Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A01760g5.528ON58358322070.0
NDAI0C010605.528ON6373794202e-43
Smik_13.1445.528ON6394003558e-35
SAKL0G04950g5.528ON5672313475e-34
TDEL0A039205.528ON4661503364e-33
KLTH0G03784g5.528ON5692503272e-31
KNAG0B036805.528ON4821703181e-30
CAGL0H04631g5.528ON5884043141e-29
ZYRO0D12584g5.528ON5791683103e-29
Kwal_47.186315.528ON584633078e-29
Suva_13.1555.528ON6451043061e-28
KAFR0C054005.528ON481712923e-27
YML007W (YAP1)5.528ON6501112927e-27
Skud_13.1475.528ON6651122822e-25
Kpol_1004.225.528ON4751682683e-24
TPHA0D023405.528ON506832622e-23
TBLA0G009305.528ON6081812562e-22
TPHA0K005205.528ON560632393e-20
TBLA0D016405.528ON5991481931e-14
NDAI0H016105.528ON519651431e-08
Ecym_40645.528ON426821359e-08
YDR423C (CAD1)5.528ON409821322e-07
NCAS0H025605.528ON587431287e-07
Kpol_1023.975.528ON591351271e-06
NCAS0F011005.528ON475981261e-06
Smik_4.6985.528ON3931551133e-05
Suva_2.600singletonOFF382531072e-04
ADR195C5.528ON288781026e-04
CAGL0F03069g5.528ON486711000.002
KNAG0C032105.528ON38478880.040
KAFR0E032905.528ON265105870.041
Skud_13.6singletonON31088770.73
YPR199C (ARR1)na 1ON29455770.79
TPHA0J005006.42ON65943751.8
Kpol_1037.126.42ON67047715.3
TBLA0B005406.41ON72947706.0
KLLA0C05940g6.42ON64043699.5
NOTE: 1 genes in the same pillar as KLLA0A01760g were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01760g
         (583 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   854   0.0  
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   166   2e-43
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   141   8e-35
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   138   5e-34
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   134   4e-33
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   130   2e-31
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   127   1e-30
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   125   1e-29
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   124   3e-29
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   122   8e-29
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   122   1e-28
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   117   3e-27
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   117   7e-27
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   113   2e-25
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...   107   3e-24
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...   105   2e-23
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   103   2e-22
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    97   3e-20
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    79   1e-14
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    60   1e-08
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    57   9e-08
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    55   2e-07
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...    54   7e-07
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...    54   1e-06
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    53   1e-06
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    48   3e-05
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    46   2e-04
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    44   6e-04
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    43   0.002
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    39   0.040
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    38   0.041
Skud_13.6 Chr13 (6426..7358) [933 bp, 310 aa] {ON} YPR199C (REAL)      34   0.73 
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    34   0.79 
TPHA0J00500 Chr10 complement(111187..113166) [1980 bp, 659 aa] {...    33   1.8  
Kpol_1037.12 s1037 (26014..28026) [2013 bp, 670 aa] {ON} (26014....    32   5.3  
TBLA0B00540 Chr2 complement(105246..107435) [2190 bp, 729 aa] {O...    32   6.0  
KLLA0C05940g Chr3 (524768..526690) [1923 bp, 640 aa] {ON} unipro...    31   9.5  

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/583 (75%), Positives = 441/583 (75%)

Query: 1   MSTSTAKRPFDNKRXXXXXXXXXXXXXXXXXXXXXXXKRRERKPGRKPLETEAKDXXXXX 60
           MSTSTAKRPFDNKR                       KRRERKPGRKPLETEAKD     
Sbjct: 1   MSTSTAKRPFDNKRAGSPDDGTDSDSGGNNSGSSPASKRRERKPGRKPLETEAKDKRTAQ 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPK 120
                                 VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPK
Sbjct: 61  NRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPK 120

Query: 121 KRDSILLDYLAKQRKASIDSNPDFXXXXXXXXXXXXXXXXISSSNFQFEFPWKMXXXXXX 180
           KRDSILLDYLAKQRKASIDSNPDF                ISSSNFQFEFPWKM      
Sbjct: 121 KRDSILLDYLAKQRKASIDSNPDFSAAANKAANSKDSSTAISSSNFQFEFPWKMDPSKIP 180

Query: 181 XXXXXXXXXXXXXXXLDNANNKSVSSTXXXXXXXXXXXXXXXXXXXXXXXXRKHSNTLNL 240
                          LDNANNKSVSST                        RKHSNTLNL
Sbjct: 181 SPSSDSTSPSASTSILDNANNKSVSSTNLNHSRSSISNSSSSPSNVNGLSSRKHSNTLNL 240

Query: 241 YQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSSSDLLKPXXXX 300
           YQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSSSDLLKP    
Sbjct: 241 YQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSSSDLLKPKSNS 300

Query: 301 XXXXXXXXXXXXXXXDLSSSAPLHDSASASALNNHDSVNAVSNQFSVDKQYNDSSHSQAT 360
                          DLSSSAPLHDSASASALNNHDSVNAVSNQFSVDKQYNDSSHSQAT
Sbjct: 301 NVNITNHNNNKINSKDLSSSAPLHDSASASALNNHDSVNAVSNQFSVDKQYNDSSHSQAT 360

Query: 361 PNGLDNDSSVSAWQQPSFGQLGFRTDQLFDLDLDSASPITKQKDXXXXXXXXXXXXPAKA 420
           PNGLDNDSSVSAWQQPSFGQLGFRTDQLFDLDLDSASPITKQKD            PAKA
Sbjct: 361 PNGLDNDSSVSAWQQPSFGQLGFRTDQLFDLDLDSASPITKQKDNNYSTTTNNTNSPAKA 420

Query: 421 DGMYWNFNTPLSNMVSRNMQNPEIPFIDTGLAFPDYDDPLLDILKEEQENEQVEGDSDPI 480
           DGMYWNFNTPLSNMVSRNMQNPEIPFIDTGLAFPDYDDPLLDILKEEQENEQVEGDSDPI
Sbjct: 421 DGMYWNFNTPLSNMVSRNMQNPEIPFIDTGLAFPDYDDPLLDILKEEQENEQVEGDSDPI 480

Query: 481 QALINEEPSMPLCHDPAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITA 540
           QALINEEPSMPLCHDPAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITA
Sbjct: 481 QALINEEPSMPLCHDPAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITA 540

Query: 541 HPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHMQ 583
           HPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHMQ
Sbjct: 541 HPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHMQ 583

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  166 bits (420), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 128/379 (33%), Positives = 175/379 (46%), Gaps = 93/379 (24%)

Query: 247 VTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKA-SPVSTPSSSDLLKPXXXXXXXXX 305
           +++ FDF+ +FDE VS FC K+SMACGT+SNPIPK+ S VSTP S  ++           
Sbjct: 308 ISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQS--IMNSNNKSPISPL 365

Query: 306 XXXXXXXXXXDLSSSAPLHDSASASALNNHDSVNAVSNQFSV---DKQYNDSSHSQATPN 362
                       +S+   H S +  A+N++     ++N + +       NDSS +   P 
Sbjct: 366 NDSTLAKSNVITTSNIFDHQSNTPQAINSN-----LTNTWGIPSASPNSNDSSPNNIVP- 419

Query: 363 GLDNDSSVSAWQQPSFGQLGFRTDQLFDLDLDSASPITKQKDXXXXXXXXXXXXPAKADG 422
              ++S+V+     +FGQLGF  D     ++D + PI   K                   
Sbjct: 420 -TQDNSNVNM----NFGQLGFMMDSPQFQNIDLSLPIENDK------------------- 455

Query: 423 MYWNFNTPLSNMVSRNMQNPEIPFIDTGLAFP----------------------DYDDPL 460
                        + N + P +PFI+  LAFP                      D  D L
Sbjct: 456 -----------FSASNFKKPSLPFINPTLAFPNDDLFNKNNSNNDNNNNTTTTHDESDLL 504

Query: 461 LDILKEEQENEQVEGD---------------SDPIQA--LINEEPSMPLCHDPAANAGAS 503
              L  +  N     +                  + A  LINEEPS       + N   +
Sbjct: 505 SQFLANDYSNTISTNNLMNSDDDEDEDDDDYEKKLVANNLINEEPS-------STNKNNN 557

Query: 504 VSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCS 563
           ++ T K     +    I+PS DG LL+CSE+WDRITAHP+YS+LDIDGLC EL TKAKCS
Sbjct: 558 LTSTSKEQENNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCS 617

Query: 564 EKGVVVNAEDVQKALISHM 582
           E+GVVVNAEDVQ AL  HM
Sbjct: 618 ERGVVVNAEDVQMALTKHM 636

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 34/48 (70%), Gaps = 2/48 (4%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYL 130
           V+ L  + KQ+E+E++FLR+Q+  L++ELK+Y P    +  S +L+Y+
Sbjct: 106 VANLTKIQKQNEIESEFLRSQLITLVNELKKYKPN--NENASKVLNYI 151

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  141 bits (355), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 126/400 (31%), Positives = 175/400 (43%), Gaps = 110/400 (27%)

Query: 248 TSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSSSDLLKPXXXXXXXXXXX 307
           +++F+F++QFDE VS FCSK++  CGT+  PIPK  PVST                    
Sbjct: 284 SNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKK-PVST-------------------- 322

Query: 308 XXXXXXXXDLSSSAPLHDSASASALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNG---- 363
                   ++ +S+ +  + S S  N  +                  SHS  T N     
Sbjct: 323 -----LDKEVFASSSILSANSPSLTNTWE------------------SHSNITVNTPANV 359

Query: 364 LDNDSSVSAWQQPSFGQLGFRT-DQLFDLDLDSASPITKQKDXXXXXXXXXXXXPAKADG 422
           + ND+S+      SFGQLGF       D++ D+ S    +              P  ++ 
Sbjct: 360 IGNDTSIDT-SFSSFGQLGFGVAANHHDVNNDNTSSTGNKNGSNKNSTNNDDVLPFISES 418

Query: 423 MY-----WNFNTP-----LSNMV----SRNMQNP--EIPFIDTGLAFP------------ 454
            +      NF  P     ++N+     S  +QN   +IPFI+  LAFP            
Sbjct: 419 PFDMDQVTNFFCPGPTNTINNVAASANSNFLQNSKDDIPFINANLAFPDENSTNIQLQPI 478

Query: 455 ---------DYDDPLLDILKEEQE----------------NEQVEGDSDPIQA-----LI 484
                    DYD    D  KE                   N++    SD   +     LI
Sbjct: 479 SESQSQNKFDYDMFFRDSSKEGNNLFEEFLEEDDDDDDDGNKKAYNTSDDESSLIKNQLI 538

Query: 485 NEEPSMPLCH--DPAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHP 542
           NEEP   L +  + A    + V E    +N      D++PS +G LL+CSE+WDRIT HP
Sbjct: 539 NEEPQSTLKNESESAQRKDSYVQEAIDNNNGNGNDNDVVPSKEGSLLRCSEIWDRITTHP 598

Query: 543 RYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582
           +YSD+D+DGLC EL  KAKCSE+GVV+NAEDVQ AL  HM
Sbjct: 599 KYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 638

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (74%), Gaps = 2/51 (3%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQ 133
           V  LES+ +Q+E+E  FLR+Q+  L++ELK+Y PE   + DS +L+YLAK+
Sbjct: 96  VQSLESIQQQNEVEATFLRDQLVTLVNELKKYRPET--RNDSKVLEYLAKR 144

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  138 bits (347), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 114/231 (49%), Gaps = 32/231 (13%)

Query: 370 VSAWQQPSFGQLGFRTDQLFDLDLDSASPITKQKDXXXXXXXXXXXXPAKADGMYWNFNT 429
            + W+ PSFG LGF  D     + D                      P  A       NT
Sbjct: 350 TNTWETPSFGNLGFGGDGDSHGNGDGHGHGNGDDSNKWLFTSDLGPSPGAAAA-----NT 404

Query: 430 PLSNMVSRNMQNPEIPFIDTGLAFPDYDDPLLDILKEEQENEQVEG-----DSDPIQALI 484
           P SN          +PFIDT +AFP   + L  + ++   N          + DP+   +
Sbjct: 405 P-SNSADI------LPFIDTSIAFPTEQNEL--VFRDTAANNSSTVFDEFLEEDPVVHQL 455

Query: 485 NEEPSM--PLCHDPAANAGASVSETDKLSN-------QEE----IVQDIIPSNDGKLLKC 531
             E S+     +D  A  G   S  +   N       QE     +  D++PS DGKLLKC
Sbjct: 456 TTEESVYDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPLVSDDVVPSRDGKLLKC 515

Query: 532 SEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582
            E+WDRIT+HP+YSDLDIDGLC+ELRTKAKCSEKGVVVNA+DVQKAL  HM
Sbjct: 516 GEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHM 566

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 111/253 (43%), Gaps = 16/253 (6%)

Query: 43  KPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELETKFLRN 102
           KPGRKPL TEAK+                           V+ LE++ +Q+E+ET+FLR+
Sbjct: 48  KPGRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQNEVETEFLRS 107

Query: 103 QVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNPDFXXXXXXXXXXXXXXXXIS 162
           Q+  L+SELK+Y PE  +  D+ +L+YLAK+ +   D++ D                  S
Sbjct: 108 QLMTLISELKKYRPE--QSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSS 165

Query: 163 SS-----------NFQFEFPWKMXXXXXXXXXXXXXXXXXXXXXLDNAN---NKSVSSTX 208
           S            +F FEFPWK                        ++N   N + ++  
Sbjct: 166 SESHIRDNIQKKMDFTFEFPWKDNAGRTQFPSPGSSSVSSNHKPSFSSNAPFNATNNTPS 225

Query: 209 XXXXXXXXXXXXXXXXXXXXXXXRKHSNTLNLYQTQSNVTSEFDFDSQFDESVSSFCSKL 268
                                   + +N+  +     ++T++FDF+S FDE VS FC+++
Sbjct: 226 TSSASLDMFYQDDALPKFTSSSLERGNNSGTIADAGFSITNDFDFESHFDEQVSEFCTRM 285

Query: 269 SMACGTKSNPIPK 281
           + ACGT+ +P+P+
Sbjct: 286 NQACGTRDSPVPQ 298

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  134 bits (336), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 88/150 (58%), Gaps = 21/150 (14%)

Query: 442 PEIPFIDTGLAFPDYDDPLLDILKEEQENEQVEGDSDPIQA---------LINEEPSMPL 492
           PE+PFID  +AFP  DD  L       EN       D ++          LINEEPS   
Sbjct: 327 PELPFIDPTMAFPTDDDEGLFFRTHRDENSLFAELLDEVEPTDNNFVNENLINEEPS--- 383

Query: 493 CHDPAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGL 552
                     +V+E  +   + E   D++PS DGKLLKCSEVWDRIT HP+YS +DIDGL
Sbjct: 384 -------TTTAVAEETRPKPKTET--DVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGL 434

Query: 553 CLELRTKAKCSEKGVVVNAEDVQKALISHM 582
           C EL TKAKCSEKGVVV AEDVQ+ L  HM
Sbjct: 435 CGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 53/131 (40%), Gaps = 15/131 (11%)

Query: 43  KPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELETKFLRN 102
           KPGRKPL+ E K+                           V  LE  N+ + +E++FLR+
Sbjct: 48  KPGRKPLDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESEFLRS 107

Query: 103 QVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNPDFXXXXXXXXXXXXXXXXIS 162
           Q+  L++ELK+Y P   K  D  +LDYLAK  +                           
Sbjct: 108 QLLTLVNELKKYRPA--KANDLQVLDYLAKHERTE-------------PTDKEIEQSVQK 152

Query: 163 SSNFQFEFPWK 173
             +F F FPWK
Sbjct: 153 KMDFTFAFPWK 163

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 29/37 (78%)

Query: 248 TSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASP 284
           ++EF+FD QFDE VS FC+K++ ACGT+  PIP  +P
Sbjct: 246 SNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTP 282

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  130 bits (327), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 124/250 (49%), Gaps = 70/250 (28%)

Query: 372 AWQQPSFGQLGFRTDQLFDLDLDSASPITKQKDXXXXXXXXXXXXPAKADGMYWNFNTPL 431
           AW  P FG  GF         + +  P  +                       W F    
Sbjct: 350 AWDSPQFGHSGF--------GMGTEDPTNR-----------------------WLFPDFS 378

Query: 432 SNMVSRNMQNPE-----IPFIDTGLAFP-DYDDPLL-----DILKEEQENEQV------- 473
           S  +S  ++ P      +PFIDT +AFP D  D LL     D+L +  E + +       
Sbjct: 379 SGNMSSTVRAPSAKIDSVPFIDTSMAFPTDQPDALLPQNSDDVLNQFFEEDPIVSQLTTE 438

Query: 474 EGDSDPIQALI-------NEEPSMPLCH---DPA---ANAGASVSE----TDKLSNQEEI 516
           E + DP +  +         + S+  C    DP+   +NA  +++E     DK S    +
Sbjct: 439 ESNYDPFKPDLQPSADSETSKHSVSSCSNDSDPSRAESNASTALTEPNYTIDKTSVPSAV 498

Query: 517 VQ----DIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAE 572
           +     D++P+ DG LLKCSE+WDRITAHP+YSD+DIDGLC+ELRTKAKCSEKGVVVN++
Sbjct: 499 LAAEDADVVPARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKGVVVNSD 558

Query: 573 DVQKALISHM 582
           DVQ AL  HM
Sbjct: 559 DVQSALAKHM 568

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 54/95 (56%), Gaps = 2/95 (2%)

Query: 38  KRRERKPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELET 97
           KR+  KPGRKPL+TEAK+                           V +LE + +QSE+E+
Sbjct: 19  KRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEMES 78

Query: 98  KFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAK 132
           +FLR+Q+  L++E+++Y P+  +  DS +L YLA+
Sbjct: 79  EFLRSQLQMLIAEIQKYRPQ--QSSDSQVLKYLAE 111

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 235 SNTLNL--YQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSS 290
           SNT +L  + T  +   +FDF++ FDE VS FC++++  CGT+  P+P+A P ST +S
Sbjct: 251 SNTQSLPKFPTSESGNGDFDFNTHFDEQVSVFCTQMNEVCGTRECPLPQALPPSTAAS 308

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 93/170 (54%), Gaps = 46/170 (27%)

Query: 443 EIPFIDTGLAFPDYDDP---------------------LLDILKEEQ--ENEQVEGDSDP 479
           EIPFI+T LAFP  D                       L D L+EE+  +N+Q +   + 
Sbjct: 328 EIPFINTSLAFPTDDGAVPQTVDDNIFFRDTQHEQRSALDDFLEEEELTDNQQQQQHEEK 387

Query: 480 IQALINEEP-------SMPLCHDPAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLKCS 532
           I  LINE P        +P   +P  +    V                +PS DGKLLKCS
Sbjct: 388 INLLINEVPFSIEADKEVPFSIEPNEDGDPQV----------------VPSKDGKLLKCS 431

Query: 533 EVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582
           E+WDRITAHP+YSDLDIDGLC EL TKAKCSE+GVVVNA+DV+ AL  H+
Sbjct: 432 EIWDRITAHPKYSDLDIDGLCGELMTKAKCSERGVVVNADDVKDALNRHI 481

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 97/251 (38%), Gaps = 16/251 (6%)

Query: 47  KPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELETKFLRNQVTN 106
           KPL+ EA+                            V +L  + KQ+E+E++FLR Q+  
Sbjct: 43  KPLDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQKQNEVESEFLRGQLVT 102

Query: 107 LLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNPDFXXXXXXXXXXXXXXXXISSSNF 166
           L+ ELK+Y PE     DS +L+YLAK      D+ P                      +F
Sbjct: 103 LVHELKKYRPET--SNDSKVLEYLAKH-----DNVP--------PNQQGQAPAARDRGDF 147

Query: 167 QFEFPWKMXXXXXXXXXXXXXXXXXXXXXLD-NANNKSVSSTXXXXXXXXXXXXXXXXXX 225
            FEFPWK                      +     ++    T                  
Sbjct: 148 SFEFPWKGRTAPEFDNSTTQETTTATPSPVSPGTKDQQGKPTDWLDEVLSSTELYAKQQQ 207

Query: 226 XXXXXXRKHSNTLNLYQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPV 285
                 R  S  L  Y     V++E  FD+QFDE VS FC +++ ACG+K+NP+PK+   
Sbjct: 208 QQLQGNRSESPFLAGYDDSLTVSNEITFDTQFDEQVSDFCVRMNEACGSKTNPVPKSKKG 267

Query: 286 STPSSSDLLKP 296
           S  S+S L  P
Sbjct: 268 SVFSNSVLSPP 278

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 118/404 (29%), Positives = 162/404 (40%), Gaps = 123/404 (30%)

Query: 249 SEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSSSDLLKPXXXXXXXXXXXX 308
           S  DF++ FDE VS FC+KL+ ACGTK+ PIP++   +T                     
Sbjct: 237 SGIDFNNFFDEQVSEFCTKLNQACGTKACPIPQSKSAAT--------------------- 275

Query: 309 XXXXXXXDLSSSAPLHDSASASALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDS 368
                        PL  ++S    N+   +N      S++ Q N+  H  AT N + + +
Sbjct: 276 ------------TPLPGTSSNGNSNSPMIINDTMGDVSLNMQGNE--HGNATNNLVTDPA 321

Query: 369 SVS-AW-------------QQPSFGQLGFRTDQLF-DLDLDSASPITKQKDXXXXXXXXX 413
            +S  W               P FGQLGF  + L  D+     SP               
Sbjct: 322 FLSNTWDDMSPASNQHSTGGAPGFGQLGFGDNLLGNDILFSPNSPAYSPSVLGSGRTQEV 381

Query: 414 XXXPAKADGMYWNFNTPLSNMVSRNMQNPEI--PFIDTGLAFP-DYDDPLL--------- 461
              PA            +  +V +  ++  +  PFI++ LAFP DYD+            
Sbjct: 382 YRSPA------------VQKVVEKENESKSVNFPFINSSLAFPGDYDNNFFRETTDLNFD 429

Query: 462 ---DILKEEQENEQV------------EGDSDPI-QALINEEPSMPLCHDPAANAGASVS 505
                      N+ V              DS  I   L+ EEPSM             V 
Sbjct: 430 DNDQDDNFTNSNDLVNDYFTTNIPDTDNSDSALIANGLVKEEPSM------QTEDTFKVQ 483

Query: 506 ETDKLSNQEEIVQDIIPSNDGK---------------------------LLKCSEVWDRI 538
            T+ + N   + + I   N G+                           LL+CSE+WDRI
Sbjct: 484 NTNDMLNSSRMKETIDNQNIGEKTTKDDNEDDDEDDENDNTVVPSRDDGLLRCSEIWDRI 543

Query: 539 TAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582
           TAHP+YSD+DIDGLC EL  KAKCSE+GVV+NA+DVQ AL  HM
Sbjct: 544 TAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQVALNKHM 587

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 2/52 (3%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQR 134
           V  LE+L K +E+ET FLR+Q++ L+ EL++Y PE   K+D  +L YL K +
Sbjct: 57  VVDLENLTKLNEVETNFLRDQLSILVKELRKYRPET--KQDHKVLKYLEKHK 106

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score =  124 bits (310), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 98/168 (58%), Gaps = 29/168 (17%)

Query: 440 QNPEIPFIDTGLAFPDYDDPLLDILKEEQENEQV----------------EGDSDPIQ-- 481
           +N E+PFIDT LAFP+  D    + +E+Q +                   EG++ P Q  
Sbjct: 417 KNSELPFIDTSLAFPEEQD----LFREQQPDNMFAEFIEHDPQRDTTNGNEGNTSPDQDE 472

Query: 482 ----ALINEEPSMPLCHDPAANAGASVSETDKLSNQEEIVQD--IIPSNDGKLLKCSEVW 535
                ++ EEP++    +   N   +V +       +E      ++PS+DGKLLKCSEVW
Sbjct: 473 FLASGMVQEEPAV-TTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVW 531

Query: 536 DRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHMQ 583
           DRIT+HP+YSD+DIDGLC EL  KAKCSE+GVVV AEDVQ AL + ++
Sbjct: 532 DRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNRVE 579

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 73/173 (42%), Gaps = 10/173 (5%)

Query: 1   MSTSTAKRPFDNKRXXXXXXXXXXXXXXXXXXXXXXXKRRERKPGRKPLETEAKDXXXXX 60
           MST++AKRP +                          +++  KPGRKPL++EAK      
Sbjct: 1   MSTTSAKRPLE-----PTVSLDFAEDEADDSPTSDEPRKKGGKPGRKPLDSEAKSKRTAQ 55

Query: 61  XXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPK 120
                                 V  LE LN+QS +ET+FLR+Q+  L++ELKRY PE P 
Sbjct: 56  NRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPN 115

Query: 121 KRDSILLDYLAKQRKASIDSNPDFXXXXXXXXXXXXXXXXISSSNFQFEFPWK 173
             DS +L YLAK   +  D +                   +S   F F FPWK
Sbjct: 116 --DSQVLQYLAKTENSKSDDSSQNKKDSESKEIEESVRRKMS---FTFAFPWK 163

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 26/34 (76%)

Query: 248 TSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPK 281
           +++F+F+ +FDE VS FC+KL   CGTK  PIP+
Sbjct: 311 SNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQ 344

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  122 bits (307), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 58/63 (92%)

Query: 520 IIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALI 579
           ++P+ DG LLKCSEVWDRIT+HP+YSD+DIDGLCLELRTKAKCSEKGVVVN +DVQ+AL 
Sbjct: 521 VVPARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQRALT 580

Query: 580 SHM 582
            HM
Sbjct: 581 KHM 583

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 59/103 (57%), Gaps = 5/103 (4%)

Query: 38  KRRERKPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELET 97
           KR+  KPGRKPL+TEAK+                           V +LE + +QSELE+
Sbjct: 19  KRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELES 78

Query: 98  KFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAK---QRKAS 137
           +FLR+Q+  LL+E+++Y P   +  DS +L++LAK   +RK+S
Sbjct: 79  EFLRSQLQKLLAEIQKYRPR--QSSDSQVLNFLAKAEERRKSS 119

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 81/218 (37%), Gaps = 75/218 (34%)

Query: 249 SEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSSSDLLKPXXXXXXXXXXXX 308
           +EFDF+S FDE VS FC++++  CGT+  P+  A P ST                     
Sbjct: 279 TEFDFNSHFDEQVSEFCTRMNEVCGTRECPVAPALPPST--------------------- 317

Query: 309 XXXXXXXDLSSSAPLHDSASASALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDS 368
                       A  H + S SA    DS+    +Q   +K      H Q   N L   +
Sbjct: 318 ------------AMAHTTPS-SAQPQPDSLTRRPSQELSEK------HLQ---NQLSPQA 355

Query: 369 SVSAWQQPSFGQLGFRTDQLFDLDLDSASPITKQKDXXXXXXXXXXXXPAKADGMYWNFN 428
           + S W  P FG  GF +D L D       P  +                     M+  FN
Sbjct: 356 ASSVWDTPQFGHSGFGSD-LED-------PTNR--------------------WMFAGFN 387

Query: 429 TPLSNMVSRNMQNP--EIPFIDTGLAFPDYDDPLLDIL 464
                 V R        +PFIDT +AFP   DP  D+L
Sbjct: 388 AATEGGVIRTTSATADSLPFIDTSMAFP--TDPQEDLL 423

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  122 bits (306), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 72/104 (69%), Gaps = 4/104 (3%)

Query: 483 LINEEPSM-PLCHDPAANAGASVSETDKLSNQEEIV---QDIIPSNDGKLLKCSEVWDRI 538
           LINEEP     CH      G+ V +    SN E++     +++PS +G LL+CSE+WDRI
Sbjct: 541 LINEEPQQQSQCHLSTPKNGSEVLQNKNSSNSEDVNDNDNEVVPSKEGSLLRCSEIWDRI 600

Query: 539 TAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582
           T HP+YSD+D+DGLC EL  KAKCSE+GVV+NAEDVQ AL  HM
Sbjct: 601 TTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 644

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%)

Query: 248 TSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKAS 283
           +++F+F++QFDE VS FCSK++ ACGTK  PIPK S
Sbjct: 289 SNDFNFENQFDEQVSEFCSKMNQACGTKQCPIPKKS 324

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (74%), Gaps = 2/51 (3%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQ 133
           V  LES+ +++E+E  FLR+Q+  L+SELK+Y PE   + DS +L+YLA++
Sbjct: 96  VHSLESIQQENEVEATFLRDQLVTLVSELKKYRPET--RNDSKVLEYLARR 144

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  117 bits (292), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 2/71 (2%)

Query: 514 EEI--VQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNA 571
           EEI  + D++PS D  LL+CSEVWDRITAHP+YSD+DIDGLC EL  KAKCSEKGVVVNA
Sbjct: 410 EEIDDINDVVPSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNA 469

Query: 572 EDVQKALISHM 582
           EDVQ AL  H+
Sbjct: 470 EDVQSALSKHL 480

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 34/44 (77%)

Query: 247 VTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSS 290
           +++EF+F+ QFDE V+ FC K++  CGT+SNPIPK S  + PS+
Sbjct: 261 ISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNLPST 304

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 46/90 (51%), Gaps = 20/90 (22%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNP 142
           V  L ++ KQ+E+E++FLR+Q+  L+ ELK+Y PE     DS +L+YLAK    + + N 
Sbjct: 76  VDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPET--ANDSQVLNYLAKHENGNFNEN- 132

Query: 143 DFXXXXXXXXXXXXXXXXISSSNFQFEFPW 172
                                SNF F FPW
Sbjct: 133 -----------------LSKKSNFSFAFPW 145

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  117 bits (292), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (63%), Gaps = 11/111 (9%)

Query: 483 LINEEPSMP---LCHDPAANAGASVSETDKLSNQEEIVQD--------IIPSNDGKLLKC 531
           LINEEP +P   L   P   +  S      L N ++I           ++PS +G LL+C
Sbjct: 539 LINEEPELPKQYLQSVPGNESEISQKNGSSLQNADKINNGNDNDNDNDVVPSKEGSLLRC 598

Query: 532 SEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582
           SE+WDRIT HP+YSD+D+DGLC EL  KAKCSE+GVV+NAEDVQ AL  HM
Sbjct: 599 SEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 649

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 31/39 (79%), Gaps = 1/39 (2%)

Query: 248 TSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVS 286
           +++F+F++QFDE VS FCSK++  CGT+  PIPK  P+S
Sbjct: 286 SNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKK-PIS 323

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (74%), Gaps = 2/51 (3%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQ 133
           V  LES+ +Q+E+E  FLR+Q+  L++ELK+Y PE   + DS +L+YLA++
Sbjct: 96  VQSLESIQQQNEVEATFLRDQLITLVNELKKYRPET--RNDSKVLEYLARR 144

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/112 (50%), Positives = 73/112 (65%), Gaps = 15/112 (13%)

Query: 483 LINEEPSMPLCHD------------PAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLK 530
           LINEEP  PL  +            P  N+G +  +    S+  +   D++PS +G LL+
Sbjct: 556 LINEEP-QPLNQNSLSSLNNEKETSPKTNSGGT--QNANDSDGNDNDNDVVPSKEGSLLR 612

Query: 531 CSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582
           CSE+WDRIT HP+YSD+D+DGLC EL  KAKCSE+GVV+NAEDVQ AL  HM
Sbjct: 613 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 664

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 1/37 (2%)

Query: 251 FDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVST 287
           F+F++QFDE VS FCSK++  CGT+  PIPK  PVST
Sbjct: 284 FNFENQFDEQVSEFCSKMNQVCGTRQCPIPKK-PVST 319

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQ 133
           V  LE++ +Q+E+E  FLR+Q+  L++ELK+Y PE   + DS +L+YLA +
Sbjct: 96  VQGLENIQQQNEVEATFLRDQLVTLVNELKKYRPE--TRNDSKVLEYLASR 144

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score =  107 bits (268), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 95/168 (56%), Gaps = 30/168 (17%)

Query: 444 IPFIDTGLAFPDYDDP-------------LLDI------LKEEQENEQVEGDS-DPIQAL 483
            P ID  LAFP+  +                DI        +E   + VE +S D I+ L
Sbjct: 308 FPLIDASLAFPNNSNSNRNNNNNNNNNVLFRDISTAEMQFMDESPLQNVEFNSEDAIKRL 367

Query: 484 INEEPS------MPLCHDPAANAGASVSETDKLSNQ--EEIVQDII-PSNDGKLLKCSEV 534
           I+EEPS      +P  H+   N+ AS+     L  +  +E+ +D++ PS D +L++CSE+
Sbjct: 368 ISEEPSPHYSNSVPHLHNNNVNS-ASLHPLTVLVQEPDDELDEDVVVPSTDSQLMRCSEI 426

Query: 535 WDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582
           WDRIT +PRY+DLDIDGLC EL   AKCS+KGVVV ++DV K L  HM
Sbjct: 427 WDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 40/57 (70%), Gaps = 2/57 (3%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASID 139
           V+ LE++++++E+ET+FLR+QV  L++ELK+Y  E     DS +L  ++  R+ + D
Sbjct: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTS--DSKILKLVSNSRENTRD 127

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 20/21 (95%)

Query: 248 TSEFDFDSQFDESVSSFCSKL 268
           +++F+F++QFDE VS+FC+K+
Sbjct: 188 SNDFNFNNQFDEQVSTFCAKM 208

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score =  105 bits (262), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 47/83 (56%), Positives = 63/83 (75%), Gaps = 1/83 (1%)

Query: 497 AANAGASVSETDKLSNQ-EEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLE 555
            AN   ++ ETD  S+  +E+V  I+P  DG+LL+C E+WDRIT +PRYSD+DIDGLC E
Sbjct: 419 TANEYPNIYETDDSSDGGDEVVGQIVPLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEE 478

Query: 556 LRTKAKCSEKGVVVNAEDVQKAL 578
           L   AKCS+KGV+V+++DVQK L
Sbjct: 479 LMASAKCSDKGVLVSSDDVQKVL 501

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 35/53 (66%), Gaps = 3/53 (5%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRK 135
           V +LE++N+++E+ET FLR Q+ +L++ELK+Y  +   K D   L  +  Q K
Sbjct: 48  VRKLENINEKNEIETVFLRTQLLSLVNELKKYRID---KNDDFRLKKIGSQLK 97

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 24/30 (80%), Gaps = 1/30 (3%)

Query: 240 LYQTQSNV-TSEFDFDSQFDESVSSFCSKL 268
           + Q  SN+ ++EFDF ++FDE VS+FC+K+
Sbjct: 256 ILQQDSNLFSTEFDFANEFDEQVSTFCAKM 285

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 90/181 (49%), Gaps = 46/181 (25%)

Query: 444 IPFIDTGLAFPDYDDPL-------LDILKEEQENEQVEGDSDPIQALINEE--------- 487
           IPFIDT LAF D    L       + + K  +++     D D  + L++E+         
Sbjct: 431 IPFIDTSLAFNDIPTNLSNDNEFNMQLFKTNRKS----SDDDFFKFLMDEDNDILNGNNN 486

Query: 488 ----------------------PSMPLCHDPAANAGASVSETDKLSNQEEI--VQDIIPS 523
                                  S  L   P A+  A  S   +  N++    V  II  
Sbjct: 487 STENNEDNNSILNNLINETPAVESTQLAQTPRASDSAHTSPIVQTPNKDPSISVMSIIRE 546

Query: 524 ND-GK-LLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISH 581
            D GK  ++CSEVWDRIT+HP+YSDLDIDGLC EL  KAKCSEKGVVV A+DVQKAL  H
Sbjct: 547 EDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKH 606

Query: 582 M 582
           +
Sbjct: 607 L 607

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 38  KRRERKPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELET 97
           K++  K GRK  + EAK                            V  LE ++K+SE+E+
Sbjct: 34  KKKSNKVGRKLSDQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVKSLEEVHKKSEIES 93

Query: 98  KFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQR 134
           +FLR+Q+  LL EL+RY PE  ++ D+ + +YL+  +
Sbjct: 94  QFLRDQLKVLLGELQRYRPE--RQNDAKVKEYLSTHK 128

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%)

Query: 520 IIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALI 579
           +I + DG  LKCS+VW R+T HP+YS+LDIDGLC EL  +AKCSEKGVVV + DVQKAL 
Sbjct: 496 VIRAEDGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKGVVVESRDVQKALS 555

Query: 580 SHM 582
            ++
Sbjct: 556 KYL 558

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRK 135
           V  LE +N+  ELET FLR+++ ++  ELK+Y P   +  D  +L+YLAK+ +
Sbjct: 70  VLALEQVNEAKELETNFLRSRLKSMADELKKYRP--AQSSDLEVLEYLAKKEQ 120

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 81/148 (54%), Gaps = 34/148 (22%)

Query: 441 NPEIPFIDTGLAFPD---YDDPLLDILKEEQENEQVEGDSDPIQALINEEPSMPLCHDPA 497
           N  I  ++T LAFP+     DP +++ K E                       P+   PA
Sbjct: 465 NVNINDVETNLAFPNQTLLQDPSINVDKFE----------------------FPI--SPA 500

Query: 498 ANAGASVSETDK------LSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDG 551
            N   S+++ DK        ++++   +++P+ D ++L C+++WDRITA P+Y+  DI+ 
Sbjct: 501 NNLNVSLNQQDKSNISDVDDDEDDDDNEMVPA-DPEMLPCTKIWDRITALPKYTSADIEN 559

Query: 552 LCLELRTKAKCSEKGVVVNAEDVQKALI 579
           LC EL +KAKCS+KGVVV++ DV K L+
Sbjct: 560 LCNELMSKAKCSDKGVVVSSLDVDKVLL 587

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 236 NTLNLYQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKS 276
           N++N + T       F+FD+QFDE +S FC KL+ ACG  S
Sbjct: 344 NSMNWFNTD---IETFNFDNQFDEQISKFCLKLNSACGNLS 381

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%), Gaps = 9/65 (13%)

Query: 527 KLLKCSEVWDRIT--------AHPRYSDLDIDGLCLELRTKAKCSEKG-VVVNAEDVQKA 577
           +  KCS++W+RI         + PR+ D DID LC EL TKA+CS  G +V+   D++++
Sbjct: 455 RFAKCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIKQS 514

Query: 578 LISHM 582
           L+ H 
Sbjct: 515 LMKHF 519

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 3/60 (5%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNP 142
           +S LE +  ++ +ET FLR+ +T+L++E+ ++ P+     DS +L YL+  R   + +NP
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPK--NTTDSKILKYLS-MRNTHMHNNP 64

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 40/82 (48%)

Query: 38  KRRERKPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELET 97
           +R+  KPGRKPL+TEAK+                           V +LE    QSE E 
Sbjct: 39  RRKGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREV 98

Query: 98  KFLRNQVTNLLSELKRYNPELP 119
           + LRNQV +LL ELK+Y P  P
Sbjct: 99  QSLRNQVVSLLRELKKYRPGSP 120

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 502 ASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAK 561
            + S T  +  Q E ++ I  +       C  + + I++ P+YS LDID LC EL  KAK
Sbjct: 327 VAASHTKTIRTQSEAIEHISSAISNGKASCYHILEEISSLPKYSSLDIDDLCSELIIKAK 386

Query: 562 CSEKG-VVVNAEDVQKALISHM 582
           C++   +VV A D+Q AL+  +
Sbjct: 387 CTDDCKIVVKARDLQSALVRQL 408

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)

Query: 247 VTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKA-SPVSTP 288
           +T+ FD   +FDE VS FC K++MACGT+ +P+PK+ S  STP
Sbjct: 280 ITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVPKSKSNTSTP 322

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 60/147 (40%), Gaps = 16/147 (10%)

Query: 1   MSTSTAKRPFD---NKRXXXXXXXXXXXXXXXXXXXXXXXKRRERKPG-----------R 46
           MST+TAKRP +   N R                       ++++   G           +
Sbjct: 1   MSTTTAKRPLELDPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMTK 60

Query: 47  KPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELETKFLRNQVTN 106
           K L+ EAK+                           V+ L  + KQ+E+E++FLR Q+  
Sbjct: 61  KQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFLRGQLIT 120

Query: 107 LLSELKRYNPELPKKRDSILLDYLAKQ 133
           L++ELK+Y    P   +S +L+YL++ 
Sbjct: 121 LVNELKKYRD--PNPNESKVLEYLSQH 145

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%)

Query: 248 TSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKA 282
           +++F+FD  FD+ VSSFC K++ ACGTK NP+PK 
Sbjct: 290 SNDFNFDDHFDQQVSSFCVKMNQACGTKQNPVPKT 324

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (73%), Gaps = 2/53 (3%)

Query: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRK 135
           V +LE + +Q+++E++FLRNQ+T ++ ELK+Y PE  K  D  +L+YLAK  +
Sbjct: 86  VHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPE--KSSDIKVLEYLAKHEE 136

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 38  KRRERKPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELET 97
           KRR  +PGRKPL+T AK+                           +S LE +   +E+E+
Sbjct: 18  KRRVGRPGRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVES 77

Query: 98  KFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRK 135
            FLR+ + +L+ ++++Y P      DS +L YL+ ++K
Sbjct: 78  TFLRDYMMDLICDMQKYRPN--NSTDSKVLKYLSLKKK 113

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 66/155 (42%), Gaps = 23/155 (14%)

Query: 451 LAFPDYDDPLL-------DIL--------KEEQENEQVEGDSDPIQALINEEPSMPLCHD 495
           LAFP   D +        DIL        KE + N +  G       L+N+E    L   
Sbjct: 238 LAFPSETDNMYFLDEANDDILLSSVVSPAKENECNGKCNGKCAEDTPLLNKEIKCELITK 297

Query: 496 PAAN-------AGASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLD 548
              N         AS    + +  + E ++ I  +   +   C  +   I++ P+YS LD
Sbjct: 298 RLLNQESLDSIVPASAPYRENIGIRSEAIRRISSAISNQNTSCCHILKEISSLPKYSSLD 357

Query: 549 IDGLCLELRTKAKCSEKG-VVVNAEDVQKALISHM 582
           ID LC EL TKA+ ++   +VV A D+Q  L+  +
Sbjct: 358 IDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 531 CSEVWDRITAHPRYSDLDIDGLCLELRTKAKCS-EKGVVVNAEDVQKALISHM 582
           CS +   I++ P++S LDID LC EL  KAKCS +  ++V A  +Q  L   +
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 34/78 (43%)

Query: 38  KRRERKPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELET 97
           KRR  KPGRKPL+TEAK+                           V +LE     +E E 
Sbjct: 23  KRRGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECEV 82

Query: 98  KFLRNQVTNLLSELKRYN 115
           + LR  V  L+ EL+R+ 
Sbjct: 83  QSLRGHVIALVRELRRWR 100

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 523 SNDGK-LLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKG----------VVVNA 571
           S++GK +L+C ++   +     Y  LD + LC EL  KAK S+ G          VV+ A
Sbjct: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473

Query: 572 EDVQKALISHM 582
            D+Q+ L  H+
Sbjct: 474 GDLQRTLAKHI 484

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 36/79 (45%)

Query: 38  KRRERKPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQLESLNKQSELET 97
           K  ++K GRK ++TEAK+                           +  L+ +N +   ET
Sbjct: 6   KEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSET 65

Query: 98  KFLRNQVTNLLSELKRYNP 116
           ++L+  ++ LL+E+ +Y P
Sbjct: 66  EYLKECLSELLTEVTKYRP 84

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 507 TDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAK--CSE 564
           T ++ N E +   I     G    C+ V   +T  P Y + D++ LC EL  K K    +
Sbjct: 305 TRRVMNNESLRSIIAEKRCGSNDTCAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHD 364

Query: 565 KGVVVNAEDVQKALISHM 582
             + V  EDV+ AL  H+
Sbjct: 365 ASITVGREDVRSALERHI 382

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 45/105 (42%), Gaps = 6/105 (5%)

Query: 38  KRRERKPGRKPLETEAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXVS--QLESLNKQSEL 95
           KRR  +PGRK L+ +AK+                           V   QLE+L+K   +
Sbjct: 6   KRRVGRPGRKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEII 65

Query: 96  ETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDS 140
           E  FL+  V  LL E+K Y  +  K  D  LLD + K     +D+
Sbjct: 66  E--FLKQNVMTLLGEIKNYRKQTNK--DKKLLDTIGKLENDGMDA 106

>Skud_13.6 Chr13 (6426..7358) [933 bp, 310 aa] {ON} YPR199C (REAL)
          Length = 310

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 37/88 (42%), Gaps = 2/88 (2%)

Query: 495 DPAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCL 554
           D    A AS   T    + +    D   S+   LL   ++W  I  H R +  D++ L  
Sbjct: 225 DAMETAAASTVITPGFHSGQRYTTDSFESD--VLLSAMDIWHFIKVHSRVNTFDLENLGT 282

Query: 555 ELRTKAKCSEKGVVVNAEDVQKALISHM 582
           EL+  A CS   ++++ +   +   S +
Sbjct: 283 ELKKTAICSNFDILISLKHFVRVFSSKL 310

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 28/55 (50%)

Query: 528 LLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582
           LL   ++W  +  HP+ +  D++ L  EL+  A CS   ++++ +   K   S +
Sbjct: 240 LLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL 294

>TPHA0J00500 Chr10 complement(111187..113166) [1980 bp, 659 aa] {ON}
           Anc_6.41 YMR006C
          Length = 659

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%)

Query: 331 ALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAW 373
           A NN  SV  + N F+ D    D SHS  TP G++   S+  W
Sbjct: 154 AWNNWTSVQTIVNNFTEDDAIWDISHSIVTPGGINIFKSLGRW 196

>Kpol_1037.12 s1037 (26014..28026) [2013 bp, 670 aa] {ON}
           (26014..28026) [2013 nt, 671 aa]
          Length = 670

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 331 ALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAWQQPS 377
           A NN  SV  + N F+ D    D S+S  TP GLD   +V  W   S
Sbjct: 157 AWNNWTSVQDIVNNFTKDDSIWDISNSIFTPGGLDIAKTVLRWNHIS 203

>TBLA0B00540 Chr2 complement(105246..107435) [2190 bp, 729 aa] {ON}
           Anc_6.41 YMR006C
          Length = 729

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 331 ALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAWQQPS 377
             NN  SV A+ N FS D    D SHS  +  G +   S+  W++ S
Sbjct: 169 GWNNWTSVQAIVNNFSHDDSIWDFSHSAISQGGYNVFKSIDIWKEIS 215

>KLLA0C05940g Chr3 (524768..526690) [1923 bp, 640 aa] {ON}
           uniprot|O59863 Kluyveromyces lactis KLLA0C05940g PLB
           Lysophospholipase precursor
          Length = 640

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 331 ALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAW 373
           A NN  SV A+ N  + D    D S+S   P G++  SS+S W
Sbjct: 160 AYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISRW 202

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,379,004
Number of extensions: 1943910
Number of successful extensions: 7381
Number of sequences better than 10.0: 70
Number of HSP's gapped: 7501
Number of HSP's successfully gapped: 118
Length of query: 583
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 468
Effective length of database: 40,294,809
Effective search space: 18857970612
Effective search space used: 18857970612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)