L    F++  K +S 
Sbjct: 440 VSIVFTIEKSQQGTMTGIFYLWRSIGNVLGASLTLVIYENSLAKKLWNYMFETNNKKDSY 499

Query: 506 KYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTF----AFCFLISIFAW 561
            +SKE   ++++   +SS    AN P     +L+  Y  +   ++    A  FL  I +W
Sbjct: 500 IFSKEEYYTLVR---DSSYLRAANFPALTLRSLLNVYRDSFLISYWPNIALAFLGLIVSW 556

Query: 562 ISCGVIKEYKLHTSM 576
           +   ++++Y   T +
Sbjct: 557 V---LVRKYPRTTKI 568

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score =  157 bits (398), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 138/519 (26%), Positives = 240/519 (46%), Gaps = 23/519 (4%)

Query: 52  VSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSAT 111
           V +++R R  I  S MC   F  A+D+TI+ +++S IASEF+EL  +S I + YLLS+A 
Sbjct: 258 VHDLTRRR--IFSSCMCTYLFFIAMDSTILMSIVSKIASEFHELWRLSLIISIYLLSNAI 315

Query: 112 FQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGS 171
            Q ++ K+S +   + L+ ++   FILG  +   + + WT V            + +L S
Sbjct: 316 GQLVFLKLSIVTSVKLLLCVAQFSFILGSYLSWSAFHFWTFVFARSITGFGSGALMALKS 375

Query: 172 ITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESK-NGWRMAFLVQVPLCAI-- 228
              +     +                          F  S+ +GW+ AFL+ VP C +  
Sbjct: 376 TIMNRFSDKKKNGYSLSASVIVFSLGVAIGPFLVYLFDNSRGSGWKNAFLIPVPFCLVNA 435

Query: 229 SLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLG 288
           S++L  I+              + K     IK  L   D    L+L   L  F+  +SL 
Sbjct: 436 SIMLADIYSIKDNLHHGGSAPISWKR----IKKILMSPDLYEILTLALLLLCFVQVTSLD 491

Query: 289 GKEIPYNSNIFKLLVVATILSGTAFIYVELYIS-DDPILPIRFLTNRSILGASFANWFCM 347
              + +++ I  +L    I  G  F ++E   +  + I+ +    ++ ++       FC 
Sbjct: 492 ITRLEHSAVIQGVLFFVIITCGILFWWIETNETYANSIISMSLRGDKHLMWTIMGISFCF 551

Query: 348 MSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKF 407
            + + +  +   Y++ V N+    + +R+ P   +   G     Y+ K   + Y   +  
Sbjct: 552 AALMCIIPFGTTYFTIVLNISTLQIAERLLPLSVAIVVGYFSVCYFWKPQMKNYLLEVVL 611

Query: 408 TXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHE-HQAATTS 466
                            +  W+QY+ L LP  GS++++T     +++++ HE HQ   + 
Sbjct: 612 GGVTLILYIALMGASLSLPVWKQYVCLSLPLLGSAMILT-----LLSSLYHEYHQPKKSP 666

Query: 467 IS----YAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASES 522
           IS    Y F + G T+G+S+G  +F   L  ++ D VMKF    Y ++ LL II+ A++S
Sbjct: 667 ISGSIVYCFSAMGGTIGISLGGYVFHKTLLKAVHDGVMKFSKHGYHEKDLLKIIEHATQS 726

Query: 523 SEYVHANAPKFIQATLIQCYEQACKSTF---AFCFLISI 558
           S++VH +APKFI  TLI+CY QAC++ F   A  F I++
Sbjct: 727 SDWVHESAPKFIFQTLIECYLQACRNVFKLSAILFTITV 765

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score =  153 bits (386), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 147/534 (27%), Positives = 235/534 (44%), Gaps = 65/534 (12%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I+ S+ L + + A+D TI++T ++ IAS F E S ++W+ATAY+L++   QPLYGK SD+
Sbjct: 50  ILLSLWLNTSICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDL 109

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+  ++ + + FI+G ++CG ++ +  L+            + ++ +I  SD+ PL  
Sbjct: 110 LGRKKCLLFAEVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQ 169

Query: 183 RALY----QXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXX 238
           R++Y                        WF     G R  F+VQ+P C  SL L + +  
Sbjct: 170 RSIYWGWGSVIWGFSQSVGGPLGGLLLNWF-----GVRGLFVVQIPFCLFSLSLTVKY-- 222

Query: 239 XXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFM-LASSLGGKEIPYNSN 297
                     +SN   G        + ID+ GS  L+T + AF+ L SS G        +
Sbjct: 223 -------IHDLSNQTQG------TWRDIDFAGSFCLITGISAFIFLCSSSGDVTDDSAVS 269

Query: 298 IFKL-LVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGA-SFANWFCMMSGVTLAF 355
           +FK+   + T+LS + FIYVE  ++   ILP   L  +  LG  SF      M      F
Sbjct: 270 LFKVGCFLITVLSVSGFIYVEKNVAAKSILPAEVL--KGSLGVISFIYGLASMLSYVGLF 327

Query: 356 YVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTG----------------- 398
            VP+Y   V  +     G  I     ST+ GS G+G+ ++K G                 
Sbjct: 328 VVPLYLQLVWGVSVAGSGGYIMYAVISTSIGSFGSGWLLRKYGAPDKDATLLNSGMMLIG 387

Query: 399 ----RYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFG-SSVLITVT-LLAM 452
                  GF + F               P     + + LL     G S+   +V+ +L  
Sbjct: 388 STLINTLGFFVMFKNILEIKPAFEGVKSPSPDQ-KFWFLLGFAIMGLSAGFQSVSVMLYT 446

Query: 453 IAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYL 512
           +A V  + QA++TS+++ FRS G+ L VS+  ++F   L G L       +SD Y K   
Sbjct: 447 VAKVGRKGQASSTSVTFLFRSLGNVLSVSISLSVFVASLKGKLKSYFQGQQSDLYRK--- 503

Query: 513 LSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTF----AFCFLISIFAWI 562
             ++K   E++       P      L+Q ++ A    F      CFL   FA +
Sbjct: 504 --LLK---ENAFLRSGEVPSDQLKDLLQVFKSAIVKAFWPSVVCCFLSVTFAGV 552

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score =  155 bits (391), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 150/527 (28%), Positives = 243/527 (46%), Gaps = 32/527 (6%)

Query: 43  EDEAREGLQVSEMSRARLH------IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELS 96
           EDE       S  S A +H      I  S MC   F  A+D++I+  ++S IASEF+EL 
Sbjct: 225 EDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELW 284

Query: 97  HISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXX 156
            +S I + YLLS+A  Q L+ K+S I   + L+ ++   FILG  +   S + WT +   
Sbjct: 285 RLSLIVSVYLLSNAIGQLLFLKLSIISSVKLLLCMAQFSFILGSYLSWSSSHFWTFIFAR 344

Query: 157 XXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKN--G 214
                    + +L S T  +    ++ + Y                       +S +  G
Sbjct: 345 FVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSG 403

Query: 215 WRMAFLVQVPLCAI--SLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRI----DW 268
           W+ AFL+ VP C +  S++L  I+              + +     +  ++K+I    D 
Sbjct: 404 WKNAFLIPVPFCLVNASIMLADIYSVKDNL--------HHEGSTFTLWKRVKKILLSPDL 455

Query: 269 LGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVE---LYISDDPI 325
              L+L  FL  F+  ++L   E+ + + I  +L    ++ G  F  +E    Y+  + +
Sbjct: 456 YEILTLTLFLLCFVQVTTLDLTELEHRTMIQWVLFSVILICGVLFWLIEANDTYM--NSV 513

Query: 326 LPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAF 385
           + +    ++ ++       FC  + + +  +   Y++ V NL    + +R+ P FFS   
Sbjct: 514 ISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVI 573

Query: 386 GSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDIS--TWRQYILLPLPHFGSSV 443
           G     Y+ K   + Y  LLKF                 +S   W+QY+ L LP  GSS+
Sbjct: 574 GYFSVCYFWKSKKQNY--LLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSLPFLGSSM 631

Query: 444 LITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFE 503
           L+T+                + SI Y F + G T+G+S+G  +F   L+ SL + VMKF 
Sbjct: 632 LLTLLSSLYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFS 691

Query: 504 SDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTF 550
              Y K+ LL IIK A+ESS++VH +APKFI  TLI+CY QAC++ F
Sbjct: 692 KQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVF 738

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score =  152 bits (384), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 156/581 (26%), Positives = 252/581 (43%), Gaps = 82/581 (14%)

Query: 35  ETEHLLES------EDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHI 88
           ET  LLE       +D   +      +S  +L I++S + LGSFL++LD TIV  +++ +
Sbjct: 6   ETTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLS-LWLGSFLSSLDGTIVANIMNRV 64

Query: 89  ASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKN 148
           A EF E     WIAT+YLL++  FQPLYGK+SD+ GR+  ++ ++ FF LGCL+   + +
Sbjct: 65  AEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANS 124

Query: 149 LWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWF 208
           +                + ++ SIT SDI   R R +YQ                    F
Sbjct: 125 VTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQGYANIVFGLGQILGAPIGGLF 184

Query: 209 SESKNGWRMAFLVQVP---LCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLK- 264
            ++  GWR+ F +QVP   LC+ SLV                 V+      + ++++ K 
Sbjct: 185 IDTL-GWRILFGLQVPTILLCS-SLV--------------HKNVNIKLSHLLPVEERFKW 228

Query: 265 ----RIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYI 320
               RID LGS +LV     F ++  L       N     LL + T++S  AFI +ELY 
Sbjct: 229 SNLSRIDILGSSTLV-----FTISGVLFLCSTELNK---ALLSIFTVISFIAFILIELYY 280

Query: 321 SDDPILPIRFLTNRSIL--GASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAP 378
           S + I+P   L     L   A+  + F +   +   F  P+Y   +Q +  T  G  +  
Sbjct: 281 SKERIMPFELLKGSFGLASAATVISSFIIFGDI---FRSPIYLQLIQGVSVTKTGFFMLF 337

Query: 379 NFFSTAFGSIGAGYYMKKTG-----------------RYYGFLLKF--------TXXXXX 413
              S A GS+  G+ ++ T                  +  G ++ +        +     
Sbjct: 338 PSISVAVGSLATGWILRHTKMKLSHCAYWIVTIGMSIQLLGLVVAYYLIQNLEPSLSGSA 397

Query: 414 XXXXXXXXKPDIS----TWRQ-YIL-LPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSI 467
                     +IS    TW   Y L L L  FG + L+  TL+ ++  +P   Q   T I
Sbjct: 398 IFGAFVQIGQNISSQSYTWVVIYALALILVSFGYACLLVATLVNIVFTIPKSQQGTVTGI 457

Query: 468 SYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYS---KEYLLSIIKQASESSE 524
            Y +RS G+ LG S+    +   +S  L++ +   + D Y+   KEY     K  S++S 
Sbjct: 458 FYLWRSIGNVLGASLTLVFYEKGVSSFLWNYMFNKQHDDYNFSKKEYR----KLLSDTSY 513

Query: 525 YVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCG 565
               + P  I   L++ Y  +   ++   F+++I     CG
Sbjct: 514 LRSGHFPDGILFELLKVYRNSFLLSYLPNFILAIAGVAICG 554

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score =  152 bits (383), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 129/480 (26%), Positives = 223/480 (46%), Gaps = 52/480 (10%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I++S+ LGSF+++LD TIV  +++ +A EF+E     WIAT++LL++  FQPLYGK+SD+
Sbjct: 37  ILTSLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDV 96

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+  ++++  F ++GCL+  L++N+                + +  SIT SDI   + 
Sbjct: 97  TGRKFALLMAYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKE 156

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXX 242
           R +YQ                    F ++  GWR  F +QVP+  +S  L   +      
Sbjct: 157 RGIYQGYANIVFGMGQMLGAPLGGLFIDTI-GWRAIFGIQVPVVMVSAFL--AYRNVNIK 213

Query: 243 XXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLL 302
                 +S     K      L RID+LGS++         LAS++ G  +  ++++ KL+
Sbjct: 214 LSHVPPISERFTRK-----NLSRIDFLGSVT---------LASTICGVLVLCSTDLNKLV 259

Query: 303 V-VATILSGTAFIYVELYISDDPILPIRFLTNRSILGA--SFANWFCMMSGVTLAFYVPV 359
           V +AT  S   F++VEL+ + + ILP   L     L +  +  + F +   +   F  P+
Sbjct: 260 VSLATAASFVLFLWVELFYAAERILPFELLKGPFGLSSVVTVCSSFVIFGDI---FRSPI 316

Query: 360 YWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGR----------YYGFLLKFTX 409
           Y   + +L  T+ G  +     S A GS+  G  +++T +            G  L+ T 
Sbjct: 317 YLQLIHDLSVTNTGLFMIFPSVSVAVGSLVTGAVLRRTSKSLELCSYLFVLAGIALQLT- 375

Query: 410 XXXXXXXXXXXXKPDIST----------------WRQYILLP--LPHFGSSVLITVTLLA 451
                       +P +ST                W+   +    L  FG + L+  TL++
Sbjct: 376 GLVISYYLVGVVEPALSTQMASTLTFQFASQSTLWKLVFVFASVLVGFGYACLLVSTLVS 435

Query: 452 MIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEY 511
           ++ ++    QA  T I Y +RS G+ LG S+   +F+N L+ SL   +++       K+Y
Sbjct: 436 IVFSIDKSQQATMTGIFYLWRSIGNVLGASLTLVVFQNSLTTSLRKYMLESHRSFTKKQY 495

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score =  152 bits (383), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 152/607 (25%), Positives = 265/607 (43%), Gaps = 86/607 (14%)

Query: 5   DRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIII 64
           D TS L P R+ +              EV E E+ +  E +  E      +S  ++ I+ 
Sbjct: 5   DETSSLLPARSTIE-------------EVPEGEYEISLEKKYHE----HNLSLPKVPIL- 46

Query: 65  SSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFG 124
           SS+ LGSF ++LD+TIV  +++ +A EF E     WIAT++LL++  FQPLYGK+SDI G
Sbjct: 47  SSLWLGSFFSSLDSTIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDITG 106

Query: 125 RRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRA 184
           R+  ++ ++ FF LGCL+   ++N+                + ++ SIT SDI   R R 
Sbjct: 107 RKFAVLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRERG 166

Query: 185 LYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXX 244
           ++Q                    F +   GWR  F +QVP     +++   +        
Sbjct: 167 IFQGYANIVFGMGQVLGAPLGGLFLDHI-GWRTLFGIQVP-----MIMFCSYLTITNVNI 220

Query: 245 XXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVV 304
               V   K+ +   K+ L RID  GSLSLV  +   +  +S    ++        LL +
Sbjct: 221 KLLHVPPRKE-RFTWKN-LSRIDIFGSLSLVATISGILFLTSTQLDKL--------LLSL 270

Query: 305 ATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYV------- 357
            T +S   F+++ELY + + ILP        +L  SF    C +  V  ++ V       
Sbjct: 271 FTFISFGLFMWIELYYAKERILPF------DLLNGSFG--LCSVVTVISSYVVFGDIFRS 322

Query: 358 PVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRY-----YGFLLKFTXXXX 412
           P+Y   +Q++  T  G  +     + A GS+  G+ ++ T +      YG +L       
Sbjct: 323 PIYLQLIQDISVTKTGLFLIIPSIAMAGGSLVTGWILRNTTKNLSHCAYGIILSGVIIQL 382

Query: 413 XXXXXXXX----XKPDIS------------------TWRQYIL--LPLPHFGSSVLITVT 448
                         P ++                  TW+   +  L L  +G S ++  T
Sbjct: 383 AGLVIAYLLIGHLNPSLNQLGNVFNIAMENFTSGSRTWKVIFVFSLLLGSYGYSSILVAT 442

Query: 449 LLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSL----FDSVMKFES 504
           L++++  +    Q   T I Y +RS G+ LG S+   L+RN L+  L    F++  K +S
Sbjct: 443 LVSIVFTIEKSQQGTMTGIFYLWRSIGNVLGASLTLVLYRNTLAKRLWIYMFETENKPDS 502

Query: 505 DKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFA-WIS 563
             ++K+   ++I+   +S      N P     +L+  Y  +   ++     +S+    ++
Sbjct: 503 YIFTKDQYYNLIR---DSGCLRRVNFPIETLKSLLNIYRGSFLISYIPNIALSVLGIMVA 559

Query: 564 CGVIKEY 570
           C ++++Y
Sbjct: 560 CVLLRKY 566

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score =  148 bits (374), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 144/553 (26%), Positives = 237/553 (42%), Gaps = 61/553 (11%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I+ S+ LGSF++ALD T+V  +++ IA+EF E     WIAT+YLL++  FQPLYGK+SDI
Sbjct: 44  ILLSLWLGSFVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDI 103

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+  +I ++ FF LGCL+   ++N+                + ++ SIT +DI   R 
Sbjct: 104 TGRKVAVITAHFFFALGCLLTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARE 163

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXX 242
           R +YQ                   +  +S  GWR  F +QVP+  +  VL          
Sbjct: 164 RGVYQGYANVVFGTGQLLGAPIGGFLLDSI-GWRSIFGIQVPMLMLCSVL---------- 212

Query: 243 XXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFK-L 301
                 + N     V I  + +R  W  +LS +    +  L +++ G     +SN  K L
Sbjct: 213 -----ALKNVNIKLVHIPPRNERFTW-KNLSRIDIFGSISLVATISGILFLTSSNWNKSL 266

Query: 302 LVVATILSGTAFIYVELYISDDPILPIRFLTNRSILG--ASFANWFCMMSGVTLAFYVPV 359
           L + T+LS + FIY+ELY++ + I+P   L     L   A+    F +   +   F  P+
Sbjct: 267 LGIFTVLSFSLFIYIELYVAKERIMPFELLKGSFGLSSIATVITSFIIYGEI---FRSPI 323

Query: 360 YWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGR---------YYGFLLKFTXX 410
           Y   +QN+  T  G  +     + A GSI  G  ++ T            +G ++     
Sbjct: 324 YLQLIQNVSVTVTGLYLIFPSVAIALGSIVTGSILRNTKMDLAHCAAAIIFGGMIMQLAG 383

Query: 411 XXXXXXXXXXXKPDI--------------------STWRQYILLPLPHFGSS---VLITV 447
                       P +                    S W + + +     GSS    L+  
Sbjct: 384 LALSYYLLSHVNPALDLADLPANLFSAATIYFVSDSIWWKIVYVGALVIGSSGYASLLVA 443

Query: 448 TLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKY 507
           TL++++  V    Q   T I Y +RS G+ LG S+   +F   L   L++ +    S   
Sbjct: 444 TLVSIVFTVDRSKQGTITGIFYLWRSIGNVLGASITLVVFERSLGRMLWEFMFGDSSTTG 503

Query: 508 SKEYLLSIIKQASESSEYVHANA-PKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGV 566
           S  +  S  ++    S Y+     P    A L++ Y +A   ++     +SI      G+
Sbjct: 504 SYRFKKSEYRRLISDSSYLRKGPFPAKALAGLLKVYNKAFLISYVPNMGLSIL-----GI 558

Query: 567 IKEYKLHTSMERK 579
           +  + L+ S  +K
Sbjct: 559 LVAWMLYRSHGKK 571

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 156/558 (27%), Positives = 242/558 (43%), Gaps = 52/558 (9%)

Query: 32  EVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASE 91
            V + E +  ++D+  E + +S +    L II +++    FLA  D TI  +    I +E
Sbjct: 33  HVRDNEEIQNADDD--EDIPLSRI--PNLWIIEATLFSNVFLAGFDGTITASTYQTIGNE 88

Query: 92  FNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWT 151
           FN++S  SWI TAYL++S +FQPLYG  SD  GRR  +  +N  F +GCL C  S N++ 
Sbjct: 89  FNQMSISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTIGCLACSFSTNIYM 148

Query: 152 LVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSES 211
           L             + +L +I  SD++P   R ++Q                     + S
Sbjct: 149 LSFMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIT-S 207

Query: 212 KNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDK---DGKVDI----KDKLK 264
             GWR  FL+QVP+  I+ +L+  +            V N K   D K++I    K  LK
Sbjct: 208 TIGWRWCFLIQVPISMIASLLMNYY------------VPNQKEYDDQKINILLSSKKILK 255

Query: 265 RIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDP 324
            ID  GS+ ++  L   +L  SLG      N  +  LL +A+I+    FI  E   +   
Sbjct: 256 DIDITGSILIIAGLTLQLLYLSLGASFSWTNPPVLMLL-LASIVIIILFILNERKTTARA 314

Query: 325 ILPIRFLTNRS----ILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIA-PN 379
           I+P+  L N S    +L  S    F   +     F +P+++  V        G R+  P+
Sbjct: 315 IIPME-LVNSSFSFVVLSISILVGF---ASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPS 370

Query: 380 FFSTAFGSIGAGYYMKKTG-----RYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILL 434
            F T  GS+  G  M K        Y G  L F               P+   W   + L
Sbjct: 371 LF-TPVGSLITGISMSKYDCLQSLLYIGIFLMF--LGNFLFLFIEKTSPN---WLIGVFL 424

Query: 435 PLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGS 494
              + G  +    TL   I A P   QA  TS  Y FRS GS  GV++ A + +      
Sbjct: 425 IPANLGQGITFPTTLFTFIFAFPKRDQATATSTLYLFRSIGSVWGVAISAGVIQ-----L 479

Query: 495 LFDSVMKFESDKYSKEYLLS-IIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFC 553
            F   ++F       E+ ++ II + + +S Y+ +   + ++ T+I+ ++ A K      
Sbjct: 480 YFARYLRFNLKDLLDEHTINKIITRINANSSYIGSLHGE-VKNTVIKSFDSATKKAHLMS 538

Query: 554 FLISIFAWISCGVIKEYK 571
            L+S+ A I C V    K
Sbjct: 539 TLLSLLALIFCIVKDNLK 556

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score =  148 bits (373), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 144/556 (25%), Positives = 229/556 (41%), Gaps = 38/556 (6%)

Query: 25  LPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTL 84
           L + VG+ V  +             +Q   + R R+  I +++    FL+ LD TI  + 
Sbjct: 9   LSSKVGSSVDYSSVPPTPRGNFEPNVQKPWIDRYRIVFIETALFANVFLSGLDGTITAST 68

Query: 85  LSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICG 144
              I +EF+     +WI TAYL+++ +FQPLYG  SD  GRR  +  +N  F LGCL CG
Sbjct: 69  YQLIGNEFDNFEISNWITTAYLVATTSFQPLYGSFSDTLGRRHCLFFANTVFALGCLGCG 128

Query: 145 LSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXX 204
           L+  + +L+            + +L +I  SDI+P  SR +YQ                 
Sbjct: 129 LAPGILSLIFMRALTGIGGGGLITLSTIVNSDIIPPESRGIYQAFQNVLLGIGAVIGAST 188

Query: 205 XXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLK 264
               + S  GWR  FL+QVP+     ++  +F            VS  +     +K++  
Sbjct: 189 GGAVA-SYLGWRWCFLLQVPVSVGGTIMAYMF-----LENQKGFVSESESSGQLLKNRFS 242

Query: 265 RIDWLGSLSLVTFLFAFML----ASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYI 320
           +ID  GSL L+  L + ++     SS+      + S     L++ T+LS   FI+ E   
Sbjct: 243 KIDLKGSLLLIVGLASQLMYLTVNSSMASSGSQWLSKESIGLILLTVLSLVMFIHTERTT 302

Query: 321 SDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNF 380
             +PI+P + L+          +           F +P+++  V        G R+A   
Sbjct: 303 QANPIIPTKLLSQSHSTMVLVISVLVGFVSYAYLFTLPLFFQIVVGDSAARAGFRLAIPS 362

Query: 381 FSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXX-XXXXKPDISTWRQYILLPLPHF 439
           F T  G +  G  M +  +   FLL F               K     W   +LL   + 
Sbjct: 363 FCTPIGGLITGLSM-RIPKTLPFLLSFGMVLMMIGNAFFLLLKTTTPEWLVCLLLTPANV 421

Query: 440 GSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAAL--------FRNKL 491
           G  V    TL + + +   E+QA  TS  Y FRS GS  GV+  + L         R KL
Sbjct: 422 GQGVTFPATLFSFLFSFHPENQATATSTLYLFRSIGSLWGVAGTSGLIQLLVGRKIREKL 481

Query: 492 SGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFA 551
            G L            S E +  +  +    + Y+    P  I+  +++ YE A K    
Sbjct: 482 HGIL------------SPEEIARLRSKIGHKTSYIE-KLPSEIKEAVVESYESAIK---- 524

Query: 552 FCFLISI-FAWISCGV 566
           F  ++S+ F  I+ G+
Sbjct: 525 FAHILSVSFCVIAIGI 540

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 144/547 (26%), Positives = 239/547 (43%), Gaps = 25/547 (4%)

Query: 9   LLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRAR---LHIIIS 65
           +L+ +R+    +  +G+  Y   EV ET  L+E   +  +  +  +M+ +R   L II +
Sbjct: 1   MLKSIRHISPNKNKDGI--YGSIEVTETS-LVEDNADIEDVDKDEDMALSRIPNLWIIEA 57

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           ++    FL+  D T+  +    I +EFN++S  +WI TAYL++S +FQPLYG  SD  GR
Sbjct: 58  TLFSNVFLSGFDGTVTASTYQTIGNEFNQMSISNWITTAYLITSTSFQPLYGSFSDALGR 117

Query: 126 RPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRAL 185
           R  +  +N  F +GCL C LS N++TL             + +L +I  SD++P   R +
Sbjct: 118 RNCLFFANAAFTIGCLACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRGI 177

Query: 186 YQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXX 245
           +Q                     + S  GWR  FL+QVP+  IS VL+  +         
Sbjct: 178 FQAFQNLLLGFGAICGASFGGTIA-STIGWRWCFLIQVPISIISSVLMNYYVPNQKEY-- 234

Query: 246 XXXVSNDKDGKV--DIKDKLKRIDWLGSLSLVTFLFAFMLASSLG--GKEIPYNSNIFKL 301
                N ++  +  + K  L  ID  GS+ ++T L   +L  SLG  G ++ + S    L
Sbjct: 235 -----NHENSNIFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLL 289

Query: 302 LVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYW 361
           L+V +I     FI  E   +   I+P+  +++         +     +     F +P+++
Sbjct: 290 LLVGSIAILLLFISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYAYLFTLPLFF 349

Query: 362 SSVQNLKPTDMGKRIA-PNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXX 420
             V        G R+A P+ F T  GS+  G+ M K       L                
Sbjct: 350 QIVLGDSTAKAGLRLAIPSLF-TPVGSLITGFSMSKYNCLRSLLYVGVSLMFLGNFLFLF 408

Query: 421 XKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGV 480
            +     W   + L   + G  +    TL   I   P   QA  TS  Y FRS GS  GV
Sbjct: 409 IEKTSPNWLISLFLIPANLGQGITFPTTLFTFIFLFPKSDQATATSTLYLFRSIGSVWGV 468

Query: 481 SVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQ 540
           ++ A + +   +  L  S +K   D+ +   L++ +   S   E +H      ++ T+I+
Sbjct: 469 AISAGVIQLSFAKYL-RSNLKDMLDENTIAKLITKLNANSSYIESLHGE----VKNTVIE 523

Query: 541 CYEQACK 547
            ++ A K
Sbjct: 524 SFDAATK 530

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score =  143 bits (361), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 141/554 (25%), Positives = 236/554 (42%), Gaps = 87/554 (15%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I+ S+ +GSFL ALD TIV  +++ +A EF E     WIAT++LL++  FQPLYGK+SDI
Sbjct: 53  IVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDI 112

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+  +++++ FF LGCL+   ++N+                ++++ SIT SDI   R 
Sbjct: 113 TGRKFALLVAHTFFCLGCLLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDICTARE 172

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXX 242
           R  YQ                    F+  + GWR  F +QVP+  I +VL          
Sbjct: 173 RGAYQGYANVVFSTGQLLGAPLGG-FALDRIGWRAIFGLQVPMLLICMVL---------- 221

Query: 243 XXXXXXVSNDKDGKVDIKDK------LKRIDWLGSLSLVTFLFA--FMLASSLGGKEIPY 294
                   N K   V   ++      L RID  GS++LV  +    F+ ++SL       
Sbjct: 222 ---GYRNVNIKLAHVPPLEERFTWKNLSRIDIGGSITLVCTISGVLFLCSTSLNK----- 273

Query: 295 NSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTL- 353
                 +L V T LS   F+Y ELY++ + ILP        +LG SF     +  G +  
Sbjct: 274 -----AILSVFTGLSFMLFMYNELYLARERILPFE------LLGGSFGLASILTVGSSFV 322

Query: 354 ----AFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTG----------- 398
                F  P++   VQN+  T  G  +  +  +TA  S+  G+ ++ T            
Sbjct: 323 IFGDVFRSPIFLQLVQNISVTKTGGFLLFSSIATAAASLITGWILRNTKMNLAKCSYLIV 382

Query: 399 ------RYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILL--------------PLPH 438
                 +  G ++  T               +    R Y+                    
Sbjct: 383 FFSIFLQLCGLVIAVTLLSYLEPNQTSLMANNTRLKRDYLFKSDSLAWKCVYICASAFTG 442

Query: 439 FGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDS 498
           +G + L+  TL++++  +    QA  T + Y +RS G+ LG S+  +L+   LS  L+  
Sbjct: 443 YGYASLLVSTLVSIVFTIDKSQQATITGLFYLWRSIGNVLGASLTLSLYEATLSKKLWSY 502

Query: 499 VMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISI 558
           +    ++  +++Y        S  S Y+  N    + + L+  Y     S+F   ++ S+
Sbjct: 503 L---SANDITEQY-----NNLSRDSSYLRKNFSGELLSGLLDVY----NSSFIVSYVPSV 550

Query: 559 FAWISCGVIKEYKL 572
              + CG++  + L
Sbjct: 551 GICL-CGIVLAWAL 563

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score =  143 bits (360), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 152/563 (26%), Positives = 244/563 (43%), Gaps = 68/563 (12%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARLHI----IISSMCLGSFLAALDNTIVTTLLSHIAS 90
           +T  L+  E    E L+ +E  R  L +    I++S+ LGSF+ +LD TIV  +++ +A 
Sbjct: 4   DTAPLIPPESRDEESLE-AEYHRYNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNRVAE 62

Query: 91  EFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLW 150
           EF E     WIAT++LL++  FQPLYGK+SDI GRR  ++ ++ FF LGCL+   ++++ 
Sbjct: 63  EFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCLLTCFAQSVE 122

Query: 151 TLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSE 210
                          + +  SI  SDI   + R  YQ                      +
Sbjct: 123 QFALARAICGIGGGGINACSSIAVSDICTAKERGSYQGYANIVFGTGQMLGGPIGGLLID 182

Query: 211 SKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIK-DKLKRIDWL 269
           +  GWR  F VQVP        II+F            +S+            L RID +
Sbjct: 183 TI-GWRAIFAVQVP--------IIMFCSFLTYKNITIKLSHIPPVSERFTWMNLSRIDIM 233

Query: 270 GSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIR 329
           GS SLV  +   +   S    ++        +L   TI+    FI  E Y + + ILP++
Sbjct: 234 GSSSLVVVICGILFICSTNWNKV--------ILSTFTIVGFLFFIVTETYFAKECILPLK 285

Query: 330 FLTNRSILGASFANWFCMMSGVTLA--FYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGS 387
            L   S L +       + S +T    F  P+Y+  VQ++  T  G  +     S A GS
Sbjct: 286 LLKGASGLCSLVT---VLSSFITFGEIFRAPIYYQVVQDMSVTKTGLFVLFPAVSVAVGS 342

Query: 388 IGAGYYMKKT----GRY-------------YGFLLKFTXXXXXXXXXXXXXKPDISTWRQ 430
           +  G  ++ T    G Y              G LL +                    W Q
Sbjct: 343 VVTGTALRHTKLDLGHYCYLIILRSIFTQLIGLLLAYVVINGTEPTIGASSSTFAVHWFQ 402

Query: 431 Y--------ILLP----LPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTL 478
           +        ILL     +  +G S L+  TL++++ +V    QA  T I Y +RS GS L
Sbjct: 403 FSSDSIWWKILLVSAGCMVSYGYSGLLVATLVSIVCSVEKSEQATLTGIFYLWRSIGSVL 462

Query: 479 GVSVGAALFRNKLSGSLFDSVMKFESDK---YSKEYLLSIIKQASESSEYVHANAPKFIQ 535
           G S+   ++ N L+ SL+ ++    +D    Y+K+   ++I  +S    Y+ ++ P  +Q
Sbjct: 463 GTSLTLVIYENSLTKSLWGAMFGSRNDDSYHYTKKEYYNLIGDSS----YLRSHFP--VQ 516

Query: 536 ATLIQCYEQACKSTFAFCFLISI 558
           +  I+   +A + +F   +L SI
Sbjct: 517 S--IEYLLKAYRGSFLISYLPSI 537

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score =  142 bits (357), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 132/500 (26%), Positives = 215/500 (43%), Gaps = 18/500 (3%)

Query: 57  RARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLY 116
           R ++ +I +++    FL+ LD+TI  +    I +EF ++   SWI TAYL++  +FQPLY
Sbjct: 39  RHKVLLIETALFTNVFLSGLDSTISASTYQLIGNEFGDVKLSSWITTAYLITCTSFQPLY 98

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASD 176
           G  SD  GRR  +  +N  F LGC  CG +  +++L+            + +L +I  SD
Sbjct: 99  GSFSDTLGRRHCLFFANTIFALGCFGCGTTTTIYSLILMRALTGIGGGGLITLSTIINSD 158

Query: 177 IVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIF 236
           I+P + R +YQ                     + +  GWR  FL+QVP+ ++   L+  F
Sbjct: 159 IIPAKKRGIYQAFQNVLLGTGAVVGASCGGLIATTM-GWRWCFLLQVPI-SVGGTLVAFF 216

Query: 237 XXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTF----LFAFMLASSLGGKEI 292
                       VS  +       +KL++ID+ G+L LV      LF   L S+    E 
Sbjct: 217 FVHDQRPDINGGVSAVRTTG---WEKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSES 273

Query: 293 PYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVT 352
            + S    +L ++T +S   F YVE     +PI+P   L  R   GA+      ++  V 
Sbjct: 274 YWYSPQSIVLTLSTGVSLILFAYVEHTTKANPIIPHDLL--RQAHGATVLIISVLVGFVA 331

Query: 353 LA--FYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXX 410
            A  F +P+Y+  V        G R+    F T  G +  G  MK        L+     
Sbjct: 332 YAYIFTLPLYFQVVIGDTAAKAGLRLTVPSFCTPIGGLITGLSMKNPNHLPVLLISGITC 391

Query: 411 XXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYA 470
                      KP    W+  +LL   + G  +    TL   + A P   QA  TS  Y 
Sbjct: 392 MLLGNLCFLFIKPWTPYWQTSLLLVPANVGQGITFPSTLFTFLFAFPPYKQATATSTLYL 451

Query: 471 FRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANA 530
           FRS G   GV+  ++L +  +      S+    ++K  ++ LL +    S+  +      
Sbjct: 452 FRSVGCVWGVAGTSSLIQYAVRNQAKKSLNGLLTEKEIRKLLLQLSHTTSQIKKL----- 506

Query: 531 PKFIQATLIQCYEQACKSTF 550
           P  +++ +I  Y+ A +  +
Sbjct: 507 PPDVRSAVISSYDNAIRQAY 526

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score =  137 bits (345), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 134/546 (24%), Positives = 235/546 (43%), Gaps = 59/546 (10%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I++S+ LGSFL+ALD TIV  +++ +A +FN  +   WIAT+YLL++  FQPLYG++SDI
Sbjct: 68  ILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDI 127

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+   +I   FF +G  +   SK L                ++++ SI  SDI  ++ 
Sbjct: 128 IGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKE 187

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXX 242
           R +YQ                      + + GWR  F  QVP+ A+++ L   +      
Sbjct: 188 RGMYQGYANIFYGAGQLIGAPIGGLLID-RIGWRALFAFQVPMVAVAMFLSFTYLNIKLA 246

Query: 243 XXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLV-TFLFAFMLASSLGGKEIPYNSNIFKL 301
                     K+ +   K  L ++D  GS++LV T     ++ S  G   +        +
Sbjct: 247 HLP------PKEERYKWK-HLSKLDIFGSITLVITIGICIVILSDNGLNRM--------V 291

Query: 302 LVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTL---AFYVP 358
           L    +LS   F+ +E Y +   ILP++ L         +A+   ++S   +    F  P
Sbjct: 292 LGAMGLLSFGLFLIIEKYYTKHQILPLKCLQG----SFGYASLTIIISTYVIFGEYFRTP 347

Query: 359 VYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTG-----------------RYY 401
           +Y   +QN   +  G  +       A GS+  G  +K++                  ++ 
Sbjct: 348 IYLQVIQNFTVSQSGIFLLFPTICVAGGSVLTGRVLKQSKMDLEKCSYQLIFYSVCTQFV 407

Query: 402 GFLLKFTXXXXXXXXXXXXXKPDIS-----------TWRQY--ILLPLPHFGSSVLITVT 448
           G L+                KP +            +W+    I   L  FG + ++  T
Sbjct: 408 GLLMLTLLINYLHIFNSNNTKPGVGNIFHELTTVDFSWKIIFCIATSLVTFGYASILVAT 467

Query: 449 LLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYS 508
           L++++  V    Q + T + Y +RS G+ LG S+    + N L+  L+     FE+ +  
Sbjct: 468 LVSIVHTVEKSQQGSITGLFYLWRSLGNVLGTSITLITYENNLTSKLYK--FMFENPEQH 525

Query: 509 KEYLLSI--IKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLI-SIFAWISCG 565
            +Y+ +I   K   ++S Y+ ++  K +   L+  Y  A   ++    LI S+   IS  
Sbjct: 526 MDYIFTIEEYKALVKNSGYLRSHFSKDVVEELLAVYRNAFVQSYIPNLLICSVGVVISYL 585

Query: 566 VIKEYK 571
           +++ YK
Sbjct: 586 LMRSYK 591

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score =  133 bits (334), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 110/376 (29%), Positives = 167/376 (44%), Gaps = 37/376 (9%)

Query: 33  VAETEHLLESE---DEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIA 89
           + E+  LL  E   D   E      +S  +  I++S + LGSFL+++D+TIV  +++ +A
Sbjct: 4   IDESTRLLPDEQHCDALDEEYTKYNLSLPKFPILVS-LWLGSFLSSIDSTIVANIMNKVA 62

Query: 90  SEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNL 149
            EF E     WIAT++LL++  FQPLYGK+SDI GR+  ++ +  FF LGC +  LS N+
Sbjct: 63  EEFQESQEKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLTALSFFGLGCFLTSLSTNI 122

Query: 150 WTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFS 209
                           + ++ SIT  DI   + R +YQ                    F 
Sbjct: 123 KQFAIARAICGIGGGGINAISSITVGDICTAKDRGIYQGYANIVFGMGQLLGAPVGGLFI 182

Query: 210 ESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWL 269
            +  GWR  F +QVPL  I+++L                V      +      + RID+L
Sbjct: 183 ATI-GWRALFWIQVPLVIIAIIL-------GEMYVNIKLVHVPPPSERFKWKNISRIDFL 234

Query: 270 GSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIR 329
           GS +LV+ +  F++  S     I  +       +        AFIYVELY+S D ILP  
Sbjct: 235 GSFTLVSSITCFIILISTKSNVILLSLLSVLSFI--------AFIYVELYVSKDRILPFE 286

Query: 330 FLTNRSILGASFANWFCMMSGVTLAFYV--------PVYWSSVQNLKPTDMGKRIAPNFF 381
                 +L  SF    C      ++ YV        P+Y   VQ+      G  +     
Sbjct: 287 ------LLKGSFG---CNSIATVISSYVIFGEIFRSPIYLQLVQDFSVIKTGIFLIFPAI 337

Query: 382 STAFGSIGAGYYMKKT 397
           +TA GS+  G  +K+T
Sbjct: 338 TTAIGSLVTGAILKRT 353

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  135 bits (339), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 138/548 (25%), Positives = 232/548 (42%), Gaps = 38/548 (6%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNE 94
           E E++  ++++  E +++S++    L II +++    FL+  D T+  +    I +EFN 
Sbjct: 33  ELENIHGADED--EDIKLSDI--PNLWIIEAALFTNVFLSGFDGTVTASTYQTIGNEFNH 88

Query: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVX 154
           ++  SWI TAYL++S +FQPLYG  SD  GRR  +  +N  F +GCL CGLS N+  L  
Sbjct: 89  MNISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLACGLSPNIVVLSF 148

Query: 155 XXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNG 214
                      + +L +I  SD++P   R ++Q                     + S  G
Sbjct: 149 MRALTGIGGGGLITLSTIVNSDMIPSSKRGIFQAFQNLLLGLGAICGASFGGSIASSI-G 207

Query: 215 WRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDK---DGKVDI----KDKLKRID 267
           WR  F VQVP+C  + +++               V N K   D ++      K  LK ID
Sbjct: 208 WRWCFFVQVPICITNSLIM------------SSYVPNQKEYEDREIGFLFHPKKILKDID 255

Query: 268 WLGSLSLVTFLFAFMLASSLGGKEIPY---NSNIFKLLVVATILSGTAFIYVELYISDDP 324
             GS+ ++  L   +L  SLG  ++     + ++  LL  + I+    F+Y E   S   
Sbjct: 256 VTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIIL-VLFVYNEAKTSARA 314

Query: 325 ILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIA-PNFFST 383
           I+P+  + +         +     +     F +P+++  V        G R+  P+ F T
Sbjct: 315 IIPLELMRSSFSFVVLTISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSLF-T 373

Query: 384 AFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSV 443
             G +  G  M +       L                 +     W   + L   + G  +
Sbjct: 374 PVGGLITGICMSRYNCLQILLYAGVFLMALGNFLFLFIEKGSPNWLVGLFLIPANLGQGI 433

Query: 444 LITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMK-F 502
               TL   I A P   QA  TS  Y FRS GS  GV++   + +     SL  ++    
Sbjct: 434 TFPATLFTFIFAFPKSRQATATSTLYLFRSIGSVWGVAMSTGVIQLYFGKSLRSNLKDLL 493

Query: 503 ESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWI 562
           + DK ++  L++ I   S   E +H      ++  +I C++ + K       ++S+ A  
Sbjct: 494 DEDKINE--LVTKITSNSSYIEKLHGE----LKDVVIDCFDSSTKKAHLLSTILSLLALA 547

Query: 563 SCGVIKEY 570
            C VIKE+
Sbjct: 548 FC-VIKEF 554

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score =  135 bits (340), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 145/572 (25%), Positives = 245/572 (42%), Gaps = 65/572 (11%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNE 94
           E    LE   E  E L++          +++S+   S L+ALD TIV+T ++ +AS F +
Sbjct: 76  EHSGALEGNKEDEEDLEIDLRDPKTFKWVLTSLWTNSALSALDGTIVSTTVNDVASRFQQ 135

Query: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVX 154
            S ++W+ATAYLL++   QPLYGKISDI GRR  ++   + F +G  +C  SK++  L  
Sbjct: 136 ASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAVGVGLCIFSKSIPQLAI 195

Query: 155 XXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNG 214
                        ++ +I  SD+ PL  R  Y                        +  G
Sbjct: 196 ARGICGIGGSGTGAMTNIILSDMAPLSERGKYWGYGSMLGGVFQSLGGPLGG-ILLTYFG 254

Query: 215 WRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSL 274
               F+ Q+P C  +L L   +                +D   D K   KRID+ GS+ L
Sbjct: 255 VSGLFIPQIPFCLATLYLSWKYV---------------QDYNQDTKGSWKRIDFGGSICL 299

Query: 275 V----TFLFAFMLASSLGGKE----IPYNSNIFKLLVVATILSGTAFIYVELYISDDPIL 326
           +    +F+F F    +    E     PY    F + V+ TIL    F+ VE Y++ + I+
Sbjct: 300 LVGISSFIFFFSADENPSISEHSGWSPYKKWSFAIFVLFTIL----FLVVEKYVALENII 355

Query: 327 PIRFLTNRSILG-ASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAF 385
           P+  L  +  LG  +F      M   T  F VP++   V  +  +  G  I     S + 
Sbjct: 356 PMEVL--KGTLGLLAFIQGLVSMINYTELFIVPLFLQLVWGISVSTSGAYIVCIVISYSV 413

Query: 386 GSIGAGYYMKKTGR-------YYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPH 438
           GS+ +G  +KK  +       YY  +  F              +    T   Y    +P 
Sbjct: 414 GSLLSGALIKKVAKPSRESTIYYSGVSIFYMSLISMVGYYFLDRAVRYTKPVYGDTKVPE 473

Query: 439 -FGSSVLITVTLLAM-------------IAAVPHEHQAATTSISYAFRSTGSTLGVSVGA 484
                ++  +TLL +             +A V  + QA++TS+ + FRS G+ L VS+  
Sbjct: 474 SLNFQLIFGITLLGLCQGSQGVTIMLYNVAKVGRKGQASSTSVQFLFRSLGNVLSVSLAF 533

Query: 485 ALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQ 544
            +F N L  +L   V+  ++D+     L +++ +  +++   + + P     ++++ + +
Sbjct: 534 NVFTNALRKTL-GKVLAGKNDE-----LFALLLK--DNAFLRNKDMPTDDLDSILEAFHK 585

Query: 545 ACKSTFAFCFLISIFAWISCGVI-----KEYK 571
           A  S+F  C    I + I  GV+     K+Y+
Sbjct: 586 ALVSSFVPCIWCLILSVIFSGVLWIAVRKQYR 617

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score =  135 bits (339), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 132/548 (24%), Positives = 233/548 (42%), Gaps = 62/548 (11%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           +++ S+ L + + A+D TI++T ++ +AS F E S ++W+ATAY+L++ + QPLYGK SD
Sbjct: 52  LVLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSD 111

Query: 122 IFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLR 181
           + GR+  ++ + + FI+G ++CG+++ +  L             + ++ +I  SD+ PL 
Sbjct: 112 LLGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLS 171

Query: 182 SRALY----QXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFX 237
            R++Y                        WF  S       F++QVP C  SL L + + 
Sbjct: 172 QRSIYWGLGSLIWGFSQSIGGPLGGLLLNWFGVSG-----LFVIQVPFCLFSLFLTVRY- 225

Query: 238 XXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSN 297
                      +++ + G        + ID+ GS  L+  + AF+ + S G      +  
Sbjct: 226 --------IHDLTDQRQG------TWRDIDFAGSFCLIIGISAFIFSCSAGDGVDSNDEG 271

Query: 298 IFKLL-VVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFY 356
            FK++ ++ TI +   F+ VE  ++   ILP   L     +         M+S V L F 
Sbjct: 272 PFKVVCLIVTIAAVAGFVVVEKRMATKSILPAHVLKGSLGVVGLIYGLSSMLSYVGL-FI 330

Query: 357 VPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTG------------------ 398
           VP+Y   V        G  I     ST+ GS  +G+ +++ G                  
Sbjct: 331 VPLYLQVVWGTSVAGSGGYIIYAVVSTSVGSFSSGWLLRRYGSPTRCTTLFNSGIMLVSS 390

Query: 399 ---RYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLI--TVTLLAMI 453
                 GF + F               P  S  + + LL     G S        +L  +
Sbjct: 391 TLINVLGFAILFRNILSISPNFENTGGPSGSQ-KFWFLLGFVIMGCSQGFQNVSVMLYTV 449

Query: 454 AAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLL 513
           A V  + QAA+TS+++ FRS G+ L VS+  +++   L     D  + FE  K    +  
Sbjct: 450 AKVGRKGQAASTSVTFLFRSLGNVLSVSIALSVYVASLK---HDLTIYFEGQKTDLYF-- 504

Query: 514 SIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTF----AFCFLISIFAWISCGVIKE 569
              K   E++     + P+     L+Q ++ A    F      CFL  I A +   +++ 
Sbjct: 505 ---KLLKENAFLRSGSVPEDQLKDLLQLFKAAITDAFWPSVGCCFLSVISATVLFKLVQR 561

Query: 570 YKLHTSME 577
            +   S+ 
Sbjct: 562 SRYSESLN 569

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score =  125 bits (313), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 130/502 (25%), Positives = 207/502 (41%), Gaps = 59/502 (11%)

Query: 35  ETEHLLE--SEDEAREGLQVSEMSRARLHI----IISSMCLGSFLAALDNTIVTTLLSHI 88
           E   LL    ED     +   E     L++    I+ S+ LGSFL ALD TIV  +++ I
Sbjct: 8   ENTRLLSPVDEDNNVHSILEKEYHEQNLNLPKTPILVSLWLGSFLVALDGTIVANVMNRI 67

Query: 89  ASEFNELSHISWIATAYLLSSATFQPLYGKISDI-FGRRPLIIISNLFFILGCLICGLSK 147
           A EF E     WIAT++LL++  FQPLYGK+SD+  GR+   +++  FF LG +I   ++
Sbjct: 68  AEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKGAALVAQFFFCLGLVISCFAQ 127

Query: 148 NLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXW 207
           N+                + ++ SI  SDI   + R +YQ                    
Sbjct: 128 NVTQFAVGRAVCGIGGGGIAAMSSIVVSDICTAKERGMYQGYANIVFGSGQLLGAPLGG- 186

Query: 208 FSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRID 267
              +  GWR  F +QVP+  + +VL                +   K+    +K+ L R+D
Sbjct: 187 LLITTLGWRAIFAIQVPVTLLCMVL-----AFRNVNIKLAHLPPPKEC-FTLKN-LSRLD 239

Query: 268 WLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLV-VATILSGTAFIYVELYISDDPIL 326
            LGS +LV          S+ G    +++ + KL + + T +S   F+Y E Y + + I+
Sbjct: 240 LLGSCTLVM---------SISGLLFLFSTTLNKLWISIFTAVSFGLFVYNEYYWATERII 290

Query: 327 PIRFLTNRSILGASFA--NWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTA 384
           P   L   S + ++    + F M   V   F  P+Y   VQN+     G  I     + A
Sbjct: 291 PFELLRGESGVTSALTVLSSFVMFGDV---FRSPIYLQVVQNVSLARSGLFILFGSIACA 347

Query: 385 FGSIGAGYYMKKTGR---------YYGFLLKFTXXXXXXXXXXXXXKPD------ISTWR 429
             S+  G+ +++T             G ++                KP+        +  
Sbjct: 348 GSSMLTGWLIRRTNMGLVKCAYLIVLGMIISQLAGTAINAVLIAKLKPNQTSHALTDSIT 407

Query: 430 QYILLP--------------LPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTG 475
           Q  L P              L  FG   ++   L++++  VP   QA  T + Y +RS G
Sbjct: 408 QQTLQPEGLLWKIIYVSATVLNTFGYGGVLVAVLVSIVFTVPKSQQATLTGVFYLWRSIG 467

Query: 476 STLGVSVGAALFRNKLSGSLFD 497
           + LG SV   L+   L   L+ 
Sbjct: 468 NVLGTSVTLTLYDLTLKAKLWK 489

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  125 bits (313), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 130/498 (26%), Positives = 212/498 (42%), Gaps = 61/498 (12%)

Query: 30  GAEVAETEHLLES---EDEAREGLQVSEMSRARLHI----IISSMCLGSFLAALDNTIVT 82
           G+   E   LL S   E+E   GL+  E     L +    I+ S+ LGSFL ALD TIV 
Sbjct: 3   GSPPGEDTALLGSISEENECDVGLE-REYHEHNLALPKIPILVSLWLGSFLVALDGTIVA 61

Query: 83  TLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI-FGRRPLIIISNLFFILGCL 141
            +++ IA EF E     WIAT++LL++  FQPLYGK+SD+  GR+   +I+  FF LG +
Sbjct: 62  NVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGLI 121

Query: 142 ICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXX 201
           I   ++N+                V+++ SI  SDI   + R +YQ              
Sbjct: 122 ISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAKERGMYQGYANIVFGSGQLLG 181

Query: 202 XXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKD 261
                    +  GWR  F +QVP+      L  +F            + + ++ +  +K+
Sbjct: 182 APLGG-LLITTIGWRAIFAIQVPMA-----LFCMFLTGRNVNIKLAHLPS-RNERFTLKN 234

Query: 262 KLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVA-TILSGTAFIYVELYI 320
            L R+D LGS +LV          S+ G    +++++ +  + A TI++   FIY E + 
Sbjct: 235 -LSRLDLLGSCTLVL---------SISGLLFLFSTSMNRTWISAFTIVTFAIFIYNERFW 284

Query: 321 SDDPILPIRFLTNRSILGA--SFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAP 378
           + + I+P   L   S + +  +  + F M   V   F  P+Y   VQN+     G  I  
Sbjct: 285 AKERIIPFDLLCGTSGITSLLTVLSSFIMFGDV---FRSPIYLQIVQNVSLAKSGIFILF 341

Query: 379 NFFSTAFGSIGAGYYMKKTG-----------------RYYGFLLKFTXXXXXXXXXXXXX 421
              + A  S+  G+ +++T                  +  G                   
Sbjct: 342 GSVACAATSVLTGWIIRRTTMDLVKCTYLIVLVMIFLQLVGTASNAILIANLIPNNTTYA 401

Query: 422 KPDIS----------TWRQYILLP--LPHFGSSVLITVTLLAMIAAVPHEHQAATTSISY 469
             D++          TW+   +    L  FG   ++   L++++  VP   QA  T + Y
Sbjct: 402 DKDVAIKVALSAKGFTWKVVYVFSTVLNSFGYGGVLVAVLVSIVFTVPKSQQATLTGVFY 461

Query: 470 AFRSTGSTLGVSVGAALF 487
            +RS G+ LG S+  AL+
Sbjct: 462 LWRSIGNVLGTSITLALY 479

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score =  122 bits (306), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 131/478 (27%), Positives = 205/478 (42%), Gaps = 33/478 (6%)

Query: 99  SWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXX 158
           +WI TAYL++S +FQPLYG  SD  GRR  +  +N  F +GCL CG SKN++ L      
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAL 64

Query: 159 XXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMA 218
                  + +L +I  SD++P   R ++Q                     + S  GWR  
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIASSI-GWRWC 123

Query: 219 FLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFL 278
           FL+QVP+  IS +L+  +                  GK+     L+ ID +GS+ ++T L
Sbjct: 124 FLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKI-----LRDIDVMGSILIITGL 178

Query: 279 FAFMLASSLG--GKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRS- 335
              +L  SLG    ++ + S    LL+V +++    FI  E   S   I+P+  L N S 
Sbjct: 179 TLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPME-LVNSSY 237

Query: 336 ---ILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIA-PNFFSTAFGSIGAG 391
              +L  S    F   +     F +P+++  V        G R+  P+ F T  GS+  G
Sbjct: 238 SVVVLSISILVGF---ASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLITG 293

Query: 392 YYMKKTG-----RYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLIT 446
           + M K        Y G  L F               P+   W   + L   + G  +   
Sbjct: 294 FSMSKYNCLRLLLYIGISLMF--LGNFLFLFIEKTSPN---WLIGLFLIPANLGQGITFP 348

Query: 447 VTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDK 506
            TL   I       QA  TS  Y FRS GS  GV++ A + +   +G L  ++     + 
Sbjct: 349 TTLFTFIFMFSKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFAGLLRSNLKGLLDEN 408

Query: 507 YSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISC 564
             K+    +I Q S +S Y+ +   + ++ T+I+ +++A K       L+S  A I C
Sbjct: 409 KIKK----LIVQLSANSSYIGSLHGE-VKNTVIKSFDEATKRAHLMSTLLSSLALILC 461

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score =  122 bits (305), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 95/311 (30%), Positives = 146/311 (46%), Gaps = 17/311 (5%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I+ S+ +GSFL +LD+TIV  +++ +A EF E     WI T++LL++  FQPLYGK+SD+
Sbjct: 42  ILYSLWMGSFLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+  +++++ FF++GCL   LS+NL                +++L SI+ SDI   + 
Sbjct: 102 AGRKTALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKE 161

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXX 242
           R +YQ                   W  +S  GW++ F  QVPL     ++  +F      
Sbjct: 162 RGVYQGYANVVFGTGSMLGGPIGGWLMDSF-GWKVIFAGQVPL-----IMTCMFLGYRNV 215

Query: 243 XXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLL 302
                 V    +      + +KRID  GS+SL+  +  F+   S    +         LL
Sbjct: 216 NIKLLHVPPRHERYR--WENIKRIDLGGSISLIGTISGFLCLCSTDLNK--------PLL 265

Query: 303 VVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWS 362
              T+LS   FI  ELY + + I+P   L+    +  S    F         F  PVY  
Sbjct: 266 ATLTLLSLVLFIMNELYWAPERIIPTDLLSGTFGI-TSLLTVFSSFIAFGDVFRNPVYLQ 324

Query: 363 SVQNLKPTDMG 373
            VQN+ PT  G
Sbjct: 325 LVQNISPTSTG 335

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score =  117 bits (293), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 120/472 (25%), Positives = 200/472 (42%), Gaps = 56/472 (11%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           I++S+ LGSFLA++D +IV  +++ IA EF+E     W+AT++LL++A FQPLYG+ SDI
Sbjct: 46  ILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDI 105

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GR+  ++I+  FF+LG L+   ++N+                + ++ SIT SDI   + 
Sbjct: 106 VGRKCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKE 165

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXX 242
           R +YQ                      E+ N WR+ F  QV   AI + +I+ +      
Sbjct: 166 RGMYQGYANVIFGAGQVLGAPVGGLIMETFN-WRIIFAAQV--VAIMICMILAYRNINLK 222

Query: 243 XXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLL 302
                        K      L RID  GS  L   L +F++  S G            L 
Sbjct: 223 LLHIPPFHQRFTRK-----NLSRIDLFGSSMLSCSLVSFLMLFSSGVSR--------SLW 269

Query: 303 VVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASF--ANWFCMMSGVTLAFYVPVY 360
            + T++S T F   E YI+ + +LP   L     L A     + F M + +   + +PVY
Sbjct: 270 FLLTLVSLTLFCINERYIATERLLPNGILRGHFGLSALLIVVSSFMMFAEL---YRMPVY 326

Query: 361 WSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYG------------------ 402
              +Q++  +  G  +     S++  S+  G+ ++ T +  G                  
Sbjct: 327 LQLIQDISVSRSGIFLLFASVSSSGASLFTGWLLRTTKQDLGKLVYKIALASSFIQLVGM 386

Query: 403 FLLKFTXXXXXXXXXXXX---------------XKPDISTWRQYILLPL--PHFGSSVLI 445
            L  FT                            K D   WR  + + L    F  + L+
Sbjct: 387 MLALFTTSVTEPSQAVHAGWAVFSPRSAGQMHYFKSDSIAWRVLLTVALMCSSFAYASLL 446

Query: 446 TVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFD 497
              L++++       QA    + Y +RS G+TLG SV  +++  +++  L+D
Sbjct: 447 VSILVSIVDTTEKSQQATMIGVFYLWRSIGNTLGASVPLSVYEFEVARKLWD 498

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score =  115 bits (287), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 112/454 (24%), Positives = 192/454 (42%), Gaps = 19/454 (4%)

Query: 99  SWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXX 158
           +WI TAYL++S +FQPLYG  SD  GRR  +  +N  F +GCL CG S N++ L      
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFMRAL 64

Query: 159 XXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMA 218
                  + +L +I  SD++P   R ++Q                     + S  GWR  
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIA-STIGWRWC 123

Query: 219 FLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKV--DIKDKLKRIDWLGSLSLVT 276
           FL+QVP+  IS +L+  +              ND++  +  D K  L  ID +GS+ ++T
Sbjct: 124 FLIQVPISMISSILMNYYVPNQKEY-------NDQNSNIFNDPKKILTGIDVMGSILIIT 176

Query: 277 FLFAFMLASSLG--GKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNR 334
            L   +L  SLG     + + S    LL+  +++    FI  E   +   I+P+  +++ 
Sbjct: 177 GLTLQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSS 236

Query: 335 SILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIA-PNFFSTAFGSIGAGYY 393
                   +     +     F +P+++  V        G R+  P+ F T  GS+  G+ 
Sbjct: 237 YSFVVLSISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLITGFS 295

Query: 394 MKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMI 453
           M K       L                 +     W   + L   + G  +    TL   I
Sbjct: 296 MSKYNCLRSLLYLGISLMFLGNFLFLFIEETSPNWLISLFLIPANLGQGITFPTTLFTFI 355

Query: 454 AAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLL 513
              P   QA  TS  Y FRS GS  GV++ A + +   +  L  ++     +   K+   
Sbjct: 356 FMFPKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFANFLCTNLKGLLDENTIKK--- 412

Query: 514 SIIKQASESSEYVHANAPKFIQATLIQCYEQACK 547
            ++ + S++S Y+ +   + +++ +I+ ++ A K
Sbjct: 413 -LVIKLSDNSSYIGSLHGE-VKSAVIKSFDAATK 444

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  115 bits (287), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 136/556 (24%), Positives = 236/556 (42%), Gaps = 38/556 (6%)

Query: 37  EHLLESEDEAREGL--QVSEMSR-ARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN 93
           E+  E  D+ +  L  + + +SR   L +I +++    FL+  D+T+  +    I +EFN
Sbjct: 40  EYREEPNDDEQGDLDDETTPLSRIPHLWLIEAALYTNVFLSGFDSTVTASTYQTIGNEFN 99

Query: 94  ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLV 153
            +   SWI  +YL++S +FQPLYG  SD+ GRR  +  +++ F +GCL CG+S N+  L 
Sbjct: 100 HMDLSSWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISINILWLS 159

Query: 154 XXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKN 213
                       + +L +I  SD++P   R ++Q                     + S  
Sbjct: 160 FMRAFTGIGGGGLITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVITSSI- 218

Query: 214 GWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLS 273
           GWR  FL+QVP   ISL   +I               + +  +   K+ LK ID+ G+  
Sbjct: 219 GWRWCFLLQVP---ISLAGALIGHLYVRNQDEYERRKSKESSQT--KEMLKHIDFSGAFL 273

Query: 274 LVTFLFAFMLASSLGGKEIP----YNSNIFKLLVVATILSGTAFIYVELYISDDPILP-- 327
           ++  L   ++  SLG         ++S     ++VA+ +    F+  E   S   I+P  
Sbjct: 274 IIIGLTLQLVYLSLGSAADESGNTWSSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSK 333

Query: 328 -IRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIA-PNFFSTAF 385
            +R L +  +L  S    F   +     F +P+++  +        G R+A P+ F T  
Sbjct: 334 LVRSLFSFLVLTISVLVGF---ASYAYLFTLPLFFQVILGDSTAKAGLRLAIPSVF-TPV 389

Query: 386 GSIGAGYYMKK-----TGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFG 440
           G + AG  M K     T  Y G  + F                D  +   + L+P  + G
Sbjct: 390 GGLIAGICMSKFNCLQTLLYVG--IAFMCLGNFLFLYIGADATD--SLIGFFLIP-ANLG 444

Query: 441 SSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVM 500
             +    +L   I A     QA  TS  Y FRS GS  GV+  A + +   S  L  ++ 
Sbjct: 445 QGITFPSSLFTFIFAFSKIDQATATSTLYLFRSIGSVWGVTGSAGIVQFCFSHHLEKALE 504

Query: 501 KFESDKYSKEYLLSIIKQASESSEYVHA-NAPKFIQATLIQCYEQACKSTFAFCFLISIF 559
               ++  ++    +IK+ + ++ Y+     P  ++  +I+ ++ A K          + 
Sbjct: 505 GLLDERKIRK----LIKKITSNTSYIKELEGP--VKVAVIESFDTATKKVHLISTSFCLV 558

Query: 560 AWISCGVIKEYKLHTS 575
           A I C +   +K  T+
Sbjct: 559 ALILCVIKDVFKPKTT 574

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score =  114 bits (286), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 128/473 (27%), Positives = 201/473 (42%), Gaps = 72/473 (15%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
           +++S+   S LAALD TIV+T ++ IAS+F + S ++W+ATAYLL++   QPLYGKISDI
Sbjct: 62  VLTSIWTNSALAALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDI 121

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
            GRR  ++   + F LG L+C  +  +  L              +++G+I  +DI+PL  
Sbjct: 122 IGRRKCLLFGEVIFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSV 181

Query: 183 RALY----QXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXX 238
           RA Y                        WF     G    F  Q+P C  S+ L   +  
Sbjct: 182 RATYWSYGAILASIFQSLGGPIGGLLLKWF-----GVGGLFTPQIPFCIGSIYLSYKYI- 235

Query: 239 XXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYN--- 295
                          D K   +   KRID+ GS+ L+  + +F+   S        +   
Sbjct: 236 --------------HDYKEHARSSWKRIDFGGSICLLVGISSFIFFFSASDNTTIEDDGW 281

Query: 296 SNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGV---- 351
           S   K  VV  I+S  AF ++E +++ + I+P      R IL  +     C+   V    
Sbjct: 282 STPKKWSVVLLIVSIIAFAFIENFVAVECIIP------RVILEGTLGLMVCIHGLVAVIN 335

Query: 352 -TLAFYVPVY---------------------WSSVQNLKPTDMGKRIA-PNFFSTAFGSI 388
            T  F VP++                     +SS  +L  + +  R + P   S  F + 
Sbjct: 336 YTCLFMVPLFLQLNWGVSVSRSGGYIMFIVIFSSAGSLFTSMILNRFSKPTRSSQLFCAA 395

Query: 389 GAGYYMK---KTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFG---SS 442
            A +YM      G YY   ++                P    W   I+L +   G    S
Sbjct: 396 SAIFYMSILTIVGYYY---MQKAIYYSKPIYGSDTQIPKYDNWS--IILGIAILGFCQGS 450

Query: 443 VLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSL 495
             +T+++   +A V  + QA++TS++  FRS G+ L VS+   +F N L   L
Sbjct: 451 QNVTISIYN-VAKVGRKEQASSTSVNLLFRSMGNVLSVSIALNIFTNVLKKKL 502

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 108/467 (23%), Positives = 199/467 (42%), Gaps = 56/467 (11%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ + +FLA++D TI+  +++ +  EF E   I W+AT++LL+S  FQP+YGK+SD+ GR
Sbjct: 52  SLWMANFLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKLSDVTGR 111

Query: 126 RPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRAL 185
           R +++++   F+LGCL+   ++N+W               + ++  IT  D+  ++ +++
Sbjct: 112 RFVLVLAYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVKEQSI 171

Query: 186 YQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXX 245
           YQ                      E+  GWR  FL QVP+  I + L +           
Sbjct: 172 YQSYAHIIYTIGEVLGAPIGGIALETV-GWRAIFLAQVPVLTICIYLTL----------- 219

Query: 246 XXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFK----L 301
                +D   +  I    +R+ W  ++S +    + +L  SL G  +  ++ I +    L
Sbjct: 220 ----CDDDLAQQHIPPHGERLTW-KNISRMDLSGSILLIISLCGVILLSSATIIEYWMWL 274

Query: 302 LVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYW 361
           LV+A   S   FI  ELY   + I+P R L   +I   S           +  +  P++ 
Sbjct: 275 LVIA---SAGLFIINELYWVSECIIPFRKLKG-AIGLTSLLLLVSSFIEYSELYRTPLFL 330

Query: 362 SSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKT---------GRYYGFLLKFTXXXX 412
             VQN+  +  G  +  +  ++A  ++ +G+ ++ T            +G +        
Sbjct: 331 QLVQNMSTSTTGVVLLFSSAASAVATLLSGWVLRTTRTNLGEASFNHMFGSMTLQVAGLT 390

Query: 413 XXXXXXXXXKPDISTWR---QYILLPLPHFGSSVLITVTLLAMIAAVPHEH--------- 460
                     PD S+ +   ++ L P      S +  +  +A ++ V   H         
Sbjct: 391 TILVLIHFLNPDQSSIQVTSEHRLAPFMMNSDSAVWKIIYVAALSTVSSGHAGLLVSTLT 450

Query: 461 ----------QAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFD 497
                     +A  T   Y FR  GS LG S   +++ + LS  L++
Sbjct: 451 SIFVHTETPDRAMFTGAFYLFRYIGSVLGASTALSVYESVLSKRLWN 497

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 106/510 (20%), Positives = 200/510 (39%), Gaps = 29/510 (5%)

Query: 20  ELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNT 79
           E+  G  +    ++++    L  +  A      S+ +R +L + + S+ L  F+ ALD  
Sbjct: 3   EIETGQNSEYNRKISDETKDLSVKQSACIAPDASKRNRVKLFLSLLSLGLSMFVTALDVL 62

Query: 80  IVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILG 139
           IV T++  + + F + +   WI T Y L +A F  L+G++S + G R  +I   + F  G
Sbjct: 63  IVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETG 122

Query: 140 CLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXX 199
            LI  L+K++  L+            + +L  +    +V  +SR L              
Sbjct: 123 SLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLLNCTFAVASI 182

Query: 200 XXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKD----- 254
                   F+     WR  F + +P+  +++ + I F                K      
Sbjct: 183 VGPFLGGAFTTHVT-WRWCFYINLPIGGLAIAIFIFFYNPEGADLLEKGSQTFKKLLSYR 241

Query: 255 -GKVDIKDKLKRIDWLGSLSLVTFL------FAFMLASSLGGKEIPYNSNI-FKLLVVAT 306
              + +K  L ++  L    +V+F+        F+LA + GG+  P+ S I    ++V  
Sbjct: 242 RANLSLKQLLDQL--LFGFDIVSFVLFTAGWLLFLLALTFGGQTHPWKSGIVISFIIVGV 299

Query: 307 ILSGTAFIY-------VELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPV 359
           +L   + IY       ++   +  P+L    ++ R+IL A+F  +F  ++      Y   
Sbjct: 300 LLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNANFTGFFSTIAYNVQMIYSVQ 359

Query: 360 YWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXX 419
           ++  V        G  + P   ST   SI +G  +KKTG     L+  +           
Sbjct: 360 FFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGHIKPLLVFGSAMGVLGSGLMI 419

Query: 420 XXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQA------ATTSISYAFRS 473
                 +   Q  +L LP      ++   L+     +     +       TTS++   +S
Sbjct: 420 LLNNTSTKHTQIGVLILPGVALGFVLPAALITCHVQLDRTSPSYGADMLETTSVNALLKS 479

Query: 474 TGSTLGVSVGAALFRNKLSGSLFDSVMKFE 503
            G+T+G  +   +F   L   + +S + FE
Sbjct: 480 LGTTVGSILSTMVFSTSLHNKMKNSNILFE 509

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 113/518 (21%), Positives = 202/518 (38%), Gaps = 50/518 (9%)

Query: 37  EHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELS 96
           E ++++    R  +   +MS   + I+  S+ L S++AALD T       +  S FN  S
Sbjct: 54  EKIVKTRGVTRIEVVREKMSTKVIWILGLSIFLTSWVAALDATTTYNYQPYATSSFNRHS 113

Query: 97  HISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXX 156
            +S +  A  +  A  +P   KISD+  R     +  L +++G +I   S N+   V   
Sbjct: 114 MLSTLTIANSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGS 173

Query: 157 XXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSES----- 211
                    ++ +  +  +D   L+ R+ +                    W S       
Sbjct: 174 VFIAVGQSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTT--------WISGYIVEDI 225

Query: 212 -KNGWRMA---FLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRID 267
             + WR     F +  P+     +L++ +            +  D   K  ++    RI 
Sbjct: 226 INSNWRWGYGMFAIITPVALTPAILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIR 285

Query: 268 -----W---------LGSLSLVTFLFAF---MLASSL-----GGKEIPYNSNIFKLLVVA 305
                W         + +  L+   FAF   +L  SL     GG     N ++  + VV 
Sbjct: 286 GFKVYWELLKVSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWN---NPSMIAMEVVG 342

Query: 306 TILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQ 365
            IL   +++  E++ +  P+LP R L NR+ +     ++   M+G     +   Y   V 
Sbjct: 343 GILL-ISYVVFEVFFAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVL 401

Query: 366 NLKPTDM-----GKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXX 420
           NL   D         +   FF   +G++  G++  K  +  G  +K              
Sbjct: 402 NLSYRDWVYLSNTTTMGLCFFGVVWGALFRGFHRYKIFQVVGIAIKLIGMGLYVACSKKD 461

Query: 421 XKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGV 480
             P I        L + +FG +  +  T +A  AAVPH+  AAT S+   + S G+ +G 
Sbjct: 462 GSPGIGL--VVAALVVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGT 519

Query: 481 SVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQ 518
           ++ +A++ ++L G+LF  V   E      E L SI ++
Sbjct: 520 AITSAVWTDQLPGALFKYVPDKEKAVAFFESLTSIWEE 557

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 94/456 (20%), Positives = 175/456 (38%), Gaps = 25/456 (5%)

Query: 72  FLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIII 131
           F+ ALD  IV T++  +   F + +   WI T Y L +A F  L+ ++S + G R  ++ 
Sbjct: 55  FVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVVS 114

Query: 132 SNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXX 191
             + F  G LI  L+ ++  L+            + +L  +    +V  +SR L      
Sbjct: 115 CIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLLN 174

Query: 192 XXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIF------XXXXXXXXX 245
                           F+     WR  F + +P+  +++ + + F               
Sbjct: 175 CTFAVASIVGPFLGGAFTTHVT-WRWCFYINLPIGGLAIAIFVFFYNPEGVNLLEKFGNT 233

Query: 246 XXXVSNDKDGKVDIKDKLKRI----DWLGSLSLVTFLFAFMLASSLGGKEIPYNSNI-FK 300
              VS+    K   K  L+++    D L  +S       F+LA + GG+   +NS I   
Sbjct: 234 FKKVSSFHPVKKSPKKVLQQLLFGFDILSFISFTAGWLLFLLALTFGGQTHAWNSGIVIS 293

Query: 301 LLVVATILSGTAFIY-------VELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTL 353
            +++  +L   + +Y       ++   S  P+L    ++NRSIL ++F  +F  ++    
Sbjct: 294 FIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVAYNVQ 353

Query: 354 AFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXX 413
             Y   ++  V        G  + P   ST   SI +G   KKTG     L+  +     
Sbjct: 354 MIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIKPLLVFGSAMGVL 413

Query: 414 XXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQA------ATTSI 467
                       +   Q  +L LP      ++   L+A    +   + +       TTS+
Sbjct: 414 GGGLMTLLDNKSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKGNPSYGADLLETTSV 473

Query: 468 SYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFE 503
           +   +S G+TLG  +   +F   ++  +    +  E
Sbjct: 474 NALLKSLGTTLGSILSTMVFSTSMNNKMKHGGLSLE 509

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 108/502 (21%), Positives = 192/502 (38%), Gaps = 60/502 (11%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNE 94
           + E ++++    R  +   +MS     I+  S+ L S +AALD T       +  S FN 
Sbjct: 52  DGEKIIKTRGVTRIEVVREKMSTRVRWILGLSIFLTSAVAALDATTTYNYQPYATSSFNR 111

Query: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVX 154
            S +S +  A  +  A  +P   KISD+  R     +  L +++G +I   S  +   V 
Sbjct: 112 HSMLSTLTIANSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVV 171

Query: 155 XXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSES--- 211
                      ++ +  +  +D   L+ R+ +                    W S     
Sbjct: 172 GSVFIAIGQSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTT--------WISGYIVE 223

Query: 212 ---KNGWRMA---FLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDI------ 259
               + WR     F +  P+     +L++ +            V +D   K  I      
Sbjct: 224 DIINSNWRWGYGMFAIITPVALTPAILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESH 283

Query: 260 -----------KDKLKRIDWLGSLSLVTFLFAFML------ASSLGGKEIPYNSNIFKLL 302
                      K  L  ID  G L L+ F F+ +L      + + GG     N ++  + 
Sbjct: 284 VSGFREYWELVKVSLIEIDAFG-LILLGFAFSLILLPCSLYSYAEGGWN---NPSMIAME 339

Query: 303 VVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWS 362
           VV  I    +++  E++ +  P+LP R L NR+ +     ++   M+G     +   Y  
Sbjct: 340 VVGGIFL-ISYVVFEVFFAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTF 398

Query: 363 SVQNL---------KPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXX 413
            V NL           T MG      FF   +G++  G++  K  +  G  +K       
Sbjct: 399 VVLNLSYRNWVYLSNTTTMGL----CFFGVVWGALFRGFHRYKIFQVVGIAIKLIGMGLY 454

Query: 414 XXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRS 473
                    P I        L + +FG +  +  T +A  AAVPH+  AAT S+   + S
Sbjct: 455 VTCSKKEGSPGIGL--VVAALVVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSS 512

Query: 474 TGSTLGVSVGAALFRNKLSGSL 495
            G+ +G ++ +A++ ++L G+L
Sbjct: 513 IGAAVGTAITSAIWTDRLPGAL 534

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 104/513 (20%), Positives = 198/513 (38%), Gaps = 64/513 (12%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNE 94
           +   ++++    R  +   +MS     I+ +S+ L +++AALD T       +  S FN 
Sbjct: 53  DGNKIIKTRGVTRIEVVKEKMSTKVTWILAASILLTAWIAALDATTTYNYQPYATSSFNR 112

Query: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVX 154
            S +S +  A  +  A  +P   KISD+  R     +  + +++G +I   S  +   V 
Sbjct: 113 HSMLSTLTIANSVIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVV 172

Query: 155 XXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSES--- 211
                      +  +  +  +D   L+ R+                      W S     
Sbjct: 173 GSVFIAVGQSGINLMNMVIVADTTSLKWRSF--------ITSLLSVPYLVTTWISGYIVQ 224

Query: 212 ---KNGWRMA---FLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSND--KDGKVDIKDK- 262
               + WR     F +  P+     +L++ +            + +D   + K +I++  
Sbjct: 225 NIISSNWRWGYGMFAIITPVALTPAILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESG 284

Query: 263 --------------LKRIDWLGSLSLVTFLFAFML------ASSLGGKEIPYNSNIFKLL 302
                         L  ID  G L L+ F F+ +L      + + GG +   N ++  + 
Sbjct: 285 ISGFKGYWQLLKTSLIEIDAFG-LILLGFAFSLILLPCSLYSYAEGGWK---NPSMIAME 340

Query: 303 VVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWS 362
           V+  I    +++  E++ +  P+LP R L NR+ +     ++   M G     +   Y  
Sbjct: 341 VIGGIFL-ISYVIFEVFFAPFPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTF 399

Query: 363 SVQNL---------KPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXX 413
            V NL           T MG      FF   +G +   ++  K  +  G  +K       
Sbjct: 400 VVLNLSYKNWVYLSNTTTMGL----CFFGVVWGVLFRYFHRYKIFQVVGIAIKLIGMGLY 455

Query: 414 XXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRS 473
                    P I      +++   +FG +  +  T +A  AAVPH+  AAT S+   + S
Sbjct: 456 VACSKKDGSPGIGLIVAALIVT--NFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSS 513

Query: 474 TGSTLGVSVGAALFRNKLSGSLFDSVMKFESDK 506
            G+ +G ++ +A++ N+L G+L    +K+  DK
Sbjct: 514 IGAAVGTAITSAVWTNELPGAL----LKYVPDK 542

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 94/236 (39%), Gaps = 15/236 (6%)

Query: 77  DNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFF 136
           D  IV TL   I  +F++  +I W+ T Y LS+A F  L+G++++I G +  ++IS + F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVF 83

Query: 137 ILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXX 196
            +G LI  LS ++ TL+            + SL  +  + IV    R +           
Sbjct: 84  EIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVI 143

Query: 197 XXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSN-DKDG 255
                      F+E  + WR  F + +P+ A + +++                S   K  
Sbjct: 144 AEGVGPFIGGAFNEHLS-WRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIM 202

Query: 256 KVDIKDKLKRIDWLGSLSLVTF-------------LFAFMLASSLGGKEIPYNSNI 298
             D  + LK   W  +  ++ F                 ML  S GG   P+NS I
Sbjct: 203 NYDYGELLKASFWKNTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGI 258

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 123/300 (41%), Gaps = 24/300 (8%)

Query: 31  AEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIAS 90
           +EV E    + S+D+  +G          L+  + S+ L  FL+ALD  IV+T++  ++ 
Sbjct: 21  SEVVEQNKKVVSQDQVVKGFA--------LYACLGSLTLALFLSALDILIVSTIIETVSR 72

Query: 91  EFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLW 150
           +FNE S   W+ T Y L +A    ++G+ + I G +  +++S + F +G L+  L+ ++ 
Sbjct: 73  DFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLVSALANSMN 132

Query: 151 TLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSE 210
            L+            + +L  +  S +V  RSR +                      F+ 
Sbjct: 133 MLIGGRVISGVGGSGLQTLCFLIISTLVNERSRGMAISVLSCSFAVASIVGPFLGGAFTT 192

Query: 211 SKNGWRMAFLVQVPLCAIS-LVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWL 269
               WR  F + +P+  ++ LV ++ +             +      VD    LK   + 
Sbjct: 193 HVT-WRWCFYINLPIGGLAFLVFVLSYNPNGGNSIKNFTKAVRSISHVDFGGLLKAKSYY 251

Query: 270 GSLSLVTFLFAF-------------MLASSLGGKEIPYNSN-IFKLLVVATILSGTAFIY 315
            +   + F F F             +L  + GG E  + S  I   LV+  +LS   F+Y
Sbjct: 252 NTFEKLVFKFDFVGFALCSAGFCLILLGLTFGGNEYSWGSGTIIAYLVIGIVLSIAFFLY 311

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 74  AALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISN 133
           AALD  IV TL   I  +FN+ + + W+ T Y LSSA F  L+G+++ + G +  +++S 
Sbjct: 56  AALDIVIVVTLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSV 115

Query: 134 LFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXX 193
           L F +G LI  +S ++  L+            + SL  I  + +V  RSR +        
Sbjct: 116 LIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTSLVSERSRGMVIMVLTFA 175

Query: 194 XXXXXXXXXXXXXWFSESKNGWRMAFLVQVPL 225
                          +E  + WR  F + +P+
Sbjct: 176 FVGSNAGGPILGGALNEHAS-WRWCFFINLPI 206

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 114/279 (40%), Gaps = 29/279 (10%)

Query: 77  DNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFF 136
           D  IV TL   I  +F++  +I W+ T Y L++A F  L+G++++I G    ++IS + F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIF 83

Query: 137 ILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXX 196
            +G LI  LS ++ TL+            + SL  +  + IV    R             
Sbjct: 84  EVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVI 143

Query: 197 XXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKD-- 254
                      F+E  + WR  F + +P+ A +L+++               +S  K   
Sbjct: 144 AEGVGPFIGGAFNEHLS-WRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIM 202

Query: 255 ------------GKVDIKDKLKRIDWLG-SLSLVTFLFAFMLASSLGGKEIPYNSN-IFK 300
                        K   K  + ++D +G +LS   F    ML  S GG    +NS+ I  
Sbjct: 203 SYKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAGFTL-LMLGLSFGGNNFAWNSSTIIS 261

Query: 301 LLVVATILSGTAFIYVELYISDD----PILPIRFLTNRS 335
           L  V  IL       + L+ + D    P+L +R+   R+
Sbjct: 262 LFTVGPIL-------LILFCAYDFHFLPLLGLRYENKRT 293

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%)

Query: 55  MSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQP 114
           M+  +L+  I S+ L  FLAALD  I++  +  IA +F + S   WI + Y L+ A    
Sbjct: 112 MAGIKLYTTIGSLTLVLFLAALDVLIISASIEVIAEQFKDYSKSGWIVSGYSLTEALLTL 171

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITA 174
           L+G+ + I G +  +++S L F  G LI  +S ++  L+            + SL  + A
Sbjct: 172 LWGRFATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIA 231

Query: 175 SDIVPLRSRAL 185
           S + P RSR +
Sbjct: 232 STLTPDRSRVI 242

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 1/155 (0%)

Query: 77  DNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFF 136
           D  IV TL   I  +F++  +I W+ T Y LS+A F  L+G++++I G    ++IS + F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 137 ILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXX 196
            +G LI  LS  + TL+            + SL  +  + IV    R +           
Sbjct: 84  EIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVI 143

Query: 197 XXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLV 231
                      F+E  + WR  F + +P+ A + +
Sbjct: 144 AEGVGPFIGGAFNEHLS-WRWCFYINLPIGAFAFI 177

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 78/176 (44%), Gaps = 1/176 (0%)

Query: 55  MSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQP 114
           M +  + + ++S+C+  FL ALD  I  TL   I  EFN+ +++ W+   Y L +A F  
Sbjct: 1   MRKVAVIVCVTSLCVTLFLGALDIVICITLYDTIGQEFNDYANVGWLMAGYNLPNALFML 60

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITA 174
           L+G+I+ + G +  ++ S + F  G L+ G + ++  L+            + SL     
Sbjct: 61  LWGRIASLVGLKCSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVG 120

Query: 175 SDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISL 230
           + IV  + RA                        +E  + WR  F V +P+  ++L
Sbjct: 121 TSIVEEKHRARVITVLGIAYMLAEGAGPFVGGGLAEHVS-WRWCFYVNLPIGGVAL 175

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 89/194 (45%), Gaps = 3/194 (1%)

Query: 43  EDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIA 102
           ED  ++ +++S+ S   L++ + ++ L  FLAALD  IV+T++  +A +    S I W+ 
Sbjct: 45  EDNVKKNVELSKGSI--LYVSLVAVALSLFLAALDVMIVSTIIEEVAKQLGSYSEIGWLF 102

Query: 103 TAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXX 162
           T Y L +A    ++G+I+   G +  ++ + + F +G LI  L+ ++  L+         
Sbjct: 103 TGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIG 162

Query: 163 XXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQ 222
              + SL  +  S +V    R +                      F+ S   WR  F + 
Sbjct: 163 GCGIQSLSFVIGSTLVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSVT-WRWCFYIN 221

Query: 223 VPLCAISLVLIIIF 236
           +P+  ++  L ++F
Sbjct: 222 LPIGGLAFFLFVLF 235

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 102/512 (19%), Positives = 197/512 (38%), Gaps = 45/512 (8%)

Query: 27  AYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLS 86
           A V A  ++TE  + S DE R G+         L++ ++S+ L  F+ ALD  IV T++ 
Sbjct: 10  AEVKAYDSDTELNVNSSDE-RGGIS--------LYLCLTSLTLVLFITALDILIVGTIID 60

Query: 87  HIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
            +A +F   S   W+ T Y L +A    ++G+ + I G +  +I++ L F  G L+  L+
Sbjct: 61  VVAEQFGNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLVAALA 120

Query: 147 KNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXX 206
            ++  L+            + +L  +    +V  RSR L                     
Sbjct: 121 NSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAIVGPIIGG 180

Query: 207 WFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRI 266
            F+     WR  F + +P+   ++++ ++              + +  G++  K +L+R+
Sbjct: 181 AFTTHVT-WRWCFYINLPIGGFAVIMFLL--TYKTKSENILQQTRNILGRIS-KFELRRL 236

Query: 267 DWLGSL--SLVTFLFA---------------FMLASSLGGKEIPYNS-NIFKLLVVATIL 308
              G+L  +L+  LF                F+L  + GG +  +NS  I   LV+  +L
Sbjct: 237 TEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYSWNSGQIITYLVLGILL 296

Query: 309 SGTAFIYVELYI-----------SDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYV 357
              + IY + +I           S  P+   R +   +++  +   +   +       Y 
Sbjct: 297 FVFSLIY-DFFIFQKFNPEPDNTSYRPLFLKRLVAKPAVIIVNMVTFLLCIGYNGQMIYS 355

Query: 358 PVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXX 417
             ++  +        G  + P   +    +I +G   KK G     L+            
Sbjct: 356 VQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGILGVIGAGL 415

Query: 418 XXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSI--SYAFRSTG 475
                 + ++  Q  +L LP       +  +L++    +  +   ATT      AF +  
Sbjct: 416 MTLMSNNSTSSTQIGVLILPGLSLGFALQASLMSAQLQIKKDRPEATTDFIEITAFNTFM 475

Query: 476 STLGVSVGAALFRNKLSGSLFDSVMKFESDKY 507
            +LG ++G  L     S SL + V   + + Y
Sbjct: 476 KSLGTTLGGVLSTTVFSASLRNKVKHAQLEMY 507

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/346 (21%), Positives = 134/346 (38%), Gaps = 27/346 (7%)

Query: 77  DNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIF-GRRPLIIISNLF 135
           D  IVTT+++ + + F+  +   WI   Y L +A    L+G+I+  F G +  ++ + + 
Sbjct: 74  DIMIVTTIINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVI 133

Query: 136 FILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXX 195
           F +G LIC L+ ++  L+            + SL  +  S +V  R R            
Sbjct: 134 FEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFG 193

Query: 196 XXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSN---- 251
                       F+ S   WR  F + +P+ A++LV+                + +    
Sbjct: 194 IASVIGPFIGGAFT-SHVTWRWCFWINLPVGAVALVIFTWVYNPTGKKQVLLTIHDLKEL 252

Query: 252 -DKDGKVDIKDKLKRIDWLGSLSLVTFLF------AFMLASSLGGKEIPYNS-NIFKLLV 303
            +K  KV  KD LK +  L  L ++ F+         +LA + GG    + S +I  L V
Sbjct: 253 SEKVKKVRFKDLLKHL--LFKLDIIEFMLISAGIVCILLAFTFGGNRFKWGSYSIILLFV 310

Query: 304 VATILSGTAFIYVEL-----------YISDDPILPIRFLTNRSILGASFANWFCMMSGVT 352
           +   L   A +Y  +           YI   P++  + L  R I  AS   +F  +  ++
Sbjct: 311 IGGCLVIVALVYDFVIFPNLQIVKANYIQYQPLISWKNLRIRGIFTASMTTFFFCIGYMS 370

Query: 353 LAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTG 398
              Y   ++  + N  P      +      T   ++  G+   K G
Sbjct: 371 QTVYYVQFFQLIYNSSPWKASIHLIAVMIPTVLTAVVCGFLNGKFG 416

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 133/320 (41%), Gaps = 30/320 (9%)

Query: 266 IDWLGS--LSLVTFLFAFMLASSLGGKEI--PYNSNIFKLLVVATILSGTAFIYVELYIS 321
           ID +G   LS+   L A +   +  G  I  PY++     LV++ IL G   +  E   +
Sbjct: 393 IDLIGCTILSVFLLLIAVITTGNSNGFSITSPYSAT----LVISIILVGILLLLSETTTN 448

Query: 322 DDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFF 381
            +PI+P+ F+ N+ I   S   +F  MS +T   Y P Y     N+   D+ KR +P F 
Sbjct: 449 KNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFL 508

Query: 382 STAFGSIGAGYYMKKTGRY-YGFLLKFTXX----XXXXXXXXXXXKPDISTWRQYILLPL 436
           +  F  I     +       YG +  F                    D   W+Q ++  L
Sbjct: 509 TILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGIL 568

Query: 437 PHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLF 496
           P  GS+ L+  TL+ +      +     ++ S+A  + GS LG+ +   +F   L   L+
Sbjct: 569 PILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLYDELW 625

Query: 497 DSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAF---C 553
             V   E     K     II++   +SEY   ++ ++    +++ Y       F F   C
Sbjct: 626 --VHSTEEKGLGK-----IIRKMINNSEY--ESSSRYYCYEILESYFIVSGYVFLFSAIC 676

Query: 554 FLISIFAWISCGVIKEYKLH 573
            L+++ ++  C  IK  + H
Sbjct: 677 LLVAVISF--CFTIKNKRHH 694

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 92/463 (19%), Positives = 170/463 (36%), Gaps = 39/463 (8%)

Query: 72  FLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIII 131
           F+ ALD  IV T++  +   F + +   WI T Y L +A F  L+G+IS   G R  I+ 
Sbjct: 54  FVTALDVLIVGTIIDTVCKSFGDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVA 113

Query: 132 SNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXX 191
             + F  G LI  L++++  L+            + +L  +    +V  +SR L      
Sbjct: 114 CIVLFEAGSLISALARSMNMLIAGRVVSGVGGSGLQTLSLVIGCQLVDEKSRPLVLSLLN 173

Query: 192 XXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSN 251
                           F+     WR  F + +P+  ++++  + F               
Sbjct: 174 CTFAIASIIGPFIGGAFTTHVT-WRWCFYINLPIGGVAILTFLCFYNPHNENLL------ 226

Query: 252 DKDGKVDIKD--KLKRIDWLGSLSLVTFLFA---------------FMLASSLGGKEIPY 294
            ++GK   K   K K      S ++   LF                F+LA + GG+   +
Sbjct: 227 -EEGKKAFKRVLKFKPTSLFSSKAMHQLLFGFDIVSFALFTAGWVLFLLALTFGGQSYSW 285

Query: 295 NSNIFKLLVVATILSGTAFIYVELYISD--------DPILPIRFLTNRSILGASFANWFC 346
           +S +    +V  IL     ++ +  + +         P+L  R ++  +I+ ++F+ +F 
Sbjct: 286 DSGVVISFLVVGILLILLSLFYDFKLFEAMKSQENIRPLLCWRLMSQPTIVLSNFSGFFS 345

Query: 347 MMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLK 406
            ++      Y   ++  V        G  + P   ST   SI +G   KKTG     L+ 
Sbjct: 346 TVAYNVQMIYSVQFFQLVYGFTAWKAGLHLIPILVSTVVFSIMSGVLTKKTGHIKPLLVF 405

Query: 407 FTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQA---- 462
            +                 +   Q  +L LP      ++   L+A    +   +      
Sbjct: 406 GSAMGVLGGGLMTLLNNTSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKSNSRYGAD 465

Query: 463 --ATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFE 503
               TS++   +S G+TLG  +   +F   +   +    M  E
Sbjct: 466 MLEVTSVNALLKSLGTTLGSILSTMIFSTSMYNKMKSRGMSLE 508

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 112/544 (20%), Positives = 206/544 (37%), Gaps = 66/544 (12%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRAR--------LHIIISSMCLGSFLAALDNTIVTTLLS 86
           ET++  + E E   G   S  +R          L++ ++S+ L  F+ ALD  IV T++ 
Sbjct: 3   ETKYSSQQEIEGACGSDASLNARGSNDSPMGLSLYLCLASLTLVLFITALDILIVGTIID 62

Query: 87  HIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
            +A +F   S   W+ T Y L +A    ++G+ + I G +  +I++ L F  G LI  L+
Sbjct: 63  VVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIAALA 122

Query: 147 KNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXX 206
            ++  L+            + +L  +    +V  RSR L                     
Sbjct: 123 SSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGG 182

Query: 207 WFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDG----------- 255
            F+     WR  F + +P+  +++++ ++             +   KD            
Sbjct: 183 AFTTHVT-WRWCFYINLPIGGLAIIMFLL----TYKAENKGILQQIKDAIGTISSFTFSK 237

Query: 256 ---KVDIKDKLKRI----DWLGSLSLVTFLFAFMLASSLGGKEIPYNS-NIFKLLVVATI 307
              +V+ K  +  I    D+ G       L  F+L  + GG +  +NS  +   LV+  +
Sbjct: 238 FRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVITYLVLGVL 297

Query: 308 LSGTAFIYVELY--------------ISDDPILPIRFLTNRSILGASFANWFCMMSG--- 350
           L    FI+  +Y              IS  P+L  R +   +I+  +    F + +G   
Sbjct: 298 L----FIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMVT-FLLCTGYNG 352

Query: 351 ---VTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKF 407
               ++ F+  ++ SS         G  + P   +    +I +G   KK G     LL F
Sbjct: 353 QMIYSVQFFQLIFASSAWK-----AGLHLIPIVITNVIAAIASGVITKKLGLVKP-LLIF 406

Query: 408 TXXXXXXXXXXXXXKPDISTWRQYI-LLPLPHFGSSVLITVTLL-AMIAAVPHEHQAATT 465
                           + ST    I +L LP F     +  +L+ A +       +AA  
Sbjct: 407 GGVLGVIGAGLMTLMTNTSTKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMD 466

Query: 466 SISY-AFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSE 524
            I   AF +   +LG ++G  L     S S  + V +   + Y  + +  +I    ++ +
Sbjct: 467 FIEVTAFNTFMKSLGTTLGGVLSTTVFSASFHNKVSRAHLEPYEGKTVDDMILYRLQNYD 526

Query: 525 YVHA 528
             H+
Sbjct: 527 GSHS 530

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/336 (22%), Positives = 131/336 (38%), Gaps = 32/336 (9%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           + I S+ L  FL ALD  I  TL   I   FN+ +++ W+ T Y L +A    L+G+I+ 
Sbjct: 8   VCIFSLSLTLFLGALDIVICITLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIAS 67

Query: 122 IFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLR 181
           + G +  ++ S + F  G L+  L+ ++  L+            + +L     + +V  +
Sbjct: 68  LVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDEK 127

Query: 182 SRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXX 241
            RA                       F+E  + WR  F + +P+  ++L    I      
Sbjct: 128 HRARVVTILGIAYMLAEGAGPFIGGAFAEHVS-WRWCFFINIPIGGVALA---ILCWGYN 183

Query: 242 XXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAF-----------------MLA 284
                   + +   K   K   K++  L SL+ V  LF +                 MLA
Sbjct: 184 PAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSSGGFALIMLA 243

Query: 285 SSLGGKEIPYNS-NIFKLLVVATILSGTAFIY---VELYISDD-------PILPIRFLTN 333
            + GG +  +NS +I  +  +   L G   +Y   V  YI          P++P     N
Sbjct: 244 LTFGGNKFAWNSASIICMFTIGIALLGIFMLYDFVVLPYIGRRLENGEAMPLVPWSLACN 303

Query: 334 RSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKP 369
             IL +S A +F   +    + Y+  Y+  V N  P
Sbjct: 304 MPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGP 339

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 114/270 (42%), Gaps = 18/270 (6%)

Query: 55  MSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQP 114
           M +  L + ++S+ L  FLAALD  IV TL   I  +F + + I W+ T Y L +A F  
Sbjct: 1   MRKLSLVLCLTSLALTLFLAALDIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTL 60

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITA 174
           L+G+++ I G +  +  S + F +G LI  +S ++  ++            + SL  +  
Sbjct: 61  LWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVG 120

Query: 175 SDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLII 234
           + +V  R+R +                      F+E+ + WR  F + +P+  ++L ++ 
Sbjct: 121 TSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAFTENVS-WRWCFYINLPIGGVALTMLT 179

Query: 235 IFXXXXXXXXXXXXVSNDKD------GKVDIKDKLKR--------IDWLG-SLSLVTFLF 279
                           N +       G+       +R        +D++G +LS   F+ 
Sbjct: 180 FSYNTTEKSVQETLTYNCRQLQTYRYGQWVTASFWRRAYNFLMFDLDFIGFALSSTGFVL 239

Query: 280 AFMLASSLGGKEIPYNSN-IFKLLVVATIL 308
            FML  + GG    +NS  I   L V  IL
Sbjct: 240 -FMLGLTFGGNTYAWNSGTIISFLTVGAIL 268

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 78/177 (44%), Gaps = 1/177 (0%)

Query: 60  LHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKI 119
           L+  + S+ L  FLAALD  IV+T++ ++A EF + S   WI   Y L SA    ++G+I
Sbjct: 54  LYACVISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRI 113

Query: 120 SDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVP 179
           + + G +  ++ + + F +G L+  L+ ++  L+            + +L  +  S +V 
Sbjct: 114 AAVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVE 173

Query: 180 LRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIF 236
              R L                      F+     WR  F + +P+  ++    I+F
Sbjct: 174 ESKRGLLIACMGSAFGIASVVGPFLGGAFTTHVT-WRWCFWINLPIGGLAFAFFILF 229

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 69/160 (43%), Gaps = 1/160 (0%)

Query: 77  DNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFF 136
           D  IV+T++  +A +F   S   WI   Y L +A    L+G+I+ I G +  ++ + + F
Sbjct: 94  DIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIF 153

Query: 137 ILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXX 196
            +G LI G++ ++  L+            + SL  +  S++V  R R L           
Sbjct: 154 EIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAV 213

Query: 197 XXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIF 236
                      F+     WR  F + +P+  ++  L ++F
Sbjct: 214 ASVIGPFLGGAFTTHAT-WRWCFYINLPVGGVAFALFVVF 252

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 78/173 (45%), Gaps = 1/173 (0%)

Query: 64  ISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIF 123
           + S+ L  FLAALD   V+T++  ++ +F + S + W+ T Y L +A    ++G+I+ + 
Sbjct: 46  LGSLVLCLFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLV 105

Query: 124 GRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSR 183
           G +   + + + F +G L+  L+ ++  L+            V SL  + +S +V  R+R
Sbjct: 106 GFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERNR 165

Query: 184 ALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIF 236
            L                      F+     WR  F + +P+  ++  L + F
Sbjct: 166 GLIIAVMSSSFGIASVVGPFLGGAFTTHVT-WRWCFYINLPVGGLAFFLFLTF 217

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 79/176 (44%), Gaps = 1/176 (0%)

Query: 60  LHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKI 119
           L++ ++S+ L  F+ ALD  IV T++  +A +F   S   W+ T Y L +A    L+G+ 
Sbjct: 44  LYLCLASLTLVLFITALDILIVGTIIDVVAKQFGNYSKTGWLVTGYSLPNAVLSLLWGRF 103

Query: 120 SDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVP 179
           + I G +  +I++ L F  G L+  L+ ++  L+            + +L  +    +V 
Sbjct: 104 ASIIGFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVD 163

Query: 180 LRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIII 235
            RSR L                      F+     WR  F + +P+  +++++ ++
Sbjct: 164 ERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVT-WRWCFYINLPIGGLAVIMFLL 218

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 87/203 (42%), Gaps = 2/203 (0%)

Query: 33  VAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEF 92
           + E     + E     G     +S  +L+  + S+ L  FLAALD  I++  +  I+ +F
Sbjct: 14  IVEDRSSAQDESSGHVG-DPQPLSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQF 72

Query: 93  NELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTL 152
           N+ S   WI + Y L  A    L+G+ + IFG +  +++S L F  G LI  +S ++  L
Sbjct: 73  NDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVL 132

Query: 153 VXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESK 212
           +            + SL  + AS +   RSR +                      F+   
Sbjct: 133 IGGRVVAGIGGSGIQSLCFVIASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHV 192

Query: 213 NGWRMAFLVQVPLCAISLVLIII 235
             WR  F + +P+  ++  ++++
Sbjct: 193 T-WRWCFYINLPIGGLAFAVLVL 214

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 83/181 (45%), Gaps = 1/181 (0%)

Query: 55  MSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQP 114
           +S  +L+  + S+ L  FLAALD  I++  +  I+ +FN+ S   WI + Y L  A    
Sbjct: 35  LSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTL 94

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITA 174
           L+G+ + IFG +  +++S L F  G LI  +S ++  L+            + SL  + A
Sbjct: 95  LWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIA 154

Query: 175 SDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLII 234
           S +   RSR +                      F+     WR  F + +P+ +++  +++
Sbjct: 155 STLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHVT-WRWCFYINLPIGSLAFAVLV 213

Query: 235 I 235
           +
Sbjct: 214 L 214

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%)

Query: 77  DNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFF 136
           D  IV T+L+ IA +FN  S I W+ T Y LS+A F  L+G+ + IFG +  +++S + F
Sbjct: 36  DIIIVVTILNTIADKFNAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIF 95

Query: 137 ILGCLICGLSKNL 149
            +G L+  +S ++
Sbjct: 96  EIGSLVIAVSNSM 108

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 95/461 (20%), Positives = 182/461 (39%), Gaps = 23/461 (4%)

Query: 75  ALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNL 134
            LD+ I     S++ + F+E S +S +     + SA  Q +Y +++D+FGR  L I + +
Sbjct: 110 GLDSNIRFIYTSYVTNSFSEHSLLSTVNVINAVISAASQIVYARLADVFGRLTLFITAVV 169

Query: 135 FFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXX 194
           F+ +G +I   S N+ T              V  +  +  SD   L+ R  YQ       
Sbjct: 170 FYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLVLLLILSDFSSLKWRLFYQFAPTWPF 229

Query: 195 XXXXXXXXXXXXWFSESKN-GWRMAFLVQV-PLCAISLVLIIIFXXXXXXXXXXXXVSND 252
                         +  +N  W +     + PL  + L+  ++             + N+
Sbjct: 230 IINTWISGNITSRANPQENWSWDIGMWAFIFPLSCVPLICCMLHMWWKARRTEEWKILNE 289

Query: 253 KD------GKVD-IKDKLKRIDWLGSLSLVTFLFAFMLASSL-GGKEIPY-NSNIFKLLV 303
           +       G V  IK+   ++D +G+  +   L   ++  +L GG    + +S I   LV
Sbjct: 290 EKTYFKTHGLVSFIKELFWKLDTIGTFIMTVSLGCILVPLTLAGGTSSKWDDSQIIGPLV 349

Query: 304 VATILSGTAFIYVELYISDDPILPIRFLTNRSI---LGASFANWFCMMSGVTLAFYVPVY 360
           +  +L     +Y EL  + +PILP + + +R++   +  SF   F         + V + 
Sbjct: 350 LGVVLLPMLIVY-ELKWAREPILPWKLIKDRAVWASMSISFLYDFIFYMAYDYLYTVMI- 407

Query: 361 WSSVQNLKPTDMGKRIA--PNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXX 418
              V   +      RI+    F ST F    A  Y+ +  R   +++             
Sbjct: 408 ---VAVDESVKSATRISSLSAFVSTVFSPFFA-LYITRVTRLKPYIIAGCGLWMVAMGLL 463

Query: 419 XXXKPDISTWRQYI-LLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGST 477
              +   S+    I  L +   G+++      +++ +A  HE+ A  TS++Y     GS 
Sbjct: 464 YHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVSVQSATSHENMATVTSLNYTLYRIGSA 523

Query: 478 LGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQ 518
           +G++V   ++   L   +F  V   +   Y+ E   + I +
Sbjct: 524 VGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYEQPYNFIAE 564

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 101/526 (19%), Positives = 201/526 (38%), Gaps = 33/526 (6%)

Query: 11  QPVRNALNPELSEGLPAYVGAEV-AETEHLLESEDEAREGLQVSEMSRARLHIIISSMCL 69
           + + N+++  +S+   A +  EV A+   +  +  +  +   V  MS  RL++ ++++ L
Sbjct: 9   ESLNNSMDGPMSKN--AIMQVEVTADNASIDANTPDHNDNSNVRLMSGLRLYVCVAALVL 66

Query: 70  GSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLI 129
            +F+ ALD  IV T++  +++     S   W+   Y L ++ F  ++G+ + + G +  +
Sbjct: 67  ATFIFALDVFIVNTIIDSVSASLGGYSKSGWLIAGYSLPNSLFSLIWGRTASLLGFQASM 126

Query: 130 IISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXX 189
            +S   F +G ++   + ++  L+            + +L  +  S IV  ++RA+    
Sbjct: 127 TLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLVIGSSIVEEKNRAMIVSI 186

Query: 190 XXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXV 249
                             F+ +   WR  F + +P+ A++ +L                 
Sbjct: 187 VMSAFAAASLIGPFVGGAFT-THVIWRWCFWINLPIGAVTALLFYFTYNPKRLSAASRFT 245

Query: 250 SNDKDGKVDIKDKLK--------------RIDWLGSLSLVTFLFAFMLASSLGGKEIPYN 295
           S  K  K    +KL               R D +G  +    +   +L  +LGG++  + 
Sbjct: 246 SCFKSVKALSFEKLASWETYRCMGKNLLFRFDIVGFATGCAGVCLLLLGLTLGGEDDSWK 305

Query: 296 SNI-FKLLVVATILSGTAFIYVELYISDD-----------PILPIRFLTNRSILGASFAN 343
           S I    L+V  +LS  + +Y + YI D            P+L    L NR IL  +   
Sbjct: 306 SAIVICFLIVGFLLSVLSVVY-DFYIFDKINPEPSNLSFRPMLVKGLLNNRFILLPNLVT 364

Query: 344 WFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGF 403
               ++      Y   ++  V      + G  + P   ++   +I  G  MKKTG+    
Sbjct: 365 CASAIAFSGYMLYSVQFFQLVMGSSAWNAGLHLIPLVIASIVSAIICGGIMKKTGQVKPL 424

Query: 404 LLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAA 463
           ++                        Q  +  LP FG    +   L++    +  E   +
Sbjct: 425 MISTVSILLIGGGVSTLLDNHSGNSMQIGVWILPGFGLGAALQCALISSQLQIDKESPNS 484

Query: 464 TTSI--SYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKY 507
              +    AF S   +LG S+G  L     + SL+  +   + + Y
Sbjct: 485 EIELVEVTAFNSFTKSLGSSIGGVLCTAIFTSSLWSKINAVKLEGY 530

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 100/499 (20%), Positives = 192/499 (38%), Gaps = 54/499 (10%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARL-----------HIIISSMCLGSFLAALDNTIVTT 83
           E+    E ED     ++ S++  + +            ++I++  L  F  +LD+T+ +T
Sbjct: 18  ESSRSFEDEDANPANVEFSKLGESEIIAVQFDTPKYRALMIATAFLCGFGYSLDHTLRST 77

Query: 84  LLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLIC 143
              +  + + E S +S I     + S   Q ++ ++SD FGR  L + + + +++G ++ 
Sbjct: 78  YTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSDYFGRVELFVAATILYVIGTIVQ 137

Query: 144 GLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXX 203
             + ++                VT +  +  SD   L+ R LYQ                
Sbjct: 138 SQAYSVSIYAAGAVFYNSGNVGVTLVLLLILSDFSSLKWRILYQYVPYWPFIIIPWISGN 197

Query: 204 XXXWFSESKN-GWRMAFLVQV-PLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKD 261
                +  K+  W +A    + PL A+ ++ ++++               ++      + 
Sbjct: 198 IVTAANPEKDWSWDIAMWAFIFPLSALPMICLLVYMMYKSSKTPEWKALKERTHIKKNQG 257

Query: 262 KLK-------RIDWLG----SLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSG 310
            LK        +D +G    ++SL   L    LA+ +  K   ++S I   LV   +L  
Sbjct: 258 FLKNTVFLFWELDSIGIILITVSLGCVLVPLTLANGVSQKW--HSSKIIGTLVFGGVLF- 314

Query: 311 TAFIYVELYISDDPILPIRFLTNRSI---LGASFANWFCMMSGVTLAFYVPVYWSSVQNL 367
             F++ E   + +P+LP + L +R I   LG +F N+F     +   F  PV   S+   
Sbjct: 315 CIFVFWETAYAKNPLLPFKLLGDRGIWAPLGVAFFNYFTFF--IACDFLYPVLLVSMNES 372

Query: 368 KPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDIST 427
             T       P+F          G  + K  R     LKF+                +  
Sbjct: 373 STTATRILNLPDFVGATLSPF-YGILVAKARR-----LKFSVVGGCAAWMI-----SMGL 421

Query: 428 WRQYILLPLPHFG---SSVLITVT--------LLAMIAAVPHEHQAATTSISYAFRSTGS 476
           + QY      H G   +SV++ ++        ++++ A   H   A  TSI + F   G+
Sbjct: 422 FYQYRGGSESHGGAIAASVIMGMSGLLCSNSVIVSLQAMTTHGRMAVITSIYFTFSKVGA 481

Query: 477 TLGVSVGAALFRNKLSGSL 495
            +G SV  A++   +   L
Sbjct: 482 AVGASVSGAVWTQIMPNQL 500

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 122/299 (40%), Gaps = 38/299 (12%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           ++IS+  +  F  +LD T+ +T   +  + ++E S +S +     + S   Q +Y ++SD
Sbjct: 61  LLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSD 120

Query: 122 IFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLR 181
            FGR  L +++ +F+I+G +I   +  L                   L ++  SD   L+
Sbjct: 121 HFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLK 180

Query: 182 SRALYQXXXXXXXXXXXXXXXXXXXWFSESKN-GWRMAFLVQV-PLCAISLVLIIIFXXX 239
            R  YQ                     +  KN  W +A    + PL A+ ++ +I++   
Sbjct: 181 WRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSALPIIFLILYMKY 240

Query: 240 XXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLF-------AFMLASSLGGKEI 292
                     S+       +K++ ++    G    + FLF         ++  SLG   +
Sbjct: 241 K---------SSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSLGCILV 291

Query: 293 P-----------YNSNIFKLLVVATILSGTA----FIYVELYISDDPILPIRFLTNRSI 336
           P           +NS I     +AT++SG      F+Y E   +  P+LP + L++R I
Sbjct: 292 PLTLANETSQKWHNSKI-----IATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGI 345

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 71/160 (44%), Gaps = 1/160 (0%)

Query: 77  DNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFF 136
           D  IV+T++  +A +F   S I W+ T Y L +A    ++G+I+   G +  ++ + + F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 137 ILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXX 196
            +G LI  L+ ++  L+            + SL  +  S++V   +R +           
Sbjct: 152 EVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAI 211

Query: 197 XXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIF 236
                      F+ S+  WR  F + +P+  ++  L ++F
Sbjct: 212 ASVVGPFLGGVFT-SRVTWRWCFYINLPIGGLTFFLFLMF 250

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 61/110 (55%), Gaps = 6/110 (5%)

Query: 40  LESEDEAREGLQVSE-MSRARLHI-----IISSMCLGSFLAALDNTIVTTLLSHIASEFN 93
            E E+E   G+Q  E +++   H+     I  S+ L  F+  LD+ +  ++ ++  + + 
Sbjct: 48  FEEEEEKSYGVQKVEILNKQYNHLWGKSAIFFSLFLMGFVFRLDSMVRRSMNAYATNSYK 107

Query: 94  ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLIC 143
           + S +S +     +++A   PLY ++SD+FGR  LI++S L ++ G +IC
Sbjct: 108 QHSLLSTVNVVRSVAAACGLPLYSRLSDVFGRIELIVVSVLLYVAGTIIC 157

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 121/299 (40%), Gaps = 38/299 (12%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           ++IS+  +  F  +LD T+ +T   +  + ++E S +S +     + S   Q +Y ++SD
Sbjct: 61  LLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSD 120

Query: 122 IFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLR 181
            FGR  L +++ +F+I+G +I   +  L                   L ++  SD   L+
Sbjct: 121 HFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLK 180

Query: 182 SRALYQXXXXXXXXXXXXXXXXXXXWFSESKN-GWRMAFLVQV-PLCAISLVLIIIFXXX 239
            R  YQ                     +  KN  W +A    + PL  + ++ +I++   
Sbjct: 181 WRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSTLPIIFLILYMKY 240

Query: 240 XXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLF-------AFMLASSLGGKEI 292
                     S+       +K++ ++    G    + FLF         ++  SLG   +
Sbjct: 241 K---------SSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSLGCILV 291

Query: 293 P-----------YNSNIFKLLVVATILSGTA----FIYVELYISDDPILPIRFLTNRSI 336
           P           +NS I     +AT++SG      F+Y E   +  P+LP + L++R I
Sbjct: 292 PLTLANETSQKWHNSKI-----IATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGI 345

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 112/523 (21%), Positives = 204/523 (39%), Gaps = 55/523 (10%)

Query: 15  NALNPELSEGLPAYVGAEVAE-----TEHLLESEDEAREG-------LQVSEMSRARLHI 62
           N  +  ++ G+ AY   E+ E     TEH +ES  ++ +        L+V EM       
Sbjct: 15  NTNHKMITGGIKAY---ELKEEKFDVTEHDIESVADSNKSSKLGSGFLKVKEME------ 65

Query: 63  IISSMCLGS----------FLAA----LDNTIVTTLLSHIASEFNELSHISWIATAYLLS 108
           I+SS C G           FL      LD    +    +  S +NE + +S I     + 
Sbjct: 66  IMSSTCSGKSARAALLASAFLCGFGYYLDYITRSVYTGYATSSYNEHALLSTIQVINSVI 125

Query: 109 SATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTS 168
           S   Q ++ ++SDIFGR  L ++  + +I+G +I   ++++ T              V+ 
Sbjct: 126 SIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEARDIRTYAVGAAFYNSGYVGVSI 185

Query: 169 LGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRM-----AFLVQV 223
           L  I  SD+ P + R L+Q                     + +KN WR      AFL   
Sbjct: 186 LLIIVLSDLSPSKWRLLFQFATSWPCIIICWISGDIVQSANPAKN-WRFDIGMWAFL--F 242

Query: 224 PLCAISLVLIIIFXXXXXXXXX--XXXVSNDKDGKVD----IKDKLKRIDWLGSLSLVTF 277
           P+ A+  ++ +++                ++K+  V     IK     ID +G+ SLVT 
Sbjct: 243 PISALPFIIFLLYFTRQASKTAEWKEIQGDNKEPSVRIVYWIKSIYSNIDVVGT-SLVTV 301

Query: 278 LFAFMLA--SSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRS 335
               +L   +  GG    +N       +V   +S   F+  ++  + + +LP + L +R 
Sbjct: 302 SLGCILVPLTLAGGISDDWNKPGIIATIVVGFVSFMFFLAWDIKFAKNAVLPFKLLKDRG 361

Query: 336 ILGASFANWFCMMSGVTLAFYV-PVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYM 394
           +  +  A     +   T++ Y+ PV   SV     +       P F +   GSI  G  +
Sbjct: 362 VWASLAAALLEKLIYATISDYLYPVLLVSVNESSKSATRILWLPTFVACT-GSIFFGLLV 420

Query: 395 KKTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFGSSVLITVTLLAMIA 454
            +T R   + +                +   S+    I   +     S + T +L+  + 
Sbjct: 421 VRTKRLKIYSIIGVCLWILSIGLFYHYRGGASSHSGIIGASVVLGTGSAIFTQSLIVNLQ 480

Query: 455 AV-PHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLF 496
            +  H++ A+ T + + F   GS  G S+  A++   +   L+
Sbjct: 481 TMTSHKNMASITGLYFMFAQIGSASGASISGAIWTQTMYKQLY 523

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 96/539 (17%), Positives = 199/539 (36%), Gaps = 34/539 (6%)

Query: 47  REGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYL 106
            E  Q S M+  RL++ + ++ L   + ALD  IV T++  ++      +   W+ T Y 
Sbjct: 61  NEKTQSSIMAGMRLYVCLFALVLAQLIVALDVFIVNTVIDVVSKNLGGYAKSGWLITGYS 120

Query: 107 LSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXV 166
           L ++    ++G+ + + G +  ++IS   F +G ++   + ++  LV            +
Sbjct: 121 LPNSLLSLIWGRATSLLGFQSSMLISIFIFEVGSIVSATATSMNNLVVGRVVAGIGGSGL 180

Query: 167 TSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLC 226
            ++  I    +V  R+R +                      F+     WR  F + +P+ 
Sbjct: 181 QTVSMIIGCSLVEERNRTIVIAVIMSAFAVSSLIGPFIGGAFTTHAT-WRWCFWISLPVG 239

Query: 227 A--------------ISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRIDWLGSL 272
                          +S+   ++                 +  K  +++ + R D +G  
Sbjct: 240 GSAAFLFFFTYNPERLSITARLVRCLKLVKAIPLKQFQYVETYKTIVRNLVFRFDLIGFT 299

Query: 273 SLVTFLFAFMLASSLGGKEIPYNSN-IFKLLVVATILSGTAFIYVELYISD----DPI-L 326
              T +  F+L  + G ++  +    +   LV+  +L   + +Y + YI D    +P   
Sbjct: 300 LNCTGICLFLLGLTFGSEDNSWKRAFVVCFLVIGGLLVVCSVVY-DFYIFDRINPEPANA 358

Query: 327 PIRFLTNRSILGASF---ANWFCMMSGVTLAFYVPV---YWSSVQNLKPTDMGKRIAPNF 380
             R L  R+++G  +   AN     + V  A Y+     ++  V      + G  + P  
Sbjct: 359 SYRPLMVRTLIGHKYFLLANTVTCAAAVVFAGYMVYSVQFFQLVLGYTAWNAGLHLIPLV 418

Query: 381 FSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYILLPLPHFG 440
            ++   +I  G + KKTG     ++                    +   Q  +  LP FG
Sbjct: 419 IASLLSAIFCGGFTKKTGHVKYVMIANIALLLIGSGVCTLLDNYSNNSMQIGVWILPGFG 478

Query: 441 SSVLITVTLLAMIAAVPHEHQAATTSIS--YAFRSTGSTLGVSVGAALFRNKLSGSLFDS 498
               +   L++    +      A T +    AF S   +LG S+GA L       +L+  
Sbjct: 479 LGATLQCALISSQLQIDKNSPDAKTELVEITAFNSFCKSLGSSIGAVLSTTTFISALWRK 538

Query: 499 VMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLI----QCYEQACKSTFAFC 553
           + K + + Y  + +  ++K   ++ +     A +   A +      CY  +  + F  C
Sbjct: 539 INKAKLEGYYGKKINELVKYRLQNFDGKSTEAAEIFSAAVTYVFWMCYAFSALAFFCAC 597

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 64/153 (41%), Gaps = 1/153 (0%)

Query: 77  DNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFF 136
           D  IV+T++  +A +F   S I W+ T Y L +A    ++G+I+   G +  ++ + + F
Sbjct: 83  DIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIF 142

Query: 137 ILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXX 196
            +G LI  L+ ++  L+            + SL  +  S +V    R +           
Sbjct: 143 EIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAI 202

Query: 197 XXXXXXXXXXWFSESKNGWRMAFLVQVPLCAIS 229
                      F+ S   WR  F V +P+  ++
Sbjct: 203 ASVVGPFLGGVFTSSVT-WRWCFYVNLPIGGLA 234

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 75/154 (48%), Gaps = 4/154 (2%)

Query: 31  AEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIAS 90
           A+ +E      SE E      +S ++  R ++  +S+ L  FLAALD  IV T++  +A+
Sbjct: 49  AKDSENGQAAPSEPET----AISPLTGLRFYVCFASLALSLFLAALDILIVGTIMETVAA 104

Query: 91  EFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLW 150
           +FN  S   W+ T Y L +A    L+G+   + G +  +++S + F +G LI   + ++ 
Sbjct: 105 KFNGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAATSMT 164

Query: 151 TLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRA 184
            L+            + +L  +  S +V  R+R 
Sbjct: 165 MLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRG 198

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 49/81 (60%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           I + S  + +F   LD++I  T +++  + ++  S IS ++   L+ SA  Q ++G +SD
Sbjct: 71  IFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVLMISAVSQVIFGGLSD 130

Query: 122 IFGRRPLIIISNLFFILGCLI 142
           IFGR  L ++S + +I+G +I
Sbjct: 131 IFGRLTLFLVSIVLYIVGTII 151

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 63/132 (47%), Gaps = 18/132 (13%)

Query: 34  AETEHLLESEDE-------AREGLQVSEMSR----------ARLHIIISSMCLGSFLAAL 76
           AE + ++ SEDE       + +  QVS  S            R  + I +  L   L   
Sbjct: 26  AEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQA 85

Query: 77  DNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLF 135
             T   T+++ ++  FN E    +W+  ++ L + +F  + G++ DI+G + +++I  + 
Sbjct: 86  GQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVT 145

Query: 136 FILGCLICGLSK 147
            I+  LICGLSK
Sbjct: 146 IIVWSLICGLSK 157

>TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 61/145 (42%), Gaps = 8/145 (5%)

Query: 427 TWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAAL 486
            W   + L   + G  +    TL   I A P   QA  TS  Y FRS GS  GV++   +
Sbjct: 34  NWLVGLFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLYLFRSIGSVWGVAMSTGV 93

Query: 487 FRNKLSGSLFDSVMK-FESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQA 545
            +     SL  ++    + DK ++  L++ I   S   E +H      +   LI     A
Sbjct: 94  IQLYFGKSLRSNLKDLLDEDKINE--LVTKITSNSSYIEKLHGELKDVVIDVLI----LA 147

Query: 546 CKSTFAFCFLISIFAWISCGVIKEY 570
            K T     ++S+ A   C VIKE+
Sbjct: 148 RKKTHLLSTILSLLALAFC-VIKEF 171

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 75/155 (48%), Gaps = 26/155 (16%)

Query: 11  QPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSE----MSRARLHIIISS 66
            PV    N ++ +G+      +    E + E ++++++G+Q S     M + +  +I  +
Sbjct: 4   NPVLKMENDQIEDGVGH---RKEGAAEKINEMDEDSKKGVQFSGVCDGMKQTKSLVIRKT 60

Query: 67  MCLGS---------------FLAA----LDNTIVTTLLSHIASEFNELSHISWIATAYLL 107
             + S               FL A    LD++I    +++  + +N  S +S I+   ++
Sbjct: 61  EIMASQYNTWYSQVLFLSCAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTISIINMM 120

Query: 108 SSATFQPLYGKISDIFGRRPLIIISNLFFILGCLI 142
            SA  Q  +  +SD+FGR  L+I++ LF+++G +I
Sbjct: 121 ISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVI 155

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 63/129 (48%), Gaps = 11/129 (8%)

Query: 32  EVAETEHLLESEDEAREGLQVSEMSRARLH-----------IIISSMCLGSFLAALDNTI 80
           +V ET + LE+ D   +      ++   ++           I+ SS+ L  +  +LD+T+
Sbjct: 16  KVNETSYSLEAHDVPEDDYYNVGVTNIEIYSEFYNTPMKRIILFSSIFLVCYSYSLDSTL 75

Query: 81  VTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGC 140
             T  +   + F+E S +S++     + SA  +  + + +DIFGR  +  I  +F+++G 
Sbjct: 76  RKTFKTDATNSFSEHSLVSFVNCFSAIVSAIGELFFARSADIFGRTSIFYICLVFYVVGT 135

Query: 141 LICGLSKNL 149
           +I   SK +
Sbjct: 136 IIVATSKGI 144

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 74/152 (48%), Gaps = 28/152 (18%)

Query: 19  PELSEGLPA----------YVGAEVAETE----HLLESEDEAREGLQVSE---MSRARLH 61
           PE  +G P+          Y  A V +TE    H  ++E E  + LQ+++   + +A L 
Sbjct: 2   PEYQQGGPSLGSESTPNENYGKANVVQTEKEFSHDSKNEPELGDKLQITKRIVIRKAELM 61

Query: 62  I------IISSMCLGS-----FLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSA 110
                  ++ SM L S     F   LD+ I +  +++  +++   S +S ++   L  SA
Sbjct: 62  ANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLTISA 121

Query: 111 TFQPLYGKISDIFGRRPLIIISNLFFILGCLI 142
             Q  +  +SD+FGR  + I++ +F+++G +I
Sbjct: 122 VAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVI 153

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 74/152 (48%), Gaps = 28/152 (18%)

Query: 19  PELSEGLPA----------YVGAEVAETE----HLLESEDEAREGLQVSE---MSRARLH 61
           PE  +G P+          Y  A V +TE    H  ++E E  + LQ+++   + +A L 
Sbjct: 2   PEYQQGGPSLGSESTPNENYGKANVVQTEKEFSHDSKNEPELGDKLQITKRIVIRKAELM 61

Query: 62  I------IISSMCLGS-----FLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSA 110
                  ++ SM L S     F   LD+ I +  +++  +++   S +S ++   L  SA
Sbjct: 62  ANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLTISA 121

Query: 111 TFQPLYGKISDIFGRRPLIIISNLFFILGCLI 142
             Q  +  +SD+FGR  + I++ +F+++G +I
Sbjct: 122 VAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVI 153

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 65/131 (49%), Gaps = 12/131 (9%)

Query: 20  ELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEM--------SRARLHIIISSMCLGS 71
           E SE LP+      +E++H+    D   +   V  +        +  +  +I  S+   +
Sbjct: 16  EYSEELPS----STSESDHISSHSDAESDKFGVHNVEIYAKYYSTPVKRFLIFFSLFTIA 71

Query: 72  FLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIII 131
           +   LDN++  T  +   S +N+ S +S ++    + SA  Q  + + +D+FGR  +++I
Sbjct: 72  YAYGLDNSVRGTYQTLATSSYNQHSLLSTVSCIKAVISAAAQIWFARSADMFGRTTILMI 131

Query: 132 SNLFFILGCLI 142
           S +F+++G ++
Sbjct: 132 SIVFYVVGTVV 142

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S  L SF   LD  I    +++  + ++  S IS +    ++ SA  Q +Y  +SD+FGR
Sbjct: 76  SAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGVISMVISAVAQVIYAGLSDVFGR 135

Query: 126 RPLIIISNLFFILGCLI 142
             L I+S +F+++G +I
Sbjct: 136 LSLFIVSIVFYVVGTII 152

>NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570
          Length = 530

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 87/235 (37%), Gaps = 6/235 (2%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNE 94
           E E   ES  E    +  +  S  ++++I+  +    FL  L   I    L  +  +FN 
Sbjct: 42  EDEDKQESNQEVTAVIPYTLFSTGQIYVIMFIITFIGFLGPLSGNIYIPALPTLQKDFNV 101

Query: 95  LSHISWIATAYLLSSATFQPLY-GKISDIFGRRPLIIISNLFF-ILGCLICGLSKNLWTL 152
            S +     +  ++     PL+ G  +D+ GR+ L I S L   I+  L+  +  ++ +L
Sbjct: 102 SSTVINATVSVFMAVFAVGPLFWGLFADVGGRKVLYICSILLMVIVNILLASIPAHISSL 161

Query: 153 VXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESK 212
                        V +LG+ T +DI P + R                             
Sbjct: 162 FVLRIVQAFGSSSVITLGAGTVTDITPPKQRGRAIGYFMIGPNMGPVLAPIIAGLILMKG 221

Query: 213 NGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVDIKDKLKRID 267
           N WR  F +   +  + L+LI+ F            V N   G  + + KL+R D
Sbjct: 222 NYWRWLFGLTGIMGGVGLLLIVAF----LPETLRCIVGNADPGWDERRLKLRRDD 272

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 48/81 (59%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           ++ SS+ L +F   LDN++ TT  +   S +++ S +S +     + SA  Q  + + +D
Sbjct: 76  MVFSSLFLIAFAYGLDNSVRTTYQTMATSSYSQHSLLSTVTCIKKVISAAAQLWFARSAD 135

Query: 122 IFGRRPLIIISNLFFILGCLI 142
           +FGR  ++ IS +F+++G +I
Sbjct: 136 MFGRPTILTISIIFYVIGTII 156

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 97/453 (21%), Positives = 171/453 (37%), Gaps = 43/453 (9%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  I  T  ++  S +++ S +S +     + +A  Q  + ++SDIFGR
Sbjct: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135

Query: 126 RPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRAL 185
             +++IS +F+I+G +I   + N+                +  +  + ASD   L  R L
Sbjct: 136 FSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLL 195

Query: 186 YQXXXXXXXXXXXXXXXXXXXWFSES-----KNGWR-----MAFLVQVPLCAISLVLIII 235
                                W S +        W+      AF+  +PL  I L L ++
Sbjct: 196 --------ALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFI--LPLACIPLGLCML 245

Query: 236 FXXXXXXXXXXXXVSNDKDGKVDIKDK-------LKRIDWLGSLSLVTFLFAFMLASSLG 288
                        +  + +    +K K         ++D +G L +  F    ++  +L 
Sbjct: 246 HMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLA 305

Query: 289 G--KEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFA---- 342
           G  KE    ++I    V+  +++   ++  E+  S  P+ P   + +R I  A       
Sbjct: 306 GGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAFFI 365

Query: 343 --NWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRY 400
             NW+     +     V V+ S     + T +      +F S   G+I  G+ + K  R 
Sbjct: 366 NFNWYMQGDYMYTVLIVAVHESIKSATRITSLY-----SFVSVIVGTI-LGFILIKVRRT 419

Query: 401 YGFLLKFTXXXXXXXXXXXXXKPDISTWRQYI-LLPLPHFGSSVLITVTLLAMIA-AVPH 458
             F+L                + D       I  L L  FG+     VT  ++ A A  H
Sbjct: 420 KPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTH 479

Query: 459 EHQAATTSISYAFRSTGSTLGVSVGAALFRNKL 491
              A  TS+  A  + GS  G SV  A++ N L
Sbjct: 480 ARMAIVTSLYLATYNIGSAFGSSVSGAVWTNIL 512

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 68/171 (39%), Gaps = 11/171 (6%)

Query: 69  LGSFLAALDNTIVTTLLSHIASEFN--ELSHIS--WIATAYLLSSATFQPLYGKISDIFG 124
           +  F+   D   ++T L  I ++ +  EL++ +  +I  A  L +       G  +DIFG
Sbjct: 128 ISGFMFGYDTGYISTALISIGTDLDHKELTYGNKEFITAATSLGALISSIFAGISADIFG 187

Query: 125 RRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRA 184
           R+P I++SNL F++G +I   +   W +V             + +  +  S+I P   R 
Sbjct: 188 RKPCILLSNLMFLIGAIIQVTAHTFWQMVVGRFIMGFGVGIGSLIAPLYISEIAPKNIRG 247

Query: 185 LYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIII 235
                                   S   NGWR+       L  +SL+  +I
Sbjct: 248 RLTVINSLWLTGGQLIAYGCGAGLSHVNNGWRI-------LVGLSLIPTVI 291

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 32/49 (65%)

Query: 99  SWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           +W+  A+ L S +F  + G+I DI+G +  +++  LF I+  LICGL+K
Sbjct: 102 AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTK 150

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 83/188 (44%), Gaps = 8/188 (4%)

Query: 1   MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARL 60
           M + + +S    ++N +  ++ +  P   G  +  T+ L+  + E    +  ++  R   
Sbjct: 1   MSKDNASSAHADLKNEVYVDVEKVTP---GCTLKTTKSLVIRKTE----IMAAQYDRWYH 53

Query: 61  H-IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKI 119
           H II+ S  +  +   LD ++     S+  S +++   IS I     + SA  Q ++ ++
Sbjct: 54  HAIILFSAFICGYGYGLDGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAASQIVFARL 113

Query: 120 SDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVP 179
           SD+FGR  L I + LF+ +G +I   + ++                +  +  +  SD   
Sbjct: 114 SDVFGRLSLFITALLFYAVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILILILSDFSS 173

Query: 180 LRSRALYQ 187
           LR R +YQ
Sbjct: 174 LRWRLVYQ 181

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 54  EMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATF 112
           + S+ +L I ++ + LG     L+   V +++  +   +  E +  SW  T+Y ++ A  
Sbjct: 24  QNSKYQLIINMALIFLGCTFDLLNVAGVISVIEDLGETYGLEYTTASWALTSYAITFAGL 83

Query: 113 QPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNL 149
               G++ DI G   L  IS  FF L CL+C +  N 
Sbjct: 84  IAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNF 120

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 122/294 (41%), Gaps = 16/294 (5%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           ++IS+   G +   LD  I      +  S ++E S +S I     + SA  Q +Y ++SD
Sbjct: 82  LLISAFVCG-YGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSD 140

Query: 122 IFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLR 181
           +FGR  L I + + +++G +I   + ++                V  +  I  SD   L+
Sbjct: 141 VFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGYVGVILILLIILSDFSSLK 200

Query: 182 SRALYQXXXXXXXXXXXXXXXXXXXWFSESKN-GWRMAFLVQV-PLCAISLVLIIIFXXX 239
            R LYQ                     +  +N  W +     + PL  I +VL ++    
Sbjct: 201 WRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAFIFPLSCIPIVLCMLHMQW 260

Query: 240 XXXXXXXXXVSNDKD------GKVDIKDKL-KRIDWLGSLSLVTFLFAFMLASSL-GGKE 291
                       D+       G V + ++L  ++D +G L +   L   ++  +L GG +
Sbjct: 261 IARKTPEWHALKDEKSYYQEHGFVKVLEQLFWKLDVIGVLLMGCSLGCILVPLTLAGGVK 320

Query: 292 IPYN-SNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSI---LGASF 341
             +N S +    V+  +L    +++ E  ++ DPI+P + + +R +   +G SF
Sbjct: 321 TTWNDSRLIGPFVLGFVLIPILWVW-EYRVARDPIIPYKLVKDRGVWSSMGISF 373

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 76/356 (21%), Positives = 136/356 (38%), Gaps = 44/356 (12%)

Query: 20  ELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRAR------------LHIIISSM 67
           E S+G  ++V  E  E  H   + DE   G + +   R                I++ S 
Sbjct: 28  ETSDGTNSFVNKEQYEA-HQDSTTDEHETGKKKTLTIRKTELLSKSYDKWYLQAILLFSA 86

Query: 68  CLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRP 127
            +  +   LD  I      +  S ++E S +S I     + SA  Q +Y ++SDI+GR  
Sbjct: 87  FVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSDIYGRMS 146

Query: 128 LIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQ 187
           L++++ + + +G +I   + ++                V  +  +  SD   LR R  YQ
Sbjct: 147 LLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLLILSDFSSLRWRLFYQ 206

Query: 188 XXXXXXXXXXXXXXXXXXXWFSESKN-GWRMAFLVQV-PLCAISLVLIIIFXXXXXXXXX 245
                                +  K+  W +     + PL  + ++  +I          
Sbjct: 207 FVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAFIFPLSCVPILCCMIH--------M 258

Query: 246 XXXVSNDKD---------------GKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSL-GG 289
              V ND +                KV +K    ++D +G L +V  L   ++  +L GG
Sbjct: 259 HWRVRNDPEWKELQGEKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVPLTLAGG 318

Query: 290 KEIPYN-SNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSI---LGASF 341
               +N SNI    V+  +L    F Y E   + +P++P + + +R +   LG SF
Sbjct: 319 VSSKWNHSNIIGPFVLGFVLI-PIFSYWEARWATNPLVPYKLVKDRGVWAALGISF 373

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 59/117 (50%)

Query: 71  SFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLII 130
           S+  +LD+ +     ++ AS + + S +S I     ++SAT Q +Y + SDIFGR  L++
Sbjct: 124 SYGYSLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRASDIFGRLSLLL 183

Query: 131 ISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQ 187
           ++ + +++G +I   + ++                V+ L ++  SD   L+ R  YQ
Sbjct: 184 VAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLKWRFFYQ 240

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 59  RLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGK 118
           R+ ++ S+   G F   LD+ I      +  S + + S +S +A    L SA  Q  Y +
Sbjct: 63  RVILLFSAFICG-FGYGLDSNIRYIYTGYATSSYAQHSLLSTVAIINNLLSAASQIFYAR 121

Query: 119 ISDIFGRRPLIIISNLFFILGCLI 142
           +SD+FGR  L ++S +F+++G +I
Sbjct: 122 LSDVFGRLSLFVVSMVFYVIGTII 145

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 41/72 (56%)

Query: 71  SFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLII 130
           SF   LD+ I    +++   ++ E S +S +    L+ SA  Q  +  +SD+FGR  L +
Sbjct: 80  SFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNVVSLMISAVGQIFFAGLSDVFGRLSLFV 139

Query: 131 ISNLFFILGCLI 142
           ++ +F+++G +I
Sbjct: 140 VAIIFYVVGTII 151

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQP 114
           SR + ++ I +  L + L     T  T+ ++ I S FN + S  +W+  ++ L S +F  
Sbjct: 77  SRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFIL 136

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           + G+I DI+G +  +I   +  I+  LICG + 
Sbjct: 137 VSGRIGDIYGLKRTMIGGLIVMIIWSLICGFAN 169

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 85/204 (41%), Gaps = 30/204 (14%)

Query: 2   VESDRTSLLQPVRNALNPE-------LSEGLPAYVGAEVAETEHLLESEDEAREG----L 50
           V  ++  +L  V + LN E       +S GLP            L E  D  R+     +
Sbjct: 10  VSGEKIHVLTDVEHELNAETHTGSNSISFGLP-----------QLSEKYDALRQNRSLII 58

Query: 51  QVSEMSRA-------RLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIAT 103
           Q +E+  A       ++ +++S+   G +   LD  I      +  S ++E S +S I  
Sbjct: 59  QQTEIFGAAYNKWYLQVFLLLSAFICG-YGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 104 AYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXX 163
              + SA  Q +Y ++SD+FGR  L I + + +++G +I   + ++              
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 164 XXVTSLGSITASDIVPLRSRALYQ 187
             V  +  I  SD   L+ R LYQ
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQ 201

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 56/145 (38%), Gaps = 21/145 (14%)

Query: 39  LLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN----E 94
           ++++ D  R   Q     R    ++I   C      A D   VT +LS      N    E
Sbjct: 5   IIKTRDSIRSNFQNISFHRYINLVLIMVSC------AFDLINVTAVLSATRDIENTYQIE 58

Query: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVX 154
            +  SW  TAY ++ A F    G++ DI G   L + S   F +  LIC +  N  T   
Sbjct: 59  FTTASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGTFAV 118

Query: 155 XXXXXXXXXXXVTSLGSITASDIVP 179
                        +L  I A+ IVP
Sbjct: 119 FR-----------ALQGIAAAGIVP 132

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 46/115 (40%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASD 176
           G ++DIFGR+P+ + SN+ F++G ++   +++ W +              + L  +  S+
Sbjct: 139 GTLADIFGRKPVTMSSNVMFLIGAILQACTRSFWQMAAGRLLMGFGIGIGSLLSPLFISE 198

Query: 177 IVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLV 231
           I P   R                         S+  NGWR+   + V    I L+
Sbjct: 199 IAPSEYRGRLTVVNSACITGGQLIAYGIGAGTSKIDNGWRILVAISVVPSMIQLI 253

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 6/115 (5%)

Query: 39  LLESEDEAREGLQVSEMSRA-----RLHIIISSMCLGSFLAALDNTIVTTLLSHIASEF- 92
           L  SEDE  +  Q  +         + ++ I +  +   L     T   ++++ +A  F 
Sbjct: 53  LTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFG 112

Query: 93  NELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           ++ +  SW+  ++ L S +F  + G++ DIFG + +++I  +  I+  LICGL+K
Sbjct: 113 SDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTK 167

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 64/140 (45%), Gaps = 5/140 (3%)

Query: 3   ESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHI 62
           + D+ S++  VR+  N   SE    Y     +E E L      A+   +       R+ I
Sbjct: 13  DEDKISVISDVRSLKNTNDSE----YTFTSDSENEVLSPGVHNAKIYGKYYTEPYQRIMI 68

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDI 122
             S + L  +   LD    TT ++   S + E S +S +     + SA  Q  + + SDI
Sbjct: 69  FFS-LFLICYAYGLDKKTRTTYVTLATSSYKEHSLMSTVTCITKVISAAGQIWFARASDI 127

Query: 123 FGRRPLIIISNLFFILGCLI 142
           FGR+ +  +S +F+++G +I
Sbjct: 128 FGRKLIFGLSVIFYVIGTVI 147

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 110/565 (19%), Positives = 214/565 (37%), Gaps = 44/565 (7%)

Query: 40  LESEDEAREG---LQVSEM---------SRARLHIIISSMCLGSFLAALDNTIVTTLLSH 87
           L   D+ R+    ++V EM         + AR+ ++ S+   G F   LD    +   ++
Sbjct: 32  LTKGDKGRQQYDYMKVKEMEIIKDVCSGNLARVFLLASAFLCG-FAYYLDMVTRSVYTTY 90

Query: 88  IASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
            A+ + + S +S I     +     Q  + ++SD+FGR  + ++  + +++G +I   + 
Sbjct: 91  AANSYEKHSLLSTIQVINSVVGVGAQISFARLSDVFGRLQMFVVGTILYVVGTIIQSQAH 150

Query: 148 NLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXW 207
           ++                V+ L  +  SD+ PLR R  YQ                    
Sbjct: 151 DVKVYAVGAIFYNTGFVGVSLLLILVLSDMSPLRWRLFYQFTASFPCIIISWISGDIVEA 210

Query: 208 FSESKN-GWRMAFLVQV-PLCAISLVLIIIFXXXXXXXXXXXXVSNDKDGKVD------- 258
            +  KN  W +     + PL ++  +  + +               D   KV+       
Sbjct: 211 ANPMKNWSWDIGMWAFIFPLSSLPFITYLFYATHISSKTKKW---KDLRNKVETHKRNII 267

Query: 259 --IKDKLKRIDWLGSLSLVTFLFAFMLASSLGG--KEIPYNSNIFKLLVVATILSGTAFI 314
             +KD   +ID +G++ +   L   ++  +L G   E  +   I   LV+   L    F+
Sbjct: 268 LVVKDIFNQIDIVGTVLVTAALGLILVPLTLAGGVSERWHEPGIIATLVIGIALL-LVFL 326

Query: 315 YVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYV-PVYWSSVQNLKPTDMG 373
           + E   + +  LP   L +R +  +  A +   M    ++ Y+ PV   SV     +   
Sbjct: 327 FWEAKFAKNAALPFNLLKDRGVWASIVAAFLEKMIYAMISDYLYPVLLVSVNETNKSATR 386

Query: 374 KRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQYIL 433
               P F +    S+  G  +    R   F +  T             +   S+    I 
Sbjct: 387 IVWLPTFMA-CLCSVFFGLLVVSVQRLKVFTICGTFLWIISIGLFYQFRGGESSHSGIIG 445

Query: 434 LPLP-HFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLS 492
             +   FGS++     ++ + A   H++ A+ T + + F   G+  G S+         S
Sbjct: 446 ASIVLGFGSAIFTQSIIVTLQAMASHDNMASITGLYFMFAQVGAATGASI---------S 496

Query: 493 GSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATL-IQCYEQACKSTFA 551
           G+++   M  +  K  K+  L++   AS   E++ + A    +  L IQ Y    K T  
Sbjct: 497 GAIWTQTMYKQLLKQLKDSDLTMAVFASP-YEFIASYAWGTKERDLVIQAYRHVQKVTML 555

Query: 552 FCFLISIFAWISCGVIKEYKLHTSM 576
              ++++   +S    K+ KL  S+
Sbjct: 556 VSLILTVPLLVSVLFTKDRKLSDSV 580

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 49/81 (60%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           +++ S+ L S+   LD ++ +   ++  + ++  S +S I+   L+  A+ Q  + ++SD
Sbjct: 69  VLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISIINLVIGASAQVFFARLSD 128

Query: 122 IFGRRPLIIISNLFFILGCLI 142
           +FGR  L+I++ +F+ +G +I
Sbjct: 129 VFGRLTLLIVATVFYSVGTII 149

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 47/84 (55%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  I  T  ++  S +++ S IS +     + +A  Q  + + SD+FGR
Sbjct: 57  SIFLVAYAYGLDGNIRYTFQAYATSSYSQHSLISTVNCIKTVIAAAGQICFARASDVFGR 116

Query: 126 RPLIIISNLFFILGCLICGLSKNL 149
             ++II+ LF+++G +I   + N+
Sbjct: 117 LSILIIAVLFYVVGTVIESQATNV 140

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 54/120 (45%), Gaps = 15/120 (12%)

Query: 32  EVAETEHLLESEDEA-----REGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLS 86
           E  E+  L++S  E      RE L V  +S A+L             A L  +I    + 
Sbjct: 18  EEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMT----------QAGLAQSIAPVRII 67

Query: 87  HIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
             +   +    +SW + AY L+  TF  + G++ D+FG + L ++  L++ L  L+ G S
Sbjct: 68  GNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/188 (19%), Positives = 78/188 (41%), Gaps = 8/188 (4%)

Query: 5   DRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLES---EDEAREGLQVSEMSRARLH 61
           D T     V   +  EL +     V  E+ + E   +    E  + E +  + ++  +  
Sbjct: 23  DNTGSESSVFRTVTRELRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPYTLLTYRQKW 82

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFN---ELSHISWIATAYLLSSATFQPLYGK 118
            +++ +    F ++L + I    L  + +EF+   EL +I+     YLL       + G 
Sbjct: 83  FMVALLTSAGFWSSLGSPIYYPALKELEAEFDVNEELINIT--VVVYLLFQGIAPTISGG 140

Query: 119 ISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIV 178
           ++D++GRRP+I++  L +++  +    SK+   +V            + ++ S  A D  
Sbjct: 141 LADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFLRCLQSAGISPIIAINSGVAGDFT 200

Query: 179 PLRSRALY 186
               R  +
Sbjct: 201 VKSERGTF 208

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 61  HIIISSMCLGSFLAALDNTIVTTLLSHIASEF--NELSHISWIATAYLLSSATFQPLYGK 118
           ++ I +  +   L     T   ++++ IA+ F  NE S  +W+  ++ L S +F  + G+
Sbjct: 70  YLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSR-TWLMASFPLVSGSFILISGR 128

Query: 119 ISDIFGRRPLIIISNLFFILGCLICGLSK 147
           + DI+G + ++ I  +  I+  LICGL+K
Sbjct: 129 LGDIYGLKKMLTIGYVVIIIWSLICGLTK 157

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 55/137 (40%), Gaps = 5/137 (3%)

Query: 53  SEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN---ELSHISWIATAYLLSS 109
           S   R    ++I       F +++   I   +L+ I  +FN   EL +I+ +   Y +  
Sbjct: 92  SRFGRTEKSLLIIQCAFTGFFSSVAGAIYYPVLTVIEKKFNITEELVNITVVV--YFIFQ 149

Query: 110 ATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSL 169
                  G ++D  GRRP+++ S L +   C+   LS+N   +V            V ++
Sbjct: 150 GLAPSFMGGLADSLGRRPVVLFSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAI 209

Query: 170 GSITASDIVPLRSRALY 186
            S    DI     R  Y
Sbjct: 210 NSGICGDITTRAERGAY 226

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/154 (20%), Positives = 59/154 (38%), Gaps = 7/154 (4%)

Query: 69  LGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLY-----GKISDIF 123
           L  FL   D   +++ L  + ++      +++    Y+ S+ +   L      G  +D+F
Sbjct: 75  LSGFLFGYDTGYISSALQSVGTDLGH--QLTYRDKEYITSATSLGALIAALGAGICADLF 132

Query: 124 GRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSR 183
           GRR  I+ SN+ F++G ++   + N W +V             + +  +  S+I P   R
Sbjct: 133 GRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGFGIGFGSLISPLFISEIAPKMIR 192

Query: 184 ALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRM 217
                                   F   K+GWR+
Sbjct: 193 GRLTVINSLWLTGGQLIAYACGAGFQHVKHGWRI 226

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 61  HIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKI 119
           +  I +  L + L     T   + ++ +A   N + +  +W+  ++ L+S +F  + G+I
Sbjct: 74  YTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRI 133

Query: 120 SDIFGRRPLIIISNLFFILGCLICGLSK 147
            DI+G +   I  N+ F +  ++CG+SK
Sbjct: 134 GDIYGLKATFIGGNIIFCIWSILCGVSK 161

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%)

Query: 59  RLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGK 118
           R+ I+  S+ L ++   L   +  T  +   S +++ S ++ +     + SA  Q  Y +
Sbjct: 54  RVTILYFSLFLLAYAYNLHKDVRGTYQTLATSSYSKHSLLATVQCINQVISAAGQIWYAR 113

Query: 119 ISDIFGRRPLIIISNLFFILGCLI 142
            SDIFGR P++I+S LF+ +G LI
Sbjct: 114 ASDIFGRTPILILSILFYFIGTLI 137

>TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 632

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 44  DEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIA- 102
           D   + L   + S     I  S +CL     AL ++I    +  +  ++N ++ +  +  
Sbjct: 175 DGPDDKLHPFDWSVRDKTITCSILCLDCITIALGSSIFAPGIPQLCEQYNIITVVEILGV 234

Query: 103 TAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLV 153
           T Y+L  A    LY  +S+++GR+ ++++S L F L  +    ++NL T++
Sbjct: 235 TLYVLGFAAVPVLYAPLSELYGRKGVLVLSGLRFCLIQIAVATAENLQTIM 285

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 45/81 (55%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           +I+S+  L  F  +LD T+ +T   +  + + E S +S I     + S   Q ++ ++SD
Sbjct: 59  LILSTAFLCGFGFSLDATLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSD 118

Query: 122 IFGRRPLIIISNLFFILGCLI 142
            FGR  L  ++++ +I+G ++
Sbjct: 119 YFGRLELFTVASILYIIGTIV 139

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 47/84 (55%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  I  T  ++  S +++ S +S +     + +A  Q  + + SDIFGR
Sbjct: 63  SLFLVAYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIKTVIAAAGQIWFARASDIFGR 122

Query: 126 RPLIIISNLFFILGCLICGLSKNL 149
             ++II+ LF+++G +I   + N+
Sbjct: 123 LTMLIIAILFYVVGTIIESQATNV 146

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 92/221 (41%), Gaps = 21/221 (9%)

Query: 258 DIKDKLKRI--DWLGS----LSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGT 311
           +I   + R+  DW+GS    L L+ F F +  A + G     +NS    +L+V ++++  
Sbjct: 241 NIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADG-----WNSAYLIVLLVISVIALI 295

Query: 312 AFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTD 371
           AF   EL  +++P+LP   + NR ++    A  F   S     FY   +  +++N  P  
Sbjct: 296 AFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLW 355

Query: 372 MGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDISTWRQY 431
            G        S    +I  G+ MKK       LL F+              P   T+ + 
Sbjct: 356 AGGSYFIFVISGTITAISCGFLMKKIRP--AVLLTFSMVGFNLGCIIFSVTPVHQTYFRN 413

Query: 432 IL-----LPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSI 467
           IL     LPL   G  +    + + +   +P++HQ    S+
Sbjct: 414 ILGTMIILPL---GMDLSFPASSIILSDNLPNQHQGMAGSL 451

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%)

Query: 100 WIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
           W+  ++ L S +F  + G++ DI+G + ++I+  +  ++  LI GLS
Sbjct: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLS 141

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKIS 120
           + I++  L   L     T    +++ ++  FN E ++ +W+  ++ L++ +F  + G++ 
Sbjct: 71  MFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLG 130

Query: 121 DIFGRRPLIIISNLFFILGCLICGLSK 147
           DI+G + ++I+  +  I+  +I GLSK
Sbjct: 131 DIYGLKKMLIVGYVIVIVWSIISGLSK 157

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 474 TGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKF 533
           T + + ++  + LF   L  SL+ ++ +  S+++ +E L  I+ +A ESS ++  +AP+F
Sbjct: 579 TAAGVAITGASILFNVALRKSLWTALEQLVSEEHPQEQLQQILHRALESSHWIQHSAPEF 638

Query: 534 IQATLIQCYEQACKSTFAFCFLISI 558
            Q T+   +    +  F   FL +I
Sbjct: 639 AQETIYASF----RHNFTTLFLAAI 659

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 96  SHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
             +SW A++Y L+  TF  + G++ DIFG R   I+   ++ L  L+ G S
Sbjct: 81  GQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFS 131

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 91/214 (42%), Gaps = 17/214 (7%)

Query: 261 DKLKRIDWLGSLSLVTFLFAFMLASSLG---GKEIPYNSNIFKLLVVATILSGTAFIYVE 317
           + L+R+D+ GS++ V  L  F  A + G   G E PY    + LL+V T+  G  F+++E
Sbjct: 238 NMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYT---YVLLIVGTVFLGV-FVFIE 293

Query: 318 LYISDDPILPIRFLTNRS--ILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKR 375
              +  P+LP   L++ +  +LG   A W     G+ + FY   +    +   P     +
Sbjct: 294 SR-AAYPLLPFAALSSDAAFVLGCIAAGWSSF--GIWI-FYTWQFMEESRKQSPLLSSAQ 349

Query: 376 IAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTXXXXXXXXXXXXXKPDIST-WRQ-YIL 433
            AP   S    ++  G+ +  T      ++ F               P   T W Q ++ 
Sbjct: 350 FAPVAISGFCAAVTTGFLLSHTPAST--VMLFAMTAFTVGIILIATAPVHQTYWAQTFVS 407

Query: 434 LPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSI 467
           + +  +G  +      + +  ++PHEHQ    S+
Sbjct: 408 IIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASL 441

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 75  ALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNL 134
            LD  I      +  S + E S +S I     ++SA  Q +Y + SD+FGR  L I+S +
Sbjct: 127 GLDGNIRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVYARASDVFGRLSLFIVSVV 186

Query: 135 FFILGCLI 142
           F+ +G +I
Sbjct: 187 FYAVGTII 194

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 83/203 (40%), Gaps = 28/203 (13%)

Query: 2   VESDRTSLLQPVRNALNPEL-------SEGLPAYVGAEVAETEHLLESEDEAREG----L 50
           V+ ++  +   + + LNPE        S GLP            L E  +  R+     +
Sbjct: 10  VKEEKKHVFMGMEHELNPETHNDSNSDSYGLP-----------QLSEKYNALRQNRSLII 58

Query: 51  QVSEMSRARLH------IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATA 104
           Q +E+  +  +      I++ S  +  +   LD  I      +  S ++E S +S I   
Sbjct: 59  QQTEIIGSAYNKWYLQAILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVI 118

Query: 105 YLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXX 164
             + SA  Q +Y ++SD+FGR  L I + + +++G +I   + ++               
Sbjct: 119 NAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYV 178

Query: 165 XVTSLGSITASDIVPLRSRALYQ 187
            V  +  I  SD   L+ R LYQ
Sbjct: 179 GVILILLIILSDFSSLKWRLLYQ 201

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 62/145 (42%), Gaps = 19/145 (13%)

Query: 43  EDE---AREGLQV----SEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-E 94
           +DE    R GL+      + SR +L I I+ +  G     L+   V +++  +   +   
Sbjct: 2   QDEFGKLRNGLKCLRLKCQNSRYQLGINITLIFFGCTFDLLNVAGVISVIEDLGETYKLG 61

Query: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVX 154
            +  SW  T+Y ++ A F    G++ DI G   L  IS   F L  L+C + ++  T   
Sbjct: 62  YTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPTF-- 119

Query: 155 XXXXXXXXXXXVTSLGSITASDIVP 179
                        +L  I+A+ IVP
Sbjct: 120 ---------AVFRALQGISAAGIVP 135

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 96  SHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
             +SW A+AY L+  TF  + G++ DIFG +   ++   ++ L  L+ G S
Sbjct: 80  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 130

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 96  SHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
             +SW A+AY L+  TF  + G++ DIFG +   ++   ++ L  L+ G S
Sbjct: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 96  SHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
             +SW A+AY L+  TF  + G++ DIFG +   ++   ++ L  L+ G S
Sbjct: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131

>TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 44  DEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIA- 102
           D A + L     S     I  + +CL      L ++I    ++ I+ +++ ++ ++ +  
Sbjct: 175 DGADDKLHPFNWSMKEKTITCAILCLDCITITLGSSIFAPGVTQISEQYDIITVVAILGI 234

Query: 103 TAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLV 153
           T Y+L  A    LY  +S+I+GR+ +++IS   F L       ++NL T++
Sbjct: 235 TLYVLGFAASPVLYAPLSEIYGRKLILVISGFGFALFQFAVATAENLQTIM 285

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQP 114
           +R   ++ I S  +  F++    T   ++++ +A E N E S  +W+  ++ LS  +F  
Sbjct: 94  NRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFIL 153

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
           + G++ DI+G + +++       +  LICG S
Sbjct: 154 VSGRLGDIYGLKKVLLGGYAILTIWSLICGFS 185

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 44/81 (54%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           I++ S  L  +   LD ++      +  + + E S +S IA    + SA  Q +Y +++D
Sbjct: 64  ILLFSAFLCGYGYGLDGSVRYIYTGYATNSYAEHSLLSTIAVINAVISAAAQIVYARLAD 123

Query: 122 IFGRRPLIIISNLFFILGCLI 142
           +FGR  L I + +F+++G +I
Sbjct: 124 VFGRLYLFITAVIFYVVGTII 144

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 58/113 (51%), Gaps = 6/113 (5%)

Query: 41  ESEDEAREGLQVSEMSRA-----RLHIIISSMCLGSFLAALDNTIVTTLLSHIASEF-NE 94
           +SEDE  +  Q  +         + ++ I +  +   L     T   ++++ ++  F +E
Sbjct: 44  QSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSE 103

Query: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
            +  SW+  ++ L S +F  + G++ DI+G + ++++  +  I+  LICG++K
Sbjct: 104 GNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITK 156

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 47/84 (55%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  I  T  ++  S +++ S +S +     + +A  Q  + ++SDIFGR
Sbjct: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135

Query: 126 RPLIIISNLFFILGCLICGLSKNL 149
             ++I+S +F+ +G +I   + N+
Sbjct: 136 FSIMIVSIIFYSMGTIIESQAVNI 159

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 47/84 (55%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  I  T  ++  S +++ S +S +     + +A  Q  + ++SDIFGR
Sbjct: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135

Query: 126 RPLIIISNLFFILGCLICGLSKNL 149
             ++I+S +F+ +G +I   + N+
Sbjct: 136 FSIMIVSVIFYSVGTIIESQAVNI 159

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 56/114 (49%), Gaps = 7/114 (6%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN- 93
           E +H++E E      L    ++  +   ++  M +  F ++L + I    L  +  +FN 
Sbjct: 68  EQQHIVEGEQNYPHTL----LTYRQKWFMVFLMTITGFWSSLGSPIYYPALKELEQKFNI 123

Query: 94  ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           + + ++     YLL       + G ++D++GRRP+I+   L F++  +  G++K
Sbjct: 124 DENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI--GIAK 175

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 54  EMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATF 112
           + S  +L++ ++ + LG     L+   + +L+  +A +++   +  SW  T+Y ++ A F
Sbjct: 21  QKSTYQLNVNVALIFLGCTFDLLNVASMISLIDDLAQKYDISYTTASWSLTSYAVTFAGF 80

Query: 113 QPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNL 149
               G++ DI G   L  +S  FF +  L+C +  N 
Sbjct: 81  IAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVMPNF 117

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKISDIFG 124
           +MC  +F ++L + I    L  +  EFN +   ++     YLL         G ++DI+G
Sbjct: 70  TMC--TFWSSLGSPIYYPALRQLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYG 127

Query: 125 RRPLIIISNLFFI 137
           RRP+I+I  + ++
Sbjct: 128 RRPVIVIGMIIYV 140

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 60/117 (51%), Gaps = 8/117 (6%)

Query: 34  AETEHLLESEDEAREGLQVSE---MSRARLHIIISSMCLGS-----FLAALDNTIVTTLL 85
           AE+EH L  + +  + + + +   M+    +  + S+ L S     F   LD+ I +  +
Sbjct: 37  AESEHKLADKLQITKRIVIRKSELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRSVYM 96

Query: 86  SHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLI 142
           ++  +++   S +S ++   L  SA  Q  +  +SD+FGR  + I++  F+++G +I
Sbjct: 97  TYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSDVFGRLSIFIVAIAFYVVGTII 153

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 99/453 (21%), Positives = 170/453 (37%), Gaps = 43/453 (9%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  I  T  ++  S +++ S +S +     + +A  Q  + ++SDIFGR
Sbjct: 76  SIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135

Query: 126 RPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRAL 185
             +++IS +F+ +G +I   +  +                V  +  + ASD   L  R L
Sbjct: 136 FSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLL 195

Query: 186 YQXXXXXXXXXXXXXXXXXXXWFSES-----KNGWR-----MAFLVQVPLCAISLVLIII 235
                                W S          W+      AF+  +PL  I L L ++
Sbjct: 196 --------ALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFI--LPLACIPLGLCML 245

Query: 236 FXXXXXXXXXXXXVS------NDKDGK-VDIKDKLKRIDWLGSLSLVTFLFAFMLASSLG 288
                        +       N+ D K   I     ++D +G L +  F    ++  +L 
Sbjct: 246 HMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVPFTLA 305

Query: 289 G--KEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFA---- 342
           G  KE    ++I    V+  +++   ++  E+  S  P+ P   + +R +L A F     
Sbjct: 306 GGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALFIAFFI 365

Query: 343 --NWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRY 400
             NW+     +     V V+ S     + T +      +F S   G+I  G+ + K  R 
Sbjct: 366 NFNWYMQGDYMYTVLVVAVHESIKSATRITAL-----YSFVSVIVGTI-LGFILIKVRRT 419

Query: 401 YGFLLKFTXXXXXXXXXXXXXKPDISTWRQYI-LLPLPHFGSSVLITVTLLAMIA-AVPH 458
             F+L                + D       I  L L  FG+     VT  ++ A A  H
Sbjct: 420 KPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTH 479

Query: 459 EHQAATTSISYAFRSTGSTLGVSVGAALFRNKL 491
              A  TS+  A  + GS  G SV  A++ N L
Sbjct: 480 ARMAIVTSLYLATYNIGSAFGSSVSGAVWTNIL 512

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  + +T  +   S +   S +S +     + SA  Q  Y + +DIFGR
Sbjct: 64  SIFLTTYCYTLDKRVRSTFQTEATSSYKNHSLMSTVTCITTVISAAGQIAYARAADIFGR 123

Query: 126 RPLIIISNLFFILGCLICGLSKNL 149
             L+  +  F+++G ++   + N+
Sbjct: 124 TSLVFTAIFFYVIGTVVESQATNI 147

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELS-HISWIATAYLLSSATFQPLYGKIS 120
           + + S  +G  L    +T+  + +  +  E +  S   SW+  ++ L S +F  + G++ 
Sbjct: 65  LFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLG 124

Query: 121 DIFGRRPLIIISNLFFILGCLICGLS 146
           DI+G + ++++  ++  +  LICGLS
Sbjct: 125 DIYGLKKMLLLGYIWLTIWSLICGLS 150

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 31  AEVAETEHL-LESEDEAREGLQVSEMSRA--RLHIIISSMCLGSFLAALDNTIVTTLLSH 87
           +  A TEH  ++ +D+    +Q      A  + ++ I +  +   L     T   +L++ 
Sbjct: 21  SATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINI 80

Query: 88  IASEFNE-LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
           ++  F+   S  +W+  ++ L S +F  + GKI DI+G +  +++  +  I+  LICGL+
Sbjct: 81  LSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 66/128 (51%), Gaps = 10/128 (7%)

Query: 32  EVAETE---HLLESEDEARE-GLQVSEMSRARL-HI-----IISSMCLGSFLAALDNTIV 81
           E A +E   H  E   E ++ G+   E+  A+  HI     +  S+ L S+   LD  I 
Sbjct: 13  ETANSELSSHTHEDAGEEKDAGVHNIEVFTAQYDHIGYRLMLFFSIFLISYAYGLDQNIR 72

Query: 82  TTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCL 141
            TL ++  + +++ S ++ +     + +A  Q  + + +DIFGR  ++I++ +F+++G +
Sbjct: 73  YTLQTYATNSYSQHSLLATVNCIIAVIAAPGQVCFARAADIFGRFTVLIVAVIFYVMGTI 132

Query: 142 ICGLSKNL 149
           I   + N+
Sbjct: 133 IESQATNV 140

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 45/84 (53%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD ++  T  +   S +++ S +S +     + +A  Q  Y + SDIFGR
Sbjct: 80  SLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSTVNAITTVIAAAGQICYARASDIFGR 139

Query: 126 RPLIIISNLFFILGCLICGLSKNL 149
             ++II  +F+ +G +I   + N+
Sbjct: 140 MTILIIGLVFYAVGTIIESQATNV 163

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 96  SHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
             +SW A AY L+  TF  + G++ D++G +   II   ++ L  L+ G S
Sbjct: 83  GQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFS 133

>YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}
           ITR2Myo-inositol transporter with strong similarity to
           the major myo-inositol transporter Itr1p, member of the
           sugar transporter superfamily; expressed constitutively
          Length = 609

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 38/101 (37%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASD 176
           G  +D+FGRRP ++ SNL F++G ++   +   W +              + +  +  S+
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISPLFISE 229

Query: 177 IVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRM 217
           I P   R                         +  KNGWR+
Sbjct: 230 IAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWRI 270

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 7/119 (5%)

Query: 32  EVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASE 91
           ++A+  + LE   E R   Q    SR +L++ +  + LG     L+   + +L+  +A  
Sbjct: 5   KIAKLSNALE---EIRNKCQ---KSRYQLNVNVGLIFLGCTFDLLNVASMISLIDDLAKT 58

Query: 92  FN-ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNL 149
           +N   +  SW  T+Y ++ A F    G++ DI G   L  IS   F +  L+C +  N 
Sbjct: 59  YNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLCAVMPNF 117

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 75  ALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPL-YGKISDIFGRRPLIIISN 133
           A  +  +T  L  ++ +F+  S ++ ++ + ++   +F PL +  +SD+FGRR    +S 
Sbjct: 191 AYGSACITGGLGLVSEKFHVGSEVAILSVSLMVLGFSFGPLLWSPVSDLFGRRVAYFVSM 250

Query: 134 LFFILGCLICGLSKNLWTLV 153
             +++  + C +SKN+ TL+
Sbjct: 251 GLYVIFNIPCAVSKNVQTLM 270

>Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {ON}
           YOL103W (REAL)
          Length = 587

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 38/101 (37%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASD 176
           G  +D+FGRRP ++ SNL F++G ++   +   W +              + +  +  S+
Sbjct: 178 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMGFGVGIGSLISPLFISE 237

Query: 177 IVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRM 217
           I P   R                         +  KNGWR+
Sbjct: 238 IAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWRI 278

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 51  QVSEMSRARLH--IIISSMCLGSFLAALDNTIVTTLLSHIASEF-NELSHISWIATAYLL 107
           Q  +   ++LH    I +  +G  L     T   ++++ IA +F +E S  +W+  ++ L
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 108 SSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
            S +F  + G+  DI+G + ++++      +  +ICGL+
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLT 164

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 40/72 (55%)

Query: 71  SFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLII 130
           SF   LD+ I    +++  + +   S +S +    ++ SA  Q  + ++SD+FGR  L I
Sbjct: 80  SFAYGLDSIIRDIYMTYAMNAYETHSLLSTVNVISMVISAVGQIFFARLSDVFGRLSLFI 139

Query: 131 ISNLFFILGCLI 142
           +S + +++G +I
Sbjct: 140 VSIVLYVVGTVI 151

>TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4.30
           YLL028W
          Length = 615

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 44  DEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIA- 102
           D   + L     +  R  I    +C+     +L ++I    ++ I+ ++  ++ ++ +  
Sbjct: 158 DGPNDPLHPFNWTSRRKFITCCVLCIDCISISLGSSIYAPGVTQISEDYGVITVVAILGV 217

Query: 103 TAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLV 153
           T Y+L  A    LY  +S+++GRR ++++S L F +       ++NL T++
Sbjct: 218 TLYVLGFAASPVLYAPLSELYGRRGVLVLSGLGFAIFQFAVATAENLQTIM 268

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 66/156 (42%), Gaps = 17/156 (10%)

Query: 2   VESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLH 61
           V S   SL Q V      E+        G+     +   ESEDE     Q  E+S A   
Sbjct: 50  VPSSLGSLQQAVSRTRTKEIGSDSGDESGSPSGIKQDGHESEDEG----QPEEVSTAPYT 105

Query: 62  II--------ISSMCLGSFLAALDNTIVTTLLSHIASEF--NELSHISWIATAYLLSSAT 111
           ++        ++ + +  F ++L + I    L  +  EF  NE S ++     YLL    
Sbjct: 106 LLSYSQKWGMVAVLTMCGFWSSLGSPIYYPALRQLEKEFHLNE-SQVNVTVVVYLLFQGI 164

Query: 112 FQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
                G ++D +GRRP+I+   L +++  +  GL++
Sbjct: 165 APTFSGGLADRYGRRPIILGGMLVYVVASI--GLAR 198

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 73/183 (39%), Gaps = 13/183 (7%)

Query: 15  NALNPE-LSEGLPAYVGAEVAETEHLLESEDEAREGLQ-------VSEMSRARLHIIISS 66
           NA  PE  SE      G +  ET  L  S  ++  G +        S  S  +  +++  
Sbjct: 11  NAYRPEGESERDEIGSGPDHGETSGLAVSNSQSEVGNESDFELEPYSRFSHTQKMLLVVQ 70

Query: 67  MCLGSFLAALDNTIVTTLLSHIASEFN---ELSHISWIATAYLLSSATFQPLYGKISDIF 123
                F + +  +I   +L+ I  +FN   EL++++ +   Y +       + G ++D F
Sbjct: 71  CAFTGFFSTVAGSIYYPVLTVIEKKFNITEELANVTIVV--YFVFQGLAPSIMGGLADTF 128

Query: 124 GRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSR 183
           GRRP+++ + L +   C+    S N   ++            V ++ S    D+     R
Sbjct: 129 GRRPVVLWAVLTYCCACIGLASSHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVER 188

Query: 184 ALY 186
             Y
Sbjct: 189 GGY 191

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  +  T  S+  S + + S +S +     + +A  Q  Y + SDIFGR
Sbjct: 76  SIFLVAYAYGLDGQVRYTYQSYATSSYAQHSLLSTVNCITTVIAAAGQICYARASDIFGR 135

Query: 126 RPLIIISNLFFILGCLICGLSKNL 149
             +++I  +F+ +G +I   + N+
Sbjct: 136 MTILVIGVIFYSMGTIIESQATNV 159

>CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103w ITR2 myo-inositol permease minor
          Length = 570

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 68/174 (39%), Gaps = 12/174 (6%)

Query: 69  LGSFLAALDNTIVTTLLSHIASEFN--ELSH----ISWIATAYLLSSATFQPLYGKISDI 122
           L  FL   D   +++ L  I ++ +  EL++    I+  AT+  L +  F  + G   DI
Sbjct: 82  LSGFLFGYDTGYISSALISIGTDLDNKELTYGEKEITTAATS--LGALIFALVAGFSVDI 139

Query: 123 FGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRS 182
           FGR+P ++ SN+ F++G ++   +   W +              + +  +  S+I P   
Sbjct: 140 FGRKPCLMFSNIMFLIGAILQVTAHKFWQMTAGRFIMGFGVGIGSLIAPLYISEIAPKMI 199

Query: 183 RALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIF 236
           R                         +   NGWR    + V L  I  VL  +F
Sbjct: 200 RGRLTVINSLWLTGGQLIAYGCGAGLNHVHNGWR----ILVGLSLIPTVLQFVF 249

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 64/139 (46%), Gaps = 4/139 (2%)

Query: 14  RNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIIS---SMCLG 70
           RN L     EG PA    + AE + L   +D     ++V     +     ++   S+ L 
Sbjct: 15  RNKLKKMSLEGHPAKDAKDHAE-QILARRKDAGVNNIEVYAAQYSHFAYRVALFFSLFLV 73

Query: 71  SFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLII 130
           ++   LD  + ++L ++  S +   S ++ I     + +A  Q  + + SDIFGR  ++ 
Sbjct: 74  AYAYGLDGMVRSSLQAYATSSYGSHSLLATINCVKAVIAAAGQICFARASDIFGRMTILA 133

Query: 131 ISNLFFILGCLICGLSKNL 149
           ++ + + +G +I   + N+
Sbjct: 134 LAVVLYAVGTIIDSQATNI 152

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 53/119 (44%), Gaps = 13/119 (10%)

Query: 41  ESEDEAREGLQVSEMSRARL------------HIIISSMCLGSFLAALDNTIVTTLLSHI 88
            +  E R+G   +   ++RL            +I + S  L   L     T    L   +
Sbjct: 19  SAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVL 78

Query: 89  ASEFN-ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
           + + N ++S   W+  ++ L S +F  + GK+ DI+G +  ++   +  ++  LICGLS
Sbjct: 79  SKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLS 137

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 12/87 (13%)

Query: 265 RIDWLGS----LSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYI 320
           ++DW+GS      L+ F F +  A   G     + S    +L++  +++  AFI  E+  
Sbjct: 245 KMDWIGSAIGVFGLILFNFVWNQAPIAG-----WGSAYIIVLLIVAVVALIAFITYEIRF 299

Query: 321 SDDPILPIRFLTNRS---ILGASFANW 344
           +  P+LP   L NR    IL + F  W
Sbjct: 300 AKQPLLPHSVLFNRKLMMILSSLFFGW 326

>NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84
          Length = 607

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%)

Query: 101 IATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTL 152
           I  A  L +     + G  +DIFGRRP ++ SN+ F++G ++   +   W +
Sbjct: 155 ITAATSLGALITSTMAGTAADIFGRRPCLMFSNVMFVIGAILQITAHKFWQM 206

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 37.4 bits (85), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 25/36 (69%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTL 152
           G  +DI+GR+P ++ISNLFF++G ++   +   W +
Sbjct: 131 GTCADIWGRKPCLMISNLFFVIGAVLQVSASTFWQM 166

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 41/72 (56%)

Query: 71  SFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLII 130
           +F   LD+ I    +++  + ++  S +S ++   L  SA  Q  +  +SD+FGR  + I
Sbjct: 80  AFSYGLDSIIRNIYMTYAMNSYSTHSLLSTVSVISLTISAVAQIFFAGLSDVFGRLSMFI 139

Query: 131 ISNLFFILGCLI 142
           ++ +F+++G +I
Sbjct: 140 VAIMFYVVGTII 151

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 108/285 (37%), Gaps = 23/285 (8%)

Query: 75  ALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNL 134
            LD  I      +  S + E S +S +     + SA  Q +Y ++SD FGR  L +I+ +
Sbjct: 85  GLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFGRFILFVIAIV 144

Query: 135 FFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXX----- 189
            +++G +I   + ++                V  +  +  SD   L+ R  YQ       
Sbjct: 145 LYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLKWRLFYQFAPTWPF 204

Query: 190 -XXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIIIFXXXXXXXXXXXX 248
                              +S     W   F    PL  I ++L +I             
Sbjct: 205 IINTWISGNITLAANPLVHWSWDVGMWAFIF----PLSCIPMLLCMIHMQWKASKTEEWK 260

Query: 249 VSN------DKDG-KVDIKDKLKRIDWLGSLSLVTFLFAFMLASSL-GGKEIPYNSN-IF 299
                    +K G  + +K+   R+D +G L +V +L   ++  +L GG +  +N   I 
Sbjct: 261 ELKKEKSYYEKHGLLLTLKELFWRLDIIGVLLMVAWLGCILVPLTLAGGVKSKWNDGRII 320

Query: 300 KLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSI---LGASF 341
              V+  +L    F   E + + DP++P   + +R +   +G SF
Sbjct: 321 GPFVLGFVLV-PIFAAWEYFFARDPLIPYALIKDRGVWASMGISF 364

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 454 AAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMK 501
           +A  HE+ A  T+I+Y     GS +G +V  A++  KL   +   V +
Sbjct: 475 SATSHENMATVTAINYTCYRLGSAIGAAVSGAIWTQKLYPDILKRVTE 522

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 27/153 (17%), Positives = 55/153 (35%), Gaps = 4/153 (2%)

Query: 69  LGSFLAALDNTIVTTLLSHIASEFNE----LSHISWIATAYLLSSATFQPLYGKISDIFG 124
           +  FL   D   +++ L  I ++ +          +I  A  L +       G  +D+FG
Sbjct: 142 ISGFLFGYDTGYISSALISIGNDLDNRPLTYGDKEFITAATSLGALISSIFAGTAADVFG 201

Query: 125 RRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRA 184
           R+P ++ SNL F++G ++   +   W +              + +  +   +I P + R 
Sbjct: 202 RKPCLMFSNLMFVVGAIVQITAHKFWQMTAGRLVMGFGVGIGSLIAPLYIGEIAPRKIRG 261

Query: 185 LYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRM 217
                                   ++  NGWR+
Sbjct: 262 RLTVINSLWLTGGQLIAYGCGAGLTKVNNGWRI 294

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 56/115 (48%), Gaps = 10/115 (8%)

Query: 32  EVAETEHLLESEDEAREGLQVSE-------MSRARLHIIISSMCLGSFLAALDNTIVTTL 84
           EV E++  LES D+ +      E        S ++  I++  + +  F ++L + I    
Sbjct: 68  EVEESD--LESADDVKTIKDSQEYVAPYTLFSYSQKWIMVGLLTMCGFWSSLGSPIYYPA 125

Query: 85  LSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFIL 138
           L  +  +F+ + + ++     YLL       + G ++DI+GRRP+I+   L +I+
Sbjct: 126 LRQLEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGMLVYIV 180

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%)

Query: 440 GSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSV 499
           G+++      +++ AA  HEH A  T+++Y F   GS +G +V  A++   L   L   V
Sbjct: 482 GTTLFTYPVNVSVQAATSHEHMATVTALNYTFYRIGSAVGAAVSGAIWTQTLYKQLLKRV 541

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 110/281 (39%), Gaps = 17/281 (6%)

Query: 75  ALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNL 134
            LD         +  S + + S +S I     + SA  Q +Y ++SD++GR  L  +S +
Sbjct: 106 GLDGNTRYIYTGYATSSYAQHSLLSTINVINAVISAASQIVYARLSDVYGRFALFCVSIV 165

Query: 135 FFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXX 194
            + +G +I   + ++                V  +  +  SD   LR R +YQ       
Sbjct: 166 LYSVGTIIQSQAYDVQRYAAGSIFYNTGYVGVILVLLLILSDFSSLRWRLVYQFVPTWPF 225

Query: 195 XXXXXXXXXXXXWFSESKN-GWRMAFLVQV-PLCAISLVLIIIFX-XXXXXXXXXXXVSN 251
                         +  KN  W +     + PL  + L+ ++I              +S 
Sbjct: 226 IINTWISGNVTSRANPLKNWSWDIGMWAFIFPLSCVPLLCVMIHMWWLARKTEEWQELSK 285

Query: 252 DKD--GKVDIKDKLK----RIDWLG----SLSLVTFLFAFMLASSLGGKEIPYNSNIFKL 301
           +K    K  +KD +     +ID +G    ++SL   L    LA   G K    NS++   
Sbjct: 286 EKTFYQKHGLKDTIVELFWKIDAMGVFIMTISLGCILVPLTLAG--GTKSKWNNSHVIGP 343

Query: 302 LVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFA 342
            V+  +L     ++ E   + DPI+P + + +R +  ASFA
Sbjct: 344 FVLGFVLIPILVLW-EYKFARDPIIPYKLVKDRGVW-ASFA 382

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 83  TLLSHIASEFNE-LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCL 141
           ++++ ++  FN   S+ +W+  ++ L + +F  + G+I DI+G +  +I   +F I+  L
Sbjct: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131

Query: 142 ICGLS 146
           ICG +
Sbjct: 132 ICGFT 136

>Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W
           (REAL)
          Length = 609

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 44/119 (36%), Gaps = 7/119 (5%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASD 176
           G  +D+FGRRP ++ SNL F++G ++   +   W +              + +  +  S+
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLVMGFGVGIGSLISPLFISE 229

Query: 177 IVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIII 235
           I P   R                         +   NGWR+       L  +SLV  +I
Sbjct: 230 IAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWRI-------LVGLSLVPTVI 281

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 64/158 (40%), Gaps = 2/158 (1%)

Query: 29  VGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHI 88
           +    +  E  L+S + ++E    +  S+ +  II   +    FL  L   I    L  +
Sbjct: 107 IATATSTEETSLKSANRSKEPPPYTAFSKKQRLIIFLVIIYVGFLGPLSGNIYIPALPLL 166

Query: 89  ASEFNELSHISWIATAYLLSSATFQPLYGKI-SDIFGRRPLIIISNLF-FILGCLICGLS 146
              FN  +       +  ++  +  PL+  + +D  GR+ L I+S L   I+  L+  + 
Sbjct: 167 QESFNVSATTINATVSVFMAVFSVGPLFWALFADFGGRKFLYIVSLLLTIIVNILLSAVP 226

Query: 147 KNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRA 184
            N+  L             V SLG  T SDI P +SR 
Sbjct: 227 TNIGALFFLRIAQAFGSSSVMSLGIGTVSDITPPKSRG 264

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 50/113 (44%)

Query: 75  ALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNL 134
            LD  I      +  S +++ S +S I     + SA  Q +Y ++SD+FGR  L I + +
Sbjct: 93  GLDGNIRYIYTGYATSSYSKHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVI 152

Query: 135 FFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQ 187
            +++G +I   + ++                V  +  I  SD   L+ R LYQ
Sbjct: 153 LYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQ 205

>Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W
           (REAL)
          Length = 611

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 23/36 (63%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTL 152
           G  +D+FGRRP ++ SNL F++G ++   +   W +
Sbjct: 172 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQM 207

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 20/126 (15%)

Query: 31  AEVAETEHLLESEDEAREG-------LQVSEMSRARLHII----------ISSMCLGSFL 73
           A   E E  LESE  +  G        Q++  + A   ++          I +MC   F 
Sbjct: 55  ATTREIEGDLESETSSHSGDDKIDPQQQITAETGAPYTLLSYGQKWGMVAILTMC--GFW 112

Query: 74  AALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIIS 132
           ++L + I    L  +  +FN + + I+     YLL       + G ++D FGRRP+I+  
Sbjct: 113 SSLGSPIYYPALRQLEKQFNVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIILAG 172

Query: 133 NLFFIL 138
            L +++
Sbjct: 173 MLIYVV 178

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 47/93 (50%), Gaps = 1/93 (1%)

Query: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQP 114
           S  + +  I +    + L     T V + ++ I+  F+ ++   +W+  ++ L S +F  
Sbjct: 36  SHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFIL 95

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           + G+I DI+G +  +I   +F I+  L+CG + 
Sbjct: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFAD 128

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNE-LSHISWIATAYLLSSATFQP 114
           +R + +  IS+  L   L        T  ++ +A  FN      +W+  ++ L S +F  
Sbjct: 70  NRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFIL 129

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           + G+I DI+G +  +I   L  ++  LICG + 
Sbjct: 130 VSGRIGDIYGLKKTLIGGYLVVLIWSLICGFAN 162

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNE-LSHISWIATAYLLSSATFQP 114
           S  + +I +++  + + L     + V + ++ I+  F+      +W+  ++ L S +F  
Sbjct: 71  SSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFIL 130

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           + G++ DI+G + ++I   +F I+  LICG + 
Sbjct: 131 ISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTN 163

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 48/93 (51%), Gaps = 1/93 (1%)

Query: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELS-HISWIATAYLLSSATFQP 114
           S+ + +  I +  + + L     T V + ++ I+  F+  S   +W+  ++ L S +F  
Sbjct: 58  SKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFIL 117

Query: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           + G+I DI+G +  +I   +F I+  L+CG + 
Sbjct: 118 ISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFAD 150

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 66/174 (37%), Gaps = 7/174 (4%)

Query: 13  VRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSF 72
           + N L+ E      AY      E + + E      E +  ++ ++A+  +I   +    F
Sbjct: 91  IENKLSNEF-----AYSTETEIEKQSVPEQAVPITEEIPYTKFTKAQQFVIFCIIVYIGF 145

Query: 73  LAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPL-YGKISDIFGRRPLIII 131
           L  +   I    L  +  EF   +       +  +    F PL +G  +D  GR+ L II
Sbjct: 146 LGPMCGNIYIPALPILQEEFQVTTTTINGTVSIFMGLFAFMPLVWGMFADFGGRKFLYII 205

Query: 132 SNLFF-ILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRA 184
           S   F +   L+  L  N+  L               SLG+ T +DI P + R 
Sbjct: 206 SLFIFTVANILLASLPANIIALYLVRVLQVVGASAAISLGTGTVADISPPKHRG 259

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 79  TIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFIL 138
           +I+  L     SE N  S   W+  ++ L S +F  + G++ DI+G + ++++  +  I+
Sbjct: 94  SIMNILSDSFGSEGNSKS---WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150

Query: 139 GCLICGLSK 147
             LICG++ 
Sbjct: 151 WSLICGITN 159

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 440 GSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSV 499
           G+++      +++ AAV HE+ A  T+ +Y     GS +G +V  A++   L   L+  +
Sbjct: 466 GTTLFTYPVTVSVQAAVSHENMATVTAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHL 525

Query: 500 --MKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYE--QACKSTFAFCFL 555
             +   +  YS  Y          ++ Y     P+  +  ++Q Y   Q  ++  A  F 
Sbjct: 526 QDIALATAAYSSPYTF--------TTNYAWGTPPE--REAVVQAYRYVQRLETVVALVFC 575

Query: 556 ISIFAWISC 564
           + + A+  C
Sbjct: 576 VPLIAFSLC 584

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%)

Query: 71  SFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLII 130
           SF   LD+ I    +++  + +   S +S +    +  SA  Q  +  +SD+FGR  + I
Sbjct: 82  SFSYGLDSIIRNIYMTYAMNNYETHSLLSTVNVISMTISAVAQIFFAGLSDVFGRLSIFI 141

Query: 131 ISNLFFILGCLI 142
           ++ +F+++G +I
Sbjct: 142 VTIVFYVVGTII 153

>TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa]
           {ON} 
          Length = 575

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 60/135 (44%), Gaps = 17/135 (12%)

Query: 32  EVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCL----GSFLAALDNTIVTTLLSH 87
           E    E+ LE  D++   +++ +   A  +I +  MCL    G F+   D   +   ++ 
Sbjct: 39  EFKNDEYPLEQSDDSPSQIEIPK-KPASAYISVCVMCLMVAFGGFINGWDIGTIGGFVAQ 97

Query: 88  --IASEFNELS-----HISWIATAYLLS-----SATFQPLYGKISDIFGRRPLIIISNLF 135
                 F  L+     ++S + T  L++      A      G++ D++GRR  +I++ + 
Sbjct: 98  TDFVKRFGSLNSNGEPYLSKVRTGLLVAIFNIGCAIGSVTLGRVGDVYGRRLGLIMATII 157

Query: 136 FILGCLICGLSKNLW 150
           F+ G +I   S + W
Sbjct: 158 FVAGVVIQIASTDKW 172

>KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {ON}
           weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 611

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 1/114 (0%)

Query: 72  FLAALDNTIVTTLLSHIASEFNE-LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLII 130
           F+     +I+      +A EF+  LS IS++    +L+ A    +    + IFG+R + +
Sbjct: 93  FVGGGQTSILAAGSKGLALEFHRSLSDISYLVGGMMLALALGSIIASPCAVIFGKRIVYL 152

Query: 131 ISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRA 184
           +  + F  G + C +S+N  +L+            + SL S T ++I     RA
Sbjct: 153 VGIIIFFFGSIGCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERA 206

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKISDIFG 124
           +MC   F ++L + I    L  +  +F  + + ++     YLL       + G ++D+FG
Sbjct: 97  TMC--GFWSSLGSPIYYPALRQLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFG 154

Query: 125 RRPLIIISNLFFILGCL 141
           RRP+I+I  L +++  +
Sbjct: 155 RRPVILIGMLIYVVASI 171

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 44/79 (55%), Gaps = 5/79 (6%)

Query: 73  LAALDNTIVTTLLSHIASEFNELSHI--SWIATAYLLSSATFQPLYGKISDIFGRRPLII 130
           LA++   IV  L++ I + FN +SH    W  T+Y+++ A F   +G++ DI G   ++ 
Sbjct: 36  LASVGAMIV--LVTDIETRFN-VSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMC 92

Query: 131 ISNLFFILGCLICGLSKNL 149
           + ++ F +  L+C +  N 
Sbjct: 93  VFSVIFGIFSLLCAVVPNF 111

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 54  EMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATF 112
           + S   L++ ++ + LG  +  ++ + + +L+  ++++++   +  SW  T+Y ++ A F
Sbjct: 21  QTSTVNLNVNVALIFLGCSIDLINVSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGF 80

Query: 113 QPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNL 149
               G++ DI G   L  +S   F +  L+CGL  N 
Sbjct: 81  IAFMGRLGDIVGNSRLFTVSCGCFAILSLLCGLMPNF 117

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 68/154 (44%), Gaps = 21/154 (13%)

Query: 9   LLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSE-------------M 55
           L +PV         + LP    + V  T  + ES  ++R+ ++ S              +
Sbjct: 22  LEKPVLGLEGDNTKKLLPQDAASRVT-TREMRESSSDSRDRVESSGVNSKLPQGAPFTLL 80

Query: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN---ELSHISWIATAYLLSSATF 112
           S  +   +++ +    F ++L + I    L  +  +FN   E+ +I+     YL+     
Sbjct: 81  SHGQKWFMVALLTSAGFWSSLGSPIYYPALKQLEKKFNVSEEMVNIT--VVVYLIFQGIA 138

Query: 113 QPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
             + G ++D++GRRP+I++  L ++  C   GL+
Sbjct: 139 PTISGGLADVYGRRPVILMGMLIYV--CASIGLA 170

>TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa]
           {ON} Anc_3.84 YDR497C
          Length = 638

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 45/119 (37%), Gaps = 7/119 (5%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASD 176
           G  +D+FGR+P ++ SN+ F++G ++   S   W +              + +  +  S+
Sbjct: 198 GTAADVFGRKPCLMFSNVMFVVGAILQISSHTFWQMCAGRLIMGFGVGIGSLISPLFISE 257

Query: 177 IVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIII 235
           I P   R                        F+   NGWR+       L  +SL+  +I
Sbjct: 258 IAPKMIRGRLTVINSLCLTGGQLIAYGCGAGFNYVNNGWRI-------LVGLSLIPTVI 309

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  I  T  +   S ++E S +S +     + +A  Q  + + SDIFGR
Sbjct: 72  SLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGR 131

Query: 126 RPLIIISNLFFILGCLICGLSKNL 149
             ++ +S +F+I+G +I   + N+
Sbjct: 132 LTILGVSIIFYIIGTVIESQATNV 155

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 4/116 (3%)

Query: 35  ETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN- 93
           +  +L ++  E R   Q S     +L++ +  + LG     L+   + +L+  +A ++N 
Sbjct: 5   KIANLTKALQEIRNKCQKSPY---QLNVNVGLIFLGCTFDLLNVASMISLIDDLAKKYNI 61

Query: 94  ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNL 149
             +  SW  T+Y ++ A F    G++ DI G   L  IS   F +  L+C +  N 
Sbjct: 62  SYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMPNF 117

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 440 GSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSL 495
           GS+       +++ AAV HE  A  ++++Y F   GS +G +V  A++  KL   L
Sbjct: 458 GSTFFTYPVTVSVQAAVSHEQMATVSALNYTFYRIGSAVGAAVSGAIWTQKLYKKL 513

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 50/113 (44%)

Query: 75  ALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNL 134
            LD+ I      +  S ++E S +S +     + SA  Q +Y ++SD FGR  L +++ +
Sbjct: 82  GLDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIVYARLSDAFGRFRLFVVAIV 141

Query: 135 FFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQ 187
            + +G +I   + ++                V  +  +  SD+  LR R  YQ
Sbjct: 142 LYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILSDMSTLRWRLFYQ 194

>TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON} 
          Length = 542

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 73/186 (39%), Gaps = 15/186 (8%)

Query: 59  RLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHI------SWIATAYLLSSATF 112
           R  +II  M L S +  + ++I T     I  EFN + H+      S     Y L    F
Sbjct: 97  RTAVIIQVMLLTS-VTYMGSSIYTPGQEQIQQEFN-VGHVVGTLNLSMYVLGYGLGPIFF 154

Query: 113 QPL--YGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLG 170
            PL  + KI    GR+PL II+   F +  +   L KN+  LV              + G
Sbjct: 155 SPLSEFAKI----GRQPLYIITFFLFAMLQIGTALVKNIAGLVILRFITGILCSPSLATG 210

Query: 171 SITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISL 230
             T  DIVP     L+                       ++K+ WR  F + + L + +L
Sbjct: 211 GATVGDIVPPDYVPLFIGLWSVGAVSAPVVGPLLGAAMVDAKD-WRWIFWLLMWLASATL 269

Query: 231 VLIIIF 236
           ++++ F
Sbjct: 270 IVLVFF 275

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%)

Query: 99  SWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           +W+  ++ L S +F  + G+I DI+G +  +I   LFFI+  LI G + 
Sbjct: 115 TWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTD 163

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKIS 120
           + I +MC   F ++L + I    L  +  +FN + + ++     YLL       + G ++
Sbjct: 103 VAILTMC--GFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLA 160

Query: 121 DIFGRRPLIIISNLFFIL 138
           D FGRRP+I+   L +++
Sbjct: 161 DCFGRRPIILAGMLIYVI 178

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 99  SWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147
           +W+  ++ L S +F  + G++ DI+G +  ++  N+FFI+  LI G + 
Sbjct: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTN 156

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 67  MCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           MC   F ++L + I    L  +  EFN + + ++     YLL       + G ++D+FGR
Sbjct: 109 MC--GFWSSLGSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGR 166

Query: 126 RPLIIISNLFFILGCL 141
           RP+I+   + +++  +
Sbjct: 167 RPIILGGMVIYVVASI 182

>ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 649

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 52/116 (44%), Gaps = 1/116 (0%)

Query: 63  IISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATA-YLLSSATFQPLYGKISD 121
           I+  +   S +  +  +I+   +  I  +F+  S +  ++   Y +S   F   +  IS+
Sbjct: 93  IVFVIAFSSMMGPMATSIIFPSIHEIEKDFSTTSMVVNVSVGVYQISLGVFPLWWSSISE 152

Query: 122 IFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDI 177
           + GRR + ++S +  +   + C LS N+   +            V S+G+ T SD+
Sbjct: 153 MNGRRTVYVVSFMLLLGFNIGCALSPNIGAFIALRFLSGAASASVQSVGAGTVSDL 208

>NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {ON}
           Anc_3.84
          Length = 587

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTL 152
           G  +DIFGR+P ++ SN+ F++G ++   +   W +
Sbjct: 148 GTAADIFGRKPCLMFSNVLFVIGAILQITAHRFWQM 183

>KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3.84
           YDR497C
          Length = 618

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/153 (17%), Positives = 56/153 (36%), Gaps = 4/153 (2%)

Query: 69  LGSFLAALDNTIVTTLLSHIASEFN----ELSHISWIATAYLLSSATFQPLYGKISDIFG 124
           +  FL   D   +++ L  I ++ +       +   +  A  L +     + G  +D++G
Sbjct: 129 ISGFLFGYDTGYISSALISIGTDLDGRVLTYGNKEIVTAATSLGALISSTMAGTAADMYG 188

Query: 125 RRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRA 184
           R+P I+ SN+ F++G ++   +   W +              + +  +  S+I P   R 
Sbjct: 189 RKPCIMFSNIMFLVGAILQVSAHKFWQMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRG 248

Query: 185 LYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRM 217
                                  F+   NGWR+
Sbjct: 249 RLTVINSLWLTGGQLIAYGLGAAFNHVNNGWRI 281

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%)

Query: 74  AALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISN 133
           A L  +IV   +   +        +SW A+A+ L+  TF  + G++ D FG +   ++  
Sbjct: 45  AGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGF 104

Query: 134 LFFILGCLICGLS 146
           L++ L  ++ G S
Sbjct: 105 LWYALWSILAGFS 117

>SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {ON}
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1
          Length = 578

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 44/119 (36%), Gaps = 7/119 (5%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASD 176
           G  +D+FGR+P I+ SNL F++G ++   +   W +              + +  +  S+
Sbjct: 129 GVSADLFGRKPCIMFSNLLFVIGAILQVSAHTFWQMAIGRLVMGFGVGIGSLISPLFISE 188

Query: 177 IVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGWRMAFLVQVPLCAISLVLIII 235
           I P   R                          +  NGWR+       L  +SL+  +I
Sbjct: 189 IAPKMIRGRLTVVNSLCLTGGQLIAYACGAGLDKVHNGWRI-------LVGLSLIPTVI 240

>KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1 Myo-inositol transporter with strong
           similarity to the minor myo-inositol transporter Itr2p,
           member of the sugar transporter superfamily; expression
           is repressed by inositol and choline via Opi1p and
           derepressed via Ino2p and Ino4p
          Length = 608

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/217 (17%), Positives = 79/217 (36%), Gaps = 7/217 (3%)

Query: 17  LNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMC--LGSFLA 74
           + P+++ G     GA + +   +    DE    + ++   +    II+ +    +  F+ 
Sbjct: 55  IEPDVTNGKLDADGALLDDRIQIRPVNDEDDTSVMITFNQKVSPFIIVLTFVASISGFMF 114

Query: 75  ALDNTIVTTLLSHIASEFNELS----HISWIATAYLLSSATFQPLYGKISDIFGRRPLII 130
             D   +++ L  I ++ +  +        I  A  L +       G  +DI+GR+P ++
Sbjct: 115 GYDTGYISSALVSIGTDLDHRALTYGDKEIITAATSLGALISSIFAGTSADIWGRKPCLM 174

Query: 131 ISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXX 190
            SNL F +G ++   +++ W +              + +  +   +I P   R       
Sbjct: 175 FSNLLFTVGAVLQISARSFWQMAVGRLIMGFGVGIGSLISPLFIGEIAPKNIRGRLVVIN 234

Query: 191 XXXXXXXXXXXXXXXXWFSESKNGWR-MAFLVQVPLC 226
                              +  NGWR +  L  +P C
Sbjct: 235 SLCLTGGQLVAYGCGAGLDKVHNGWRILVGLSLIPTC 271

>KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 56/133 (42%), Gaps = 4/133 (3%)

Query: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEF--NELSHISWIATAYLLSSATFQ 113
           ++++L +++     G F +++   I   +LS I ++F  NE   ++     Y +      
Sbjct: 76  TKSKLGLVVQCAFTG-FFSSIAGAIYYPVLSVIENKFHINE-EQVNMTVVVYFIFQGLSP 133

Query: 114 PLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSIT 173
            L G ++D  GRRP+I+ S + +   C+    S N   ++            V ++ S  
Sbjct: 134 TLMGGLADSLGRRPVILCSVIIYFCACIGLACSNNYAQVIALRCLQAAGISPVIAINSGM 193

Query: 174 ASDIVPLRSRALY 186
             D+     R  Y
Sbjct: 194 MGDVTTKAERGGY 206

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 57/116 (49%), Gaps = 13/116 (11%)

Query: 40  LESEDEAREGLQVSE------MSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN 93
           +E  D A +   + +      +S A+   +++ +    F ++L + I    L  +  +F+
Sbjct: 59  IEGHDIAHDNAPLPQHAPYTLLSNAQKWCMVALLTSAGFWSSLGSPIYYPALKQLEKQFS 118

Query: 94  ---ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
              EL +I+ +   YL+       + G ++D++GRRP+I+I  L ++  C   GL+
Sbjct: 119 VSEELVNITVVV--YLIFQGVAPTISGGLADVYGRRPVILIGMLIYV--CASIGLA 170

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 58/139 (41%), Gaps = 23/139 (16%)

Query: 7   TSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAR---------EGLQVSEMSR 57
           TS +   +NA++P L EG  +       E EHL    DE R         E   V  M+ 
Sbjct: 684 TSGIDANKNAIHPALEEGSGSVPSVTQREWEHLAGHRDEIRTLLKDSVSQEHETVGSMNT 743

Query: 58  ARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEF---NELSHISWIATAYLLSSATFQP 114
             LH        G + A L + I T L ++  ++    + ++  S+     +L S TF+ 
Sbjct: 744 RLLHNRFKD---GPYYAQLSHDIATILTNYATAQMELPSSMNSASFPQQLSILCSRTFKN 800

Query: 115 LYGKISDIFGRRPLIIISN 133
           +Y        R P ++++N
Sbjct: 801 IY--------RNPKLLLAN 811

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKIS 120
           + I +MC   F ++L + I    L  +  +FN + + ++     YLL       + G ++
Sbjct: 102 VAILTMC--GFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLA 159

Query: 121 DIFGRRPLIIISNLFFIL 138
           D FGRRP+I+   L +++
Sbjct: 160 DCFGRRPIILAGMLIYVV 177

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKIS 120
           + + +MC   F ++L + I    L  +  EFN + + I+     YL+       + G ++
Sbjct: 103 VAVLTMC--GFWSSLGSPIYYPALRQLEKEFNVDENMINITVVVYLMFQGIAPTVCGGLA 160

Query: 121 DIFGRRPLIIISNLFFIL 138
           D FGRRP+I+   L +++
Sbjct: 161 DCFGRRPIILGGMLVYVV 178

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 61/132 (46%), Gaps = 16/132 (12%)

Query: 34  AETEHLLESEDE--------AREGLQVSEMSRAR-LHIIISSMCL---GSFLAA----LD 77
           AE  H  E  DE        A   L + +M   R  +  + ++C+    +FLA     L+
Sbjct: 39  AEENHKQELLDEYGVPDKLRANRSLVIRKMEIMRKQYTSVFAICVFLFTAFLAGVGTDLN 98

Query: 78  NTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFI 137
           + +     ++  + +   S +S I     + SA    +Y ++SD+FGR  L + + LFF+
Sbjct: 99  SQLRNNYTTYATNSYRSHSLLSTIGVVSSIISAGALTVYARLSDVFGRIRLYLSAMLFFV 158

Query: 138 LGCLICGLSKNL 149
           +G +I   + N+
Sbjct: 159 VGTIIQSQANNV 170

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%)

Query: 439 FGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDS 498
            GS+++   T+++  +   HE+ A  T+I  A    G  +G +V  A++   L   L ++
Sbjct: 471 LGSTMITRTTVISSQSITAHENMATITAIMLAISRIGGGIGSAVSGAIWTQTLYAKLVET 530

Query: 499 VMKFESDKYSKEYLLSIIK 517
           +   E  K   +  LS I+
Sbjct: 531 IGDPEIAKKVYQSPLSAIR 549

>KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively
          Length = 569

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 33/182 (18%), Positives = 68/182 (37%), Gaps = 4/182 (2%)

Query: 40  LESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHI- 98
           +  ED+    +  ++     + I+  +  +  F+   D   +++ L  I ++ +  +   
Sbjct: 41  VNDEDDTSVMITFNQKISPFILILTFTASISGFMFGYDTGYISSALVSIGTDLDNKALTY 100

Query: 99  --SWIATAYLLSSATFQPLYGKIS-DIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXX 155
               I TA     A    ++  IS DIFGR+P ++ SN+ F++G  +   + + W +   
Sbjct: 101 GDKEIITAATSLGALISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFWQMAVG 160

Query: 156 XXXXXXXXXXVTSLGSITASDIVPLRSRALYQXXXXXXXXXXXXXXXXXXXWFSESKNGW 215
                      + L  +  S+I P   R                         ++  NGW
Sbjct: 161 RLIMGFGVGIGSLLAPLFISEIAPKHIRGRLTVINSLWLTGGQLIAYACGAGLNKVHNGW 220

Query: 216 RM 217
           R+
Sbjct: 221 RI 222

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 41/77 (53%)

Query: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125
           S+ L ++   LD  +     ++  + +   S +S +     + +A  Q  + + +DIFGR
Sbjct: 49  SLFLVAYAYGLDGMVRYNFQAYATNSYGSHSLLSTVNCIKAVIAAAGQLCFARAADIFGR 108

Query: 126 RPLIIISNLFFILGCLI 142
             +II+S LF+++G +I
Sbjct: 109 ISIIIVSILFYVVGTII 125

>CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1
          Length = 577

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 67  MCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIA-TAYLLSSATFQPLYGKISDIFGR 125
           +CL      + ++I  T +  I   ++ +  ++ +  T Y+L  A    +Y  +S+I+GR
Sbjct: 143 LCLNCISITMGSSIFATGIRQICEIYHVIPVVAILGITLYVLGFAASPVIYAPLSEIYGR 202

Query: 126 RPLIIISNLFFILGCLICGLSKNLWTLV 153
           R +++IS+  F L       +K+L T++
Sbjct: 203 RGVLVISSFGFALFNFAVATAKDLQTIM 230

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 51/108 (47%), Gaps = 6/108 (5%)

Query: 41  ESEDEAREGLQVSEM------SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNE 94
           E   E   G+  SE+      S  R  I+   +    +   LDN + +   +   S + +
Sbjct: 39  EPHLEESAGVYNSEVYAKYYSSPTRRSIVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQ 98

Query: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLI 142
            S +S +     + SA  Q  + + SD+FGR  ++I++ +F+++G ++
Sbjct: 99  HSLLSTVNAIKSVISAAGQIWFARASDLFGRGTILIVAVMFYVVGTIV 146

>NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa]
           {ON} Anc_4.30
          Length = 567

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 67  MCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIA-TAYLLSSATFQPLYGKISDIFGR 125
           +CL     ++ ++I  + +  I   +  +  ++ +  T Y+L  A    +Y  +S+I+GR
Sbjct: 133 LCLNCICISMGSSIFASAVPQICEIYGVIQVVAILGVTLYVLGFAISPIVYAPLSEIYGR 192

Query: 126 RPLIIISNLFFILGCLICGLSKNLWTLV 153
           R +++IS+  F L       ++NL T++
Sbjct: 193 RGVLVISSFGFCLFQFAVATAENLQTIM 220

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 66/177 (37%), Gaps = 6/177 (3%)

Query: 15  NALNPELSEGLPAYVGAEVAETEHLLESEDEARE----GLQVSEMSRARLHIIISSMCLG 70
           N    EL+E + +Y   E A+   L  +E    E        S  SR+   ++I+     
Sbjct: 34  NDFEDELAESIRSY-NKETADKLSLHRTESVKPEPEITAPPHSRFSRSFKTVLIAQCAFT 92

Query: 71  SFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQP-LYGKISDIFGRRPLI 129
            F + +   I   +LS I  +FN    +  +            P L G  +D  GRRP++
Sbjct: 93  GFFSTIAGAIYYPVLSVIERKFNIDEQLVNVTVVVYFVFQGLAPTLMGGFADSLGRRPVV 152

Query: 130 IISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALY 186
           +I+ + +   C+    ++    ++            V ++ S    DI     R  Y
Sbjct: 153 LIAIIIYFGACVGLACTQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAERGGY 209

>KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {ON}
           Anc_3.84 YDR497C
          Length = 577

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 45/88 (51%), Gaps = 4/88 (4%)

Query: 69  LGSFLAALDNTIVTTLLSHIASEFN--ELSH--ISWIATAYLLSSATFQPLYGKISDIFG 124
           +  F+   D   +++ L  I ++ +  EL++    +I  A  L +       G  +D++G
Sbjct: 89  ISGFMFGYDTGYISSALVSIGTDLDNKELTYGDKEFITAATSLGALISSIFAGVAADMYG 148

Query: 125 RRPLIIISNLFFILGCLICGLSKNLWTL 152
           R+P ++ SN+ F++G ++   + N W +
Sbjct: 149 RKPCLMFSNVMFLIGAILQISASNFWQM 176

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 12/126 (9%)

Query: 67  MCLGSFLAALDNTIVTTLLS--HIASEFNELSH------ISWIATAYLLSSATFQPLYGK 118
           + LG FL   D  +++  L+  +  + FN  S       +S +    L+SS     L G+
Sbjct: 112 VSLGVFLFGYDQGVMSGCLTGHYFKNHFNNPSRAAIGNMVSILEIGALVSSL----LVGR 167

Query: 119 ISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIV 178
           + + +GRR  I   +L F++G L  G +  +  L+            ++++  I  S+I 
Sbjct: 168 LGEKWGRRRTIKYGSLIFVIGGLFQGFADKMMHLIIGRTISGLGVGLLSTIVPIYQSEIS 227

Query: 179 PLRSRA 184
           P  +R 
Sbjct: 228 PPHNRG 233

>Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W
           (REAL)
          Length = 542

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 34/180 (18%), Positives = 71/180 (39%), Gaps = 8/180 (4%)

Query: 13  VRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQV---SEMSRARLHIIISSMCL 69
           ++N +  EL+E + +Y    V +      +  +    + V   S  SR+   ++I+    
Sbjct: 10  LKNDIEGELAESMQSYKTETVDKQALQRTTSVKPEPDITVPPHSRFSRSFKTVLIAQCAF 69

Query: 70  GSFLAALDNTIVTTLLSHIASEFN---ELSHISWIATAYLLSSATFQPLYGKISDIFGRR 126
             F + +   I   +LS I  EF+   +L +I+ +   Y +         G  +D  GRR
Sbjct: 70  TGFFSTIAGAIYYPVLSVIEGEFDIDEQLVNITVVV--YFVFQGLAPTFMGGFADSLGRR 127

Query: 127 PLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALY 186
           P+++ + + +   C+    ++    ++            V ++ S    DI     R  Y
Sbjct: 128 PVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAERGGY 187

>NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa]
           {ON} Anc_3.84
          Length = 602

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTL 152
           G  +D+FGR+P ++ SN+ FI+G ++   +   W +
Sbjct: 159 GTAADVFGRKPCLMFSNVMFIIGAILQISAHKFWQM 194

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 61/141 (43%), Gaps = 17/141 (12%)

Query: 27  AYVGAEVAETEHLLESEDEAREGLQVSEMSR-ARLHIIISSMCL----GSFLAALDNTIV 81
           +++  E  + ++++   D + + L V    + A  +I +  +CL    G F+   D   +
Sbjct: 19  SFLSNESNKKDNVIIELDSSNQELPVEIPKKPASAYITVVIICLMVAFGGFVFGWDTGTI 78

Query: 82  TTLLSH--IASEFNELS----------HISWIATAYLLSSATFQPLYGKISDIFGRRPLI 129
           +  L+       F EL               + + + L  A    L+ K+ D +GRR  +
Sbjct: 79  SGFLAQTDFLRRFGELQADGTYAFSNIRTGLVVSIFCLGCAIGGILFSKLGDTYGRRIAL 138

Query: 130 IISNLFFILGCLICGLSKNLW 150
           +I  L +++G +IC  + + W
Sbjct: 139 VIVTLVYMVGIVICISANSKW 159

>ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON}
           similar to uniprot|O43081 Schizosaccharomyces pombe
           SPBC947 SPBC947.06c protein and weakly similar to
           YHR048W uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 508

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 58/125 (46%), Gaps = 15/125 (12%)

Query: 30  GAEVAETEHLLESEDEAREG---LQVSE--------MSRARLHIIISSMCLGSFLAALDN 78
           G  V + EHLL+   E+      ++ SE         SR +     +   L +F A  ++
Sbjct: 22  GGNVLDKEHLLDMSSESNTNSLLVEFSEGDPGSPFNWSRGKKLWHTAIYGLATFSAQFNS 81

Query: 79  TIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPL-YGKISDIFGRRPLI---IISNL 134
           T  +  +SH+   FN     + +AT+  +    F P+ +  +S+++GR+  I   ++ ++
Sbjct: 82  TTTSPSVSHLGEYFNVSREKALLATSLYVLGIAFGPMFFAPLSEMYGRKIAIFGSLLVSM 141

Query: 135 FFILG 139
            F LG
Sbjct: 142 VFTLG 146

>Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 83/198 (41%), Gaps = 14/198 (7%)

Query: 1   MVES-DRTSLLQP-VRNALNPELSEGLPAYVGAEV--AETEHLLESED--------EARE 48
           M ES DR +  +P  ++ + PE S   P+    ++   E E  + S +        E + 
Sbjct: 38  MNESWDRVNEGKPNAKSEIVPEQSHSSPSISAQKINTKEEEIAIRSSNSQSKNLSPEPKA 97

Query: 49  GLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLS 108
            +  +  S+ R  +I   +    FL  +   I    L  +  EF+  S       +  ++
Sbjct: 98  DIPYTYFSKDRRLVIFGIIIFIGFLGPMSGNIYIPALPLLQREFDVSSTTINATVSAFMA 157

Query: 109 SATFQPLY-GKISDIFGRRPLIIIS-NLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXV 166
             +  PL+ G ++D  GR+ L ++S +L   +  L+  +  N+  L             V
Sbjct: 158 VFSVGPLFWGALADFGGRKFLYMVSLSLMLTVNILLAAVPANIAALFVLRVFQAFSSSSV 217

Query: 167 TSLGSITASDIVPLRSRA 184
            SLG+ T +D+VP + R 
Sbjct: 218 ISLGAGTVTDVVPPKHRG 235

>NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 18/132 (13%)

Query: 37  EHLLESEDEAREGLQVSEMSR--ARLHIIISSMCL----GSFLAALDNTIVTTLLSHI-- 88
           E   +S+D      Q+ E+ +  A  ++ +  MCL    G F++  D   +   LSH   
Sbjct: 28  EMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDY 87

Query: 89  -----ASEFNELSHISWIATAYLLS-----SATFQPLYGKISDIFGRRPLIIISNLFFIL 138
                +S  +   ++S + T  L+S      A    + G++ D  GRR  I+I+   +I+
Sbjct: 88  INRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIV 147

Query: 139 GCLICGLSKNLW 150
           G +I   S + W
Sbjct: 148 GIVIQIASIDKW 159

>Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W
           (REAL)
          Length = 591

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 34/180 (18%), Positives = 71/180 (39%), Gaps = 8/180 (4%)

Query: 13  VRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQV---SEMSRARLHIIISSMCL 69
           ++N +  EL+E + +Y    V +      +  +    + V   S  SR+   ++I+    
Sbjct: 34  LKNDIEGELAESMQSYKTETVDKQALQRTTSVKPEPDITVPPHSRFSRSFKTVLIAQCAF 93

Query: 70  GSFLAALDNTIVTTLLSHIASEFN---ELSHISWIATAYLLSSATFQPLYGKISDIFGRR 126
             F + +   I   +LS I  EF+   +L +I+ +   Y +         G  +D  GRR
Sbjct: 94  TGFFSTIAGAIYYPVLSVIEGEFDIDEQLVNITVVV--YFVFQGLAPTFMGGFADSLGRR 151

Query: 127 PLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIVPLRSRALY 186
           P+++ + + +   C+    ++    ++            V ++ S    DI     R  Y
Sbjct: 152 PVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAERGGY 211

>KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {ON}
           Anc_4.30 YLL028W
          Length = 589

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 64/143 (44%), Gaps = 10/143 (6%)

Query: 19  PELSEGLPAYVGAEVAETEHLLESEDE-------AREGLQVSEMSRARLHIIISSMCLGS 71
           P   EGLP     +      LL ++++         + L     S AR  I    +CL  
Sbjct: 102 PPSYEGLPPM--GDNRPYPPLLPNKEQYEVTFNGPDDPLHPFNWSLARKIIPCFILCLNC 159

Query: 72  FLAALDNTIVTTLLSHIASEFNELSHISWIA-TAYLLSSATFQPLYGKISDIFGRRPLII 130
               L + I  + +  I +EF+ +  ++ +  T Y+L  A    ++  +S+++GR+ +++
Sbjct: 160 ICITLGSAIYASGVLQICAEFHIIQVVAILGITLYVLGFAASPVIFAPLSEVYGRKGVLV 219

Query: 131 ISNLFFILGCLICGLSKNLWTLV 153
           +S   F +       +K+L TL+
Sbjct: 220 VSAFGFTIFNFAVATAKDLQTLL 242

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 75/170 (44%), Gaps = 23/170 (13%)

Query: 4   SDRTSLLQPVRNALNPELSEGLPAYVGAE-VAETEHLLESEDEARE----GLQVSEMSR- 57
           ++ TS+  P   + N   ++  P+  G+  + E +     +DE ++     +   EM + 
Sbjct: 2   NNETSVADPAVGSQNVNDNDLAPSDSGSHSILENQSNKGEDDEMKDFGDNEIAPHEMPKK 61

Query: 58  -ARLHIIISSMCL----GSFLAALDNTIVTTLLSHIA--SEFNELSH-----ISWIATAY 105
            A  ++ +S +CL    G ++   D   ++  +S       F +  H     +S + T  
Sbjct: 62  PASEYVTVSILCLMIAFGGYVYGWDTGTISGFVSQTDWIRRFGQKHHDGTHYLSKVRTGL 121

Query: 106 LLS-----SATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLW 150
           LL+      A    L+ ++ DI+GRR  ++   + +++G +I   S + W
Sbjct: 122 LLAIFNIGCAIGGLLFSRLGDIYGRRKALVFVTVVYMVGLIISIASIDKW 171

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 26/137 (18%), Positives = 57/137 (41%), Gaps = 5/137 (3%)

Query: 53  SEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN---ELSHISWIATAYLLSS 109
           S  S  +  +++       F + +  +I   +L+ I  +FN   EL++++ +   Y +  
Sbjct: 61  SRFSHKQKMLLVVQCAFTGFFSTVAGSIYYPVLTIIERKFNITEELANVTIVV--YFIFQ 118

Query: 110 ATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSL 169
                + G ++D FGRRP+++ + L +   C+    + N   ++            V ++
Sbjct: 119 GVAPSIMGGLADTFGRRPIVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAI 178

Query: 170 GSITASDIVPLRSRALY 186
            S    D+     R  Y
Sbjct: 179 NSGIMGDVTTKVERGGY 195

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%)

Query: 75  ALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNL 134
            LD  +  T  +   S FN  S  S +     ++S+  Q  + + SDIF R   ++IS L
Sbjct: 90  GLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWFARASDIFSREFSMVISIL 149

Query: 135 FFILGCLI 142
           F+++G +I
Sbjct: 150 FYVVGTII 157

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 52/128 (40%), Gaps = 5/128 (3%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFN---ELSHISWIATAYLLSSATFQPLYGK 118
           I++       F +++   I   +LS I +EFN   E+ +I+ +   Y +       + G 
Sbjct: 79  ILVIQCAFTGFFSSIAGAIYYPVLSVIENEFNITEEMVNITVVV--YFIFQGIAPSIMGG 136

Query: 119 ISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITASDIV 178
           ++D  GRRP+++ S L +   C+    S     ++            V ++ S    DI 
Sbjct: 137 LADSMGRRPVVLSSVLVYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDIT 196

Query: 179 PLRSRALY 186
               R  Y
Sbjct: 197 TRAERGGY 204

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/104 (20%), Positives = 50/104 (48%), Gaps = 5/104 (4%)

Query: 41  ESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN---ELSH 97
           E+ D+       + M+  +   +++ +  G F ++L + I    L  +   FN   E+ +
Sbjct: 77  ETPDKVSCETPYTLMTHGQKWFMVALLTSGGFWSSLGSPIYYPALKQLEQVFNINEEMVN 136

Query: 98  ISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCL 141
           I+ +   Y +       + G ++D++GRRP+I+   L +++  +
Sbjct: 137 ITVVV--YFIFQGVAPTISGGLADVYGRRPIILAGMLIYVVASI 178

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 62/134 (46%), Gaps = 11/134 (8%)

Query: 14  RNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFL 73
           R++LN  L++         V  T+     E  + +     +        I S M +G  L
Sbjct: 38  RSSLNSSLTQ---------VLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGM-IGQLL 87

Query: 74  AALDNTIVTTLLSHIASEFNELS-HISWIATAYLLSSATFQPLYGKISDIFGRRPLIIIS 132
           +    T   ++++ +A E +  S   +W+ +++ L+  +F  + G++ DI+G + +++  
Sbjct: 88  SQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGG 147

Query: 133 NLFFILGCLICGLS 146
            +   +  +ICGLS
Sbjct: 148 YIITTVWSIICGLS 161

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/131 (19%), Positives = 54/131 (41%), Gaps = 2/131 (1%)

Query: 57  RARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPL 115
           RA+  +++     G F +++   I   +L+ I  +F+     ++     Y +       L
Sbjct: 72  RAKFGLVMQCAFTG-FFSSIAGAIYYPVLTVIEKKFSITEEQVNITVVVYFIFQGLSPSL 130

Query: 116 YGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSITAS 175
            G ++D  GRRP+++ S + +   C+   LS+N   ++            V ++ S    
Sbjct: 131 MGGLADSLGRRPVVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIMG 190

Query: 176 DIVPLRSRALY 186
           D+     R  Y
Sbjct: 191 DVTTKAERGGY 201

>KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.30
           YLL028W
          Length = 592

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/121 (19%), Positives = 57/121 (47%), Gaps = 1/121 (0%)

Query: 33  VAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEF 92
           + + E  + + D   + L     S  +  +I   +CL      + ++I  + +  I  ++
Sbjct: 124 LPDAEQYVVTFDGPNDPLHPFNWSLKKKVMICVVLCLDCLCITMASSIFASAVPQICEKY 183

Query: 93  NELSHISWIA-TAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWT 151
           + +  ++ +  T ++L  A    +Y  +S+I+GR+ +++I+   F L       ++NL T
Sbjct: 184 HVIQVVAILGITLFVLGFAASPIIYAPLSEIYGRKGVLVIAAFGFALFQFAVATAENLQT 243

Query: 152 L 152
           +
Sbjct: 244 I 244

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 52/101 (51%), Gaps = 6/101 (5%)

Query: 57  RARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLY 116
           + + H+++      SF A + + I  +++S  + E N++ H+S    + + S      + 
Sbjct: 88  KNKKHMVLMLGVFASF-AGILSGIDQSIISGASIEMNKMLHLSSHEASLVSSLMPLGAVA 146

Query: 117 GKI-----SDIFGRRPLIIISNLFFILGCLICGLSKNLWTL 152
           G I     S++ GR+  ++IS  F+ +G +IC  + N+ T+
Sbjct: 147 GSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTM 187

>KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 614

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 67  MCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIA-TAYLLSSATFQPLYGKISDIFGR 125
           + L +   A+ ++I  + +  I ++++    +  +  T Y+   A    +Y  +S+++GR
Sbjct: 179 LGLNAVTVAMGSSIFASAVPQICAKYHVAQVVGVLGVTLYVFGFAASPVIYAPLSELYGR 238

Query: 126 RPLIIISNLFFILGCLICGLSKNLWTLV 153
           + L+IIS+  F+L       +K+L T++
Sbjct: 239 QKLLIISSFGFVLFMFATATAKDLQTIM 266

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 46/109 (42%), Gaps = 16/109 (14%)

Query: 58  ARLHIIISSMCL----GSFLAALDNTIVTTLLSH--IASEFNELS----------HISWI 101
           A  +I +  +CL    G F+   D   ++  L+       F EL               +
Sbjct: 48  ASAYITVVIICLMVAFGGFVFGWDTGTISGFLAQTDFLRRFGELQADGTYAFSNIRTGLV 107

Query: 102 ATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLW 150
            + + L  A    L+ K+ D +GRR  ++I  L +++G +IC  + + W
Sbjct: 108 VSIFCLGCAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKW 156

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQP-LYGKIS 120
           + + +MC   F ++L + I    L  +  +FN   ++  ++    L    F P + G ++
Sbjct: 101 VAVLTMC--GFWSSLGSPIYYPALKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLA 158

Query: 121 DIFGRRPLIIISNLFFILGCL 141
           DI+GRRP+I+   L +++  +
Sbjct: 159 DIYGRRPVILFGMLVYVVASI 179

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 46/109 (42%), Gaps = 16/109 (14%)

Query: 58  ARLHIIISSMCL----GSFLAALDNTIVTTLLSH--IASEFNELS----------HISWI 101
           A  +I +  +CL    G F+   D   ++  L+       F EL               +
Sbjct: 49  ASAYITVVIICLMVAFGGFVFGWDTGTISGFLAQTDFLRRFGELQADGTYAFSNIRTGLV 108

Query: 102 ATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLW 150
            + + L  A    L+ K+ D +GRR  ++I  L +++G +IC  + + W
Sbjct: 109 VSIFCLGCAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKW 157

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 344 WFCMMSGVTLAFYVPVYWSSVQNLK---PTDMGKRIAPNFFSTAFGS----IGAGYYMKK 396
           W  + +   + F  P+Y   + NL    P +  KR+  NF +TA  S    IG   Y+  
Sbjct: 362 WNVVQTKKLMDFSSPIYIDGIPNLNSLPPKEQSKRLLENFRATALSSVTGLIGLNDYLDI 421

Query: 397 TGRYYG 402
             +YY 
Sbjct: 422 ADKYYD 427

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 96  SHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146
           S  +W+  ++ L S +F  + GK+ DI+G +  ++      ++  LICGLS
Sbjct: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137

>YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putative
           dityrosine transporter, required for spore wall
           synthesis; expressed during sporulation; member of the
           major facilitator superfamily (DHA1 family) of multidrug
           resistance transporters
          Length = 572

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 115 LYGKISDIFGRRPLIIIS-NLFFILGCLICGLSKNLWTLVXXXXXXXXXXXXVTSLGSIT 173
            +G ++D  GR+ L ++S +L  I+  L+  +  N+  L             V SLG+ T
Sbjct: 165 FWGALADFGGRKFLYMVSLSLMLIVNILLAAVPVNIAALFVLRIFQAFASSSVISLGAGT 224

Query: 174 ASDIVPLRSRA 184
            +D+VP + R 
Sbjct: 225 VTDVVPPKHRG 235

>Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138C
           (TPO2) -  [contig 96] FULL
          Length = 597

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 53/112 (47%), Gaps = 4/112 (3%)

Query: 43  EDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIA 102
           ED+  +        +    I++  +C   F  A+ + I+T  +   A+ F     +  + 
Sbjct: 106 EDDHEDPRNWPTRQKWNYTILLGIIC---FDVAMMSAIITGDMDSPAAYFGVSMEVMCLC 162

Query: 103 TAYLLSSATFQPLY-GKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLV 153
            + ++      P++   +S+ FGR P+ +I+ L  ++  + CG +KN+ TL+
Sbjct: 163 VSLMVWGFGIGPMFFAPLSEEFGRNPVYLITLLIAVVFIVPCGAAKNIGTLL 214

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%)

Query: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISD 121
           I++ S  +  +   L+  I      +  S + E S +S +     + SA  Q +Y ++SD
Sbjct: 67  ILLFSAFVCGYAYGLECNIRYIYTGYATSSYAEHSLLSTVNVINAVVSAASQIIYSRLSD 126

Query: 122 IFGRRPLIIISNLFFILGCLI 142
            FGR  L II+ + +++G +I
Sbjct: 127 FFGRLTLFIIAIVLYVVGTII 147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,049,690
Number of extensions: 1867986
Number of successful extensions: 7543
Number of sequences better than 10.0: 380
Number of HSP's gapped: 7492
Number of HSP's successfully gapped: 422
Length of query: 579
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 464
Effective length of database: 40,294,809
Effective search space: 18696791376
Effective search space used: 18696791376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)