Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00803g3.564ON95295247560.0
Ecym_25943.564ON10198529191e-107
SAKL0F00880g3.564ON10099998586e-99
Kwal_47.192583.564ON10119998412e-96
AFR269W3.564ON101710308236e-94
Smik_7.203.564ON10049148094e-92
YGL241W (KAP114)3.564ON10049138079e-92
Kpol_380.63.564ON10029067928e-90
NCAS0F039503.564ON10128697921e-89
TDEL0D063203.564ON10188697832e-88
KNAG0D029403.564ON10098557823e-88
NDAI0B062603.564ON10139207781e-87
KLTH0G00792g3.564ON102110067753e-87
Skud_7.263.564ON10159237718e-87
CAGL0H07777g3.564ON10219157673e-86
ZYRO0E09460g3.564ON10098587462e-83
KAFR0J001903.564ON10128837411e-82
TPHA0G036303.564ON102210237402e-82
Suva_7.203.564ON100810307271e-80
TBLA0E002403.564ON101010246971e-76
AFR273W3.561ON96995830.36
TPHA0E029505.229ON726103762.2
Kwal_26.85958.624ON103426762.4
TPHA0N012803.561ON957116735.5
Kpol_499.74.180ON863121726.6
ACL187W4.180ON86152727.2
TBLA0A031005.348ON37268709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00803g
         (952 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar ...  1836   0.0  
Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {...   358   e-107
SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar...   335   6e-99
Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa...   328   2e-96
AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic h...   321   6e-94
Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...   316   4e-92
YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}  KAP114Karyo...   315   9e-92
Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON} ...   309   8e-90
NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {...   309   1e-89
TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]...   306   2e-88
KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {...   305   3e-88
NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]...   304   1e-87
KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar...   303   3e-87
Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (R...   301   8e-87
CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} simil...   300   3e-86
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...   291   2e-83
KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.5...   290   1e-82
TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...   289   2e-82
Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (R...   284   1e-80
TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.56...   273   1e-76
AFR273W Chr6 (923039..925948) [2910 bp, 969 aa] {ON} Syntenic ho...    37   0.36 
TPHA0E02950 Chr5 (619747..621927) [2181 bp, 726 aa] {ON} Anc_5.2...    34   2.2  
Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {...    34   2.4  
TPHA0N01280 Chr14 complement(277121..279994) [2874 bp, 957 aa] {...    33   5.5  
Kpol_499.7 s499 (15347..17938) [2592 bp, 863 aa] {ON} (15347..17...    32   6.6  
ACL187W Chr3 (30322..32907) [2586 bp, 861 aa] {ON} Syntenic homo...    32   7.2  
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...    32   9.6  

>KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar to
           uniprot|P53067 Saccharomyces cerevisiae YGL241W KAP114
           Karyopherin, responsible for nuclear import of Spt15p,
           histones H2A and H2B, and Nap1p; amino terminus shows
           similarity to those of other importins, particularly
           Cse1p; localization is primarily nuclear
          Length = 952

 Score = 1836 bits (4756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 917/952 (96%), Positives = 917/952 (96%)

Query: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
           MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC
Sbjct: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60

Query: 61  LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
           LRKFTTMYWSA            EQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA
Sbjct: 61  LRKFTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120

Query: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
           VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL
Sbjct: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180

Query: 181 NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN 240
           NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN
Sbjct: 181 NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN 240

Query: 241 NMESEVIGLKGELFMALSKLFDLNQSILGSNGDLSYRLRITLDAIKSNANSYARALTNND 300
           NMESEVIGLKGELFMALSKLFDLNQSILGSNGDLSYRLRITLDAIKSNANSYARALTNND
Sbjct: 241 NMESEVIGLKGELFMALSKLFDLNQSILGSNGDLSYRLRITLDAIKSNANSYARALTNND 300

Query: 301 ELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFKLSDFNEFISK 360
           ELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFKLSDFNEFISK
Sbjct: 301 ELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFKLSDFNEFISK 360

Query: 361 ETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQEACLFLFQELCS 420
           ETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQEACLFLFQELCS
Sbjct: 361 ETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQEACLFLFQELCS 420

Query: 421 NETSMNVPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETLPEIKQLVQQFL 480
           NETSMNVPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETLPEIKQLVQQFL
Sbjct: 421 NETSMNVPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETLPEIKQLVQQFL 480

Query: 481 VKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKAIKTLYVXXX 540
           VKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKAIKTLYV   
Sbjct: 481 VKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKAIKTLYVDSE 540

Query: 541 XXXXXXXXXAMHEIVKTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIVFESVRSLPYLLR 600
                    AMHEIVKTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIVFESVRSLPYLLR
Sbjct: 541 EDSLGLLLEAMHEIVKTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIVFESVRSLPYLLR 600

Query: 601 DINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPPVGNHISDEV 660
           DINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPPVGNHISDEV
Sbjct: 601 DINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPPVGNHISDEV 660

Query: 661 AEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWKDSMFDLCSLVFDPERSLYK 720
           AEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWKDSMFDLCSLVFDPERSLYK
Sbjct: 661 AEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWKDSMFDLCSLVFDPERSLYK 720

Query: 721 TIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHPVDSFIIISCEVILKDIQS 780
           TIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHPVDSFIIISCEVILKDIQS
Sbjct: 721 TIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHPVDSFIIISCEVILKDIQS 780

Query: 781 FLAYIFSIPISAEESIPNKLIRELFDCFEENRSKNMLKEVALSLSELFFSNDQRLTRSSY 840
           FLAYIFSIPISAEESIPNKLIRELFDCFEENRSKNMLKEVALSLSELFFSNDQRLTRSSY
Sbjct: 781 FLAYIFSIPISAEESIPNKLIRELFDCFEENRSKNMLKEVALSLSELFFSNDQRLTRSSY 840

Query: 841 HDESDGVVRPFKEYIVKMFADELTRQTDIXXXXXXXXXXXNDITPKDYEEDYVSQLNDDV 900
           HDESDGVVRPFKEYIVKMFADELTRQTDI           NDITPKDYEEDYVSQLNDDV
Sbjct: 841 HDESDGVVRPFKEYIVKMFADELTRQTDIEEEEEEEEEEENDITPKDYEEDYVSQLNDDV 900

Query: 901 VLLTGRVIDMELKEILVQFFKSTQQSNDNSLGRVLKNLDEQERLKILSALFE 952
           VLLTGRVIDMELKEILVQFFKSTQQSNDNSLGRVLKNLDEQERLKILSALFE
Sbjct: 901 VLLTGRVIDMELKEILVQFFKSTQQSNDNSLGRVLKNLDEQERLKILSALFE 952

>Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {ON}
           similar to Ashbya gossypii AFR269W
          Length = 1019

 Score =  358 bits (919), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 251/852 (29%), Positives = 424/852 (49%), Gaps = 24/852 (2%)

Query: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
           M +  L+   QSP K++RE AE +LL  C++DP   F+ LI+ A++ +A  +++Q  L+ 
Sbjct: 13  MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72

Query: 61  LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
           +RK  TMYW+A            E  K++VR  LL L+  +    K++S  +YCIVQI A
Sbjct: 73  IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132

Query: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
           VDFPDEWP LLD + + I   +S NA+SLL E+  D+++ EMFF    G K V  V   L
Sbjct: 133 VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192

Query: 181 NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN 240
           ++ +     K   ++LYH C+ QL +     + E  S+ +  H   +N+ +   L+  GN
Sbjct: 193 SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQ-IAQH---VNETLHIFLQLLGN 248

Query: 241 NM----ESEVIGLKGELFMALSKL-FDLNQSILGSNGDLSYRLRITLDAIKSNANSYARA 295
           +      +E++ LK   +  L+ L     + +   +   S++  + L  + +    Y++ 
Sbjct: 249 HNLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFK-TVALKDLDTLGKYYSQI 307

Query: 296 LTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFK--LSD 353
           L + DE  L+ ++ S IN + +L+ +    +E P + +  E  ++LC LP        +D
Sbjct: 308 LASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTND 367

Query: 354 FNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQEACLF 413
            N F+SKETG+S  Y  RDE+ Q++S      YR+I  ++L++   V   + + QE+ L+
Sbjct: 368 LNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEKQESMLY 427

Query: 414 LFQELCSN--ETSMNVPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETLPE 471
           L Q    N  E  +N     + L     IL+       V SR  +TI K  E  +  L  
Sbjct: 428 LLQSCQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLEN 487

Query: 472 IKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKA 531
           IK +V++F+ KT+    S+ +  + A  +IS+  Y+SF  LGS+L  +    L++ +L  
Sbjct: 488 IKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDI 547

Query: 532 IKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIVFES 591
           I  +Y              +  ++ +     +   K   L  +LKLS+S+P +V++V E+
Sbjct: 548 INDIYAEVDDDTPGFLLEVLSGVIASNPESTNKSLKASELEFVLKLSTSDPYSVQVVVEA 607

Query: 592 VRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPP 651
              L  LL+ +   DY    E C PSF+  +         Y+PLV L+LE L+VFLK  P
Sbjct: 608 QDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNP 667

Query: 652 VGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWKDSMFDLCSLV 711
               +   V EYV  P+   I    D+ + + + +AF +L  NS      D    L + +
Sbjct: 668 SDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKK---DDISSHLQTAI 724

Query: 712 FDPER------SLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHPVDS 765
              ER      S   +  V  ++L  L          + +++E    +LV  N +H V++
Sbjct: 725 MILERLLASDTSYSASSKVGSLLLSVLTKFADQIQDIMPKLLEAAARRLVQVNNIHTVEN 784

Query: 766 FIIISCEVILKDIQSFLAYIFSIPISAE-ESIPNKLIRELFDCFEENRSKNMLKEVALSL 824
            I++ C +   D++  + ++ S+ + ++  S    +I +  D FE  R +  +KE  ++L
Sbjct: 785 LILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVAL 844

Query: 825 SELFFSNDQRLT 836
           S+LFF ND R+ 
Sbjct: 845 SKLFFLNDSRVA 856

>SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1009

 Score =  335 bits (858), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 279/999 (27%), Positives = 490/999 (49%), Gaps = 76/999 (7%)

Query: 11   QSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRKFTTMYWS 70
            QS  K+ERE AE+SLL+  A +P   F+ LID A N+    ++RQ +LL LR+  TMYWS
Sbjct: 13   QSADKKEREAAESSLLQFSAQEPESMFLSLIDIACNS-YPLTSRQFSLLFLRRLVTMYWS 71

Query: 71   AXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDFPDEWPGL 130
            A             +GK +VR  LL L  ++  + K  ++ +YC+VQI AVDFPDEWP L
Sbjct: 72   AGFESYVGPPGVGSRGKSIVRESLLRLSLDDSQDIKTKNSSSYCVVQISAVDFPDEWPDL 131

Query: 131  LDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALNDDTLRLQAK 190
            L  + E I+ ++S +A+SLLTE+  D+++ EMFF    G + +  V   L   T  +++K
Sbjct: 132  LIRIYEAIVEHYSLSAMSLLTEIFDDVVSEEMFFQGGIGWQTIQIVSQVLTSSTSSVESK 191

Query: 191  SKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGNN---MESEVI 247
            S  L LYH C+ QL++     T E     +  H+K M     +LL+ Y ++   ++  ++
Sbjct: 192  SAALDLYHACVLQLQSPQATSTIE-RKHAIAEHIKQMLGLFIQLLQFYQSSQDEIQPTLL 250

Query: 248  GLKGELFMALSKLFDLNQSILGSNGDLSYRLRITLDAIKSNANSYARALTNNDELRLEII 307
             LK  ++  L  L            + +    + L  + + +N Y R+L N D+  ++ +
Sbjct: 251  KLKASIYENLGMLKSNFSKQFFPEEEKNILKGLVLKDLNAISNIYYRSLNNTDDKDIDSL 310

Query: 308  NSSCINTVQYLAYIPSDLIENPT-LPDFTEDFIKLCLLPEDYFKLSD----FNEFISKET 362
            +   I+ + +L+ +  +L+ +PT  P   +   K+C L +   + SD    FN F++KET
Sbjct: 311  DECAIHIIVFLSSL-HELVFSPTETPVLLDSLTKVCCLTDT--QTSDWDNYFNIFVTKET 367

Query: 363  GLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQEACLFLFQELCSNE 422
            GL+ASY+ARDE  Q+ S+ +   Y ++   + Q        + +YQE+ ++L +   +N+
Sbjct: 368  GLAASYSARDESFQFFSNLTGTNYTNLLAFLTQNVHASGIEDWKYQESLMYLMEAAVNND 427

Query: 423  TSMN---VPRYQDFLSLAVMILDDDACPT--FVKSRTILTIPKFFENNMETLPEIKQLVQ 477
              +     P  Q   + + ++    +C T  FVK R IL +PK  E  M++L +IK LV+
Sbjct: 428  EEITNDFQPVLQTLDAFSELLA---SCETNEFVKVRVILILPKILEKFMDSLEDIKLLVK 484

Query: 478  QFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKAIKTLYV 537
            +FL +T     +   D L  + +ISFTYY+SFAEL S+L  +T   L++++LK I  +Y 
Sbjct: 485  KFLFQTFTLVSAPTKDILKVASLISFTYYSSFAELDSVLGTETYQQLKEAVLKIINEIYE 544

Query: 538  XXXXXXXXXXXXAMHEIV-KTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIVFESVRSLP 596
                         +++I+  T + +     + + L L+LK+S+ +PSN+++V E+   L 
Sbjct: 545  DAEDDTPALLLETLNQIIGSTSNAEVIASVRFDELQLILKISAKDPSNIQVVLEAQECLQ 604

Query: 597  YLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPPVGNHI 656
             LL++I+   Y +  E   PSF+  +     S   YSP++ L+LE L+VF+K  P    +
Sbjct: 605  NLLKNISLEIYLKYAEMAIPSFVNVLEGSNSSGFEYSPILSLSLELLTVFMKKKPTNGTL 664

Query: 657  SDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSN-----PKFWKDSMFDLCSLV 711
               + ++V  P+ + +    D+ + +     + +L  NS      P    +++  +   +
Sbjct: 665  PPRITDFVFQPLSETLVGSQDDEVLQLTTDIYSFLINNSENSQIAPHL--NTILSVLEKL 722

Query: 712  FDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHPVDSFIIISC 771
                 S    ++V  +++             I  I+E    +LV  + +   ++ I + C
Sbjct: 723  LSINTSDSAAMNVGSLIIAIFCKLSDQLQETIPTILEAAAKRLVQVHNIATAENLIFVFC 782

Query: 772  EVILKDIQSFLAYIFSIPISAEESIPNKLI-RELFDCFEENRSKNMLKEVALSLSELFFS 830
             +   +    + ++ S+ + +E +   KLI  +  + FE  R +  +KE  L+LS+LFF 
Sbjct: 783  YLTSTNPNQTVDFLSSLVLDSEGNSALKLILPKWLESFEIIRGEKRIKENILALSKLFFL 842

Query: 831  NDQRLTRSSYHDES---DG---------VVRPFK-------EYIVKMFADELTRQT---- 867
            ND+R++    + +S   DG          + P K       E IVK+F  EL+ Q     
Sbjct: 843  NDERISSIIVNGDSIPYDGDLVITRSMSKIMPEKYTQISAYEKIVKLFVAELSFQGNQPG 902

Query: 868  -------DIXXXXXXXXXXXNDITPK---------DYE--EDYVSQLNDDVVLLTGRVID 909
                   D+           ND             +YE  ++YV   +D      G VI 
Sbjct: 903  LEKYIPHDLKKYDDQAIKAANDANDDDWEDVDDVLEYEKLQEYVDDESDLEDDEEGDVIG 962

Query: 910  ME-----LKEILVQFFKSTQQSNDNSLGRVLKNLDEQER 943
            ++      +E+L+QFF+     N +    +  +L++ E+
Sbjct: 963  VQELHQSTRELLIQFFREAAAKNVSGFQEIYNHLNDNEK 1001

>Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa]
            {ON} YGL241W (KAP114) - Kap114p [contig 344] FULL
          Length = 1011

 Score =  328 bits (841), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 275/999 (27%), Positives = 451/999 (45%), Gaps = 65/999 (6%)

Query: 11   QSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRKFTTMYWS 70
            QSP K+ RE  E  + + C+ DP  +   L+  A   +     R  +LL LRK  TMYWS
Sbjct: 13   QSPDKQTREQGEACIWKLCSEDPSFSCACLVQLACRQDYRIENRLFSLLSLRKLITMYWS 72

Query: 71   AXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDFPDEWPGL 130
            A            E  K+L+R  LL L  ++  + ++    +YCIVQI AVDFPDEWPGL
Sbjct: 73   AGFESYRGPPGVNEDCKELIRNSLLELGLDDAQDTRIQKGSSYCIVQIAAVDFPDEWPGL 132

Query: 131  LDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALNDDTLRLQAK 190
            ++ +   IL  HS +A+ +L E+  D+++ EMFF+   G + +  +   LND    + AK
Sbjct: 133  IEIVYNAILRSHSVSALYVLNEIFDDVVSEEMFFNQGVGWQTIQLISNILNDPGCSILAK 192

Query: 191  SKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGNNMESEVIGLK 250
                +LY  C+ QL++ +   T EL S  L  H++     +  LL++Y +N++ E I L 
Sbjct: 193  HSAAKLYQACLLQLQSPAASSTPELRSA-LTNHIQESTKMLLNLLQAY-SNIQDEAIDLL 250

Query: 251  GELFMALSKLFDLNQSILGSNGDLSYRLRITLDAIKSNANSYARALTNNDELRLEIINSS 310
                  L  L  +           +    +T   I++     A +  N +E +   IN  
Sbjct: 251  RLHQTVLKCLTTIRTGFPKKLSSDTIGRELTTVLIENFTRVAALSNDNTEEEKSSEINEV 310

Query: 311  CINTVQYLAYIPSDLIENPTLPDFTEDFI-KLCLLPEDYFKL-SDFNEFISKETGLSASY 368
             I  V  LA IP   +  P L    EDF+   CL  E+     SDFN F+SKE GL++SY
Sbjct: 311  GIQMVSLLATIPDRYLGGPALSKVVEDFVLASCLGTEEEEAWESDFNHFVSKEVGLASSY 370

Query: 369  NARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQEACLFLFQELCSNE---TSM 425
              RDE  Q++   S   Y+ I + ++    +V   E + +EA  +L Q LC NE   T  
Sbjct: 371  YIRDECSQFLQEISGARYQSIFEILVSALSKVDPLEWRLKEAVFYLIQSLCINEDEVTVF 430

Query: 426  NVPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETLPEIKQLVQQFLVKTVN 485
            N     D L+     ++       V++R IL +PK  E  M+ L  +K +V++ L  T+N
Sbjct: 431  NNNEVFDLLNELRQNMEGQNLQLHVRTRAILALPKVVEKFMDRLENVKDIVKELLFATLN 490

Query: 486  CTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKAIKTLYVXXXXXXXX 545
                  D  L AS +I+F+ Y SFAEL S+L  +     +  +L  I+ +          
Sbjct: 491  GACEDNDPTLKASALIAFSSYASFAELDSVLGLEAFQEARCLVLNLIQDVLEDSEDDTPA 550

Query: 546  XXXXAMH-EIVKTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIVFESVRSLPYLLRDINC 604
                A++  + K  +  +D    Q+ LNL+LK+S+ +PSN+++V E+   +  LL   + 
Sbjct: 551  VLLEALNPALAKQSNTTKDTLFYQQALNLVLKISAKDPSNLQVVLEAQDCISALLSGEST 610

Query: 605  TDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPPVGNHISDEVAEYV 664
              Y  L +SC P F+  + T   +   Y+P+V L+LE L+VF+K  P    +   ++ YV
Sbjct: 611  ESYVELSKSCIPLFVNILGTMKANNYIYAPIVSLSLELLTVFMKKKPSDGFLPSNISSYV 670

Query: 665  LNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWK---DSMFDLCSLVFDPERSLYKT 721
              P+   +    D+ I + A  A  YL  NS     +    ++  +   +     S    
Sbjct: 671  FEPLSDILINSSDDEILQVASDALTYLMSNSQASDLEPLLPTVLSILEKLLSVNTSDSGA 730

Query: 722  IDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHPVDSFIIISCEVILKDIQSF 781
            ++V  +++++L            +I+E    + V    +   ++ + + C +   +    
Sbjct: 731  MNVGSLVVITLEKYSYQLQEVYPKILEAATKRFVSAKNVATTENLVFVFCYLTSINPAEA 790

Query: 782  LAYIFSIPISAEESIP-NKLIRELFDCFEENRSKNMLKEVALSLSELFFSNDQR------ 834
            + ++ S  I+ +E    N ++ +  + FE  R +  +KE  ++LS++FF +D R      
Sbjct: 791  INFLSSFTINEKEGNSLNYVLPKWLESFEVLRGERRIKENIVALSKIFFQSDPRVGSVIV 850

Query: 835  ------------LTRSSYHDESDGVVR-PFKEYIVKMFADELTRQTD---------IXXX 872
                        +TRS          R    E IVK+F  EL  Q+          +   
Sbjct: 851  NGDPLPYKGDIIVTRSMAKKMPIEYTRITAHEKIVKLFVAELEFQSSQPSLDKFLPVNAR 910

Query: 873  XXXXXXXXNDITPKDYEEDYVSQLNDDVV-----------------------LLTGRVID 909
                    N+   +D ++D   +  DDV+                       L   + I 
Sbjct: 911  KFDTSSSFNN-NAEDEQDDGEWEDVDDVLEYDQLQQFVVEDGERNDSDDEDSLANIQDIQ 969

Query: 910  MELKEILVQFFKSTQQSNDNSLGRVLKNLDEQERLKILS 948
               KE+L+ FFK     N N+L  + +NL E E+ KILS
Sbjct: 970  QSTKELLIDFFKEAAAKNINNLRDLYENLSEHEK-KILS 1007

>AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGL241W (KAP114)
          Length = 1017

 Score =  321 bits (823), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 280/1030 (27%), Positives = 451/1030 (43%), Gaps = 115/1030 (11%)

Query: 1    MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
            M +  L+   QS  K ERE AE SLLE C  DP    + L+  AT  N   ++RQ  L  
Sbjct: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78

Query: 61   LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
            LRK  TMYW+A            E  K+ VR  LL +  +   + K+IS   YC+VQI A
Sbjct: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138

Query: 121  VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
             DFPDEWPGLL  + E+I    S  A+ LL E+  D+++ EMFF    G + +  +   L
Sbjct: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198

Query: 181  NDDTLRLQAKSKLLQLYHHCISQLR--------------NVSMFVTSELMSEWLIPHLKA 226
             DD   +  K   ++LYH C+ QL                  +    EL ++ L+ H ++
Sbjct: 199  GDDG-PVALKDAAMKLYHSCLLQLAAPQALEEADTRAAVGAHVHEALELFAQ-LLEHCRS 256

Query: 227  MNDCIDKLLESYGNNMESEVIGLKGELFMALSKLF---DLNQSILGSNGDLSYRLRITLD 283
            +    D LL+   +  E+ V+     +   L K F    L +++L    D   R  + L 
Sbjct: 257  LEPHAD-LLQFQAHTYENLVL-----IKTQLPKRFFPGALREALL----DAVLRDLVLLG 306

Query: 284  AIKSNANSYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCL 343
            A       Y + L   DE  L+ +  S I+ V +L+ +    +             ++C+
Sbjct: 307  AY------YEQHLAEGDEELLKAVAESAIHMVIFLSSVHECKLNTE----------RMCM 350

Query: 344  LPEDYFKLS------------DFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITD 391
            L     +LS            D+N FISKETGL++SY  RDEI QY+S      YR    
Sbjct: 351  LLGSLARLSCLSAIQTEAWDVDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLR 410

Query: 392  SVLQKCLQVTSNEAQYQEACLFLFQ--ELCSNETSMNVPRYQDFLSLAVMILDDDACPTF 449
             + ++ LQV S   + QE+ LFL Q  +L S     +       L  +  +L        
Sbjct: 411  VLFEQLLQVESMAWRSQESLLFLLQSCQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPL 470

Query: 450  VKSRTILTIPKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSF 509
            V+ R  +T+P+  E  M++LP +K LV++F+  T N T+++E+  L AS +I+FTYY+SF
Sbjct: 471  VRCRVAMTVPRLLEKYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSF 530

Query: 510  AELGSILDYQTSMILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTKQE 569
             + GS+L  QT+  L++ +L  IK +               +  +       ++   K  
Sbjct: 531  VDFGSVLGVQTAEELEKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLY 590

Query: 570  ILNLLLKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQ 629
             L L+  +++++PSN+++V E+   L  LL+  +  +Y +  E C PSF+E +       
Sbjct: 591  ELQLVQNVATADPSNIQVVVEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHG 649

Query: 630  QTYSPLVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFV 689
              Y+PLV L+LE L VF++  PV + +   + +Y+ +P+   +    D+ + + + +AF 
Sbjct: 650  YAYTPLVSLSLELLVVFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFT 709

Query: 690  YLACNSNPKFWKDSMFDLCSLV-------FDPERSLYKTIDVAPIMLLSLRVTQPHENRF 742
             L  +S      D +     ++            S    I+   +++  L          
Sbjct: 710  ALLASS----LTDDLLGRIPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDI 765

Query: 743  IGQIMEYTISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPI-SAEESIPNKLI 801
            + +I+E    +LV    LH  ++ + + C +   D +  + ++ S  I     +    ++
Sbjct: 766  MPKILEAAAKRLVQIKNLHTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIV 825

Query: 802  RELFDCFEENRSKNMLKEVALSLSELFFSNDQRLTRSSY------HDESDGVVRPF---- 851
                + FE  R ++ +KE  LSLS+LFF  D R+   +       HD    + R      
Sbjct: 826  PRWLEAFEVLRGEHKIKENILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKM 885

Query: 852  ---------KEYIVKMFADELTRQTDIXXXXXXXXXXXNDITPKDYEEDYVSQLNDDV-- 900
                      E IVK+F  EL  Q +                P D E D   +  +DV  
Sbjct: 886  PDKYTQISAAEKIVKLFVAELAFQQNQPDPGRYPKDGSGPADPHDSEGDSADEDWEDVDD 945

Query: 901  ---------------------VLLTGRVIDMELKEILVQFFKSTQQSNDNSLGRVLKNLD 939
                                  LL    I+ +   +L QFFK     N +    +   L 
Sbjct: 946  ILDYEKLQEYADDSDIDDTGDSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLT 1005

Query: 940  EQERLKILSA 949
            EQE+ K LSA
Sbjct: 1006 EQEK-KSLSA 1014

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W
           (REAL)
          Length = 1004

 Score =  316 bits (809), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 253/914 (27%), Positives = 440/914 (48%), Gaps = 68/914 (7%)

Query: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
           M+I  L+   QS  K  RE AE  LL+ C ++    F  L + A  + +   +RQ ALL 
Sbjct: 1   MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60

Query: 61  LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
           LRK  TMYWS                KD +R  LL L  N++   K+I+  +YCIVQI A
Sbjct: 61  LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120

Query: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
           VDFPD+WP LL  + + I + HS NA+SLL E+  D+++ EMFF+   G + V  +   L
Sbjct: 121 VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180

Query: 181 NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN 240
             DT  L AK   L+L+  C+ Q+ + + +      S         ++ C+   L+  G 
Sbjct: 181 ATDTSTLVAKFAALKLFKACLLQMSSHNGYDEESRKS--------FISQCLSTSLQRLGQ 232

Query: 241 NMESEVIGLKGELFMALSKLFDLNQSILGSN-----GDLSYRLRITLDAIK-------SN 288
            +    +G   E  ++  KL    +SI+  N      D S +   ++D  K        +
Sbjct: 233 LL---TMGFHSENVVSQLKL----KSIIYENLVLIKNDFS-KNHFSIDLQKQFKIVTVQD 284

Query: 289 ANSYARALTNNDELRLEIINSSC----INTVQYLAYIPSDLIENPTLPDFTEDFIKLCLL 344
            N+ A   TN + +  E I+ +     I  V++L  + +    +  +         LC +
Sbjct: 285 LNNIAHLDTNGNSIEYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQV 344

Query: 345 PEDYFKL--SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTS 402
             +  +L  SDFN F+SKETGL+ASYN RD+  +++ S S+ +   I  SV+ K ++  +
Sbjct: 345 NSEIMELWISDFNTFVSKETGLAASYNVRDQSSEFLISLSNPLLSLIF-SVISKDIERNT 403

Query: 403 NEAQYQEACLFLFQELCSNETSMNVPRYQDFLSLAVMILDDDACPTFVK----SRTILTI 458
            + Q  E+ L+L Q +  N+  +      + L   +    +      VK    +R IL I
Sbjct: 404 YDNQILESLLYLLQSVLLNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVI 463

Query: 459 PKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDY 518
           PK  +  ++ LP+IK L  +FL K+++  +  +++ + ++ +I+FTYY  FAEL S+L  
Sbjct: 464 PKVLDKFIDVLPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGP 523

Query: 519 QTSMILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTKQEIL----NLL 574
                +Q  +++ I  +               + +++   +  + L +K+EIL    +L+
Sbjct: 524 DVCSEIQGKVIQIINDINSDSEEDTNGAIMEVLSQVIS--YNPKGLDSKEEILQAEFHLV 581

Query: 575 LKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSP 634
             +SS +P+NV++V +S   L  LL +IN  +Y    E C PSFI  + +   +   YSP
Sbjct: 582 FTISSKDPANVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSP 641

Query: 635 LVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACN 694
           L+ L LEF++VFLK  P+   + DE+ +Y+  P+ + +    +E   + A ++F YL  N
Sbjct: 642 LLSLVLEFITVFLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFN 701

Query: 695 SNPKFWKDSMFDLCSL---VFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTI 751
           ++ +  +  + D+  +   +   E S    ++V P+++             +G+I+E  I
Sbjct: 702 TDTQVMEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVI 761

Query: 752 SKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCFEEN 811
            +LV    +    + + + C +   D +  + ++ +  I  + ++ + ++++  + FE  
Sbjct: 762 VRLVKAQNISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNAL-SLVMQKWMEAFEVI 820

Query: 812 RSKNMLKEVALSLSELFFSNDQRL------------------TRSSYHDESDGVVR-PFK 852
           R +  +KE  ++LS LFF +D RL                  TRS      D  V+ P  
Sbjct: 821 RGEKRIKENIVALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLY 880

Query: 853 EYIVKMFADELTRQ 866
             I+K+F  EL  Q
Sbjct: 881 TKIIKLFVSELGFQ 894

>YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}
           KAP114Karyopherin, responsible for nuclear import of
           specific proteins; cargoes include Spt15p, Sua7p,
           histones H2A and H2B, and Nap1p; amino terminus shows
           similarity to those of other importins, particularly
           Cse1p; localization is primarily nuclear; function is
           regulated by sumoylation
          Length = 1004

 Score =  315 bits (807), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 253/913 (27%), Positives = 442/913 (48%), Gaps = 64/913 (7%)

Query: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
           M I  L+ G QS  K  RE AE  LL+ C +D    F  L + A  + AS  +RQ ALL 
Sbjct: 1   MDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLS 60

Query: 61  LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
           LRK  TMYWS                KD +R  LL L  N++   K+ +  +YCIVQI A
Sbjct: 61  LRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISA 120

Query: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
           VDFPD+WP LL  + + I + HS NA+SLL E+  D+++ EMFF+   G   +  V   L
Sbjct: 121 VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVL 180

Query: 181 NDDTLRLQAKSKLLQLYHHCISQLRNVSMF---VTSELMSEWLIPHLKAMNDCIDKLLES 237
           N +T  L AK   L+L   C+ Q+ + + +        +S+ L   L+ +      L  +
Sbjct: 181 NTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQL---LTLN 237

Query: 238 YGNNMESEVIG-LKGELFMALSKLF---DLNQSILGSNGDLSYRLRITLDAIKSNANSYA 293
           +GN    +VI  LK +  +  + +F   D ++    S     +++ + +  +++  +  A
Sbjct: 238 FGN---VDVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKI-MAIQDLENVTHINA 293

Query: 294 RALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFKL-- 351
              T   E  LE ++   I  V++L  + +       +         LC L  +  ++  
Sbjct: 294 NVETTESEPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWT 353

Query: 352 SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQ--- 408
           SDFN F+SKETGL+ASYN RD+        ++E +  + +  L    +V SN+ ++    
Sbjct: 354 SDFNTFVSKETGLAASYNVRDQ--------ANEFFTSLPNPQLSLIFKVVSNDIEHSTCN 405

Query: 409 ----EACLFLFQELCSNETSMNVPRYQDFLSLAVMILDD----DACPTFVKSRTILTIPK 460
               E+ L+L Q +  N+  +        L + +  L++       P  + +R ILTIP+
Sbjct: 406 YSTLESLLYLLQCILLNDDEITGENIDQSLQILIKTLENILVSQEIPELILARAILTIPR 465

Query: 461 FFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQT 520
             +  ++ LP+IK L   FL K++N  + ++ + + ++ +I+FTYY  FAEL S+L  + 
Sbjct: 466 VLDKFIDALPDIKPLTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEV 525

Query: 521 SMILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTKQEIL----NLLLK 576
               Q+ +++ I  +               + +++   +  ++ H+++EIL    +L+  
Sbjct: 526 CSETQEKVIRIINQVSSDAEEDTNGALMEVLSQVIS--YNPKEPHSRKEILQAEFHLVFT 583

Query: 577 LSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLV 636
           +SS +P+NV++V +S   L  LL +IN  +Y    E C PSFI  + +   +   YSPL+
Sbjct: 584 ISSEDPANVQVVVQSQECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLL 643

Query: 637 VLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSN 696
            L LEF++VFLK  P    + DE+ +Y+  P+ + +    ++   + A +AF YL  N++
Sbjct: 644 SLVLEFITVFLKKKPNDGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTD 703

Query: 697 PKFWKDSMFDLCSL---VFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISK 753
            +  +  + D+  +   +   E S    ++V P+++             IG+I+E  + +
Sbjct: 704 TRAMEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVR 763

Query: 754 LVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCFEENRS 813
           L+    +    + + + C +   D +  + ++ S  I   +++   ++R+  + FE  R 
Sbjct: 764 LIKTQNISTEQNLLSVLCFLTCNDPKQTVDFLSSFQIDNTDAL-TLVMRKWIEAFEVIRG 822

Query: 814 KNMLKEVALSLSELFFSNDQRL------------------TRSSYHDESDGVVR-PFKEY 854
           +  +KE  ++LS LFF ND+RL                  TRS      D  V+ P    
Sbjct: 823 EKRIKENIVALSNLFFLNDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTK 882

Query: 855 IVKMFADELTRQT 867
           I+K+F  EL+ Q+
Sbjct: 883 IIKLFVSELSFQS 895

>Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON}
           complement(8594..11602) [3009 nt, 1003 aa]
          Length = 1002

 Score =  309 bits (792), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 240/906 (26%), Positives = 437/906 (48%), Gaps = 51/906 (5%)

Query: 3   IPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLR 62
           I  L+   QSP    RE AE+ LL  C  D    F  +I   +N     S+R  ALL LR
Sbjct: 4   IHQLINLAQSPDNSVREKAESELLAACDEDACIVFHSMIQVGSNGFEELSSRLFALLTLR 63

Query: 63  KFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVD 122
           K  TMYWS             E+ K+  R  LL +  ++  + K+ +   YC+VQI AVD
Sbjct: 64  KLITMYWSPGFESYRLNSTLNEEIKNNFRDSLLKICLDDSQDTKIKNASAYCVVQISAVD 123

Query: 123 FPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALND 182
           FPD+WP LL+ +   I+  HS +AISLL E+  D+++ EMFF+   G++ +  +   L D
Sbjct: 124 FPDQWPTLLNEVYGAIMERHSLSAISLLNEIYDDVMSEEMFFEEGIGSETIRIIFSVLTD 183

Query: 183 DTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGNNM 242
           +   + AK    +L+H C+ Q+        S L  + +    + + +CI ++L  +   +
Sbjct: 184 NNTGIAAKIASSKLFHSCLLQM--------SVLDPQSVHKRKQLVTECISQILTIWSGLL 235

Query: 243 ESEVIGLKGELFMALSKLFDLNQSI-------LGSNGDLSYRLRITLDAIKSNANSYARA 295
           + + +      F   SK+++    I       L S  ++    R+ ++ +   A  Y   
Sbjct: 236 QKQNVTEMSSEFELRSKIYEDLAMIKSEFPRKLFSKENIEIFRRLVINDLNIAAKCYNNV 295

Query: 296 LTN-NDELRLEIINSSCINTVQYLAYIPSDLIENPT-LPDFTEDFIKLCLLPEDYFK--L 351
           L++ N +  +  IN   I+ +++L  I SD   +P  +   ++ F+ L  +  +  +   
Sbjct: 296 LSSENSDTEMIHINEFVIHIIEFLTAI-SDFKFSPEDIGTISKSFVTLSCIDRNTEESWT 354

Query: 352 SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQY--QE 409
           +DFN FISKETGL AS+  RD+I  ++S+ ++ +Y      +L +  ++ ++ + +  QE
Sbjct: 355 ADFNSFISKETGLFASFTIRDQIADFISNVNEGVYSGFYSLILNEFNEIINSNSDWRTQE 414

Query: 410 ACLFLFQELCSNETSMNVP---RYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNM 466
           + L+L Q + ++ET +N       Q  ++    I+ +    +FV  R+ILTIPK  E  M
Sbjct: 415 SVLYLLQCIATSETEINESLQCNTQILVTAIGNIISNPPTQSFVLMRSILTIPKLLEKFM 474

Query: 467 ETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQ 526
           ETLP++K+  +Q L  +++  +S+ D+ + +S +I+FTYYTSFAEL S+L      + Q+
Sbjct: 475 ETLPDVKEYTKQLLSISLDIALSSSDELVQSSGLIAFTYYTSFAELNSVLGDVACRVEQE 534

Query: 527 SLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTKQEI-LNLLLKLSSSEPSNV 585
            +LK I+ L               ++ ++     Q    T  E+  + LL +S  +PSN+
Sbjct: 535 KVLKLIQNLSNDSEEDTNGVLVEVLNNVIDCNSPQHLDETILEVEFDFLLTISVKDPSNI 594

Query: 586 RIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSV 645
           +++ E+   L  L+  ++   Y +      P  I  ++   Q+  +YSPL+ LALEF+++
Sbjct: 595 QLIVEAQECLEKLIESMDINLYNKYAHKLLPFLINVINECNQTGYSYSPLLSLALEFINI 654

Query: 646 FLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKF---WKD 702
            ++N P    +   + E + +P+   +    ++   + A +AF +L  NS       + +
Sbjct: 655 LMRNRPDDISLPTYICEQLFSPLRHILMVSQEDETLQLATEAFSFLLFNSQTDVIFPYLE 714

Query: 703 SMFDLCSLVFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHP 762
            + ++ S +   + S    ++V  +++             I  I+  T  K ++   +  
Sbjct: 715 EIINVLSRLLSMDISDTAAMNVGSLVVTIFTKFSEQVQELIPGILRATTDKFINAKNIST 774

Query: 763 VDSFIIISCEVILKDIQSFLAYIFSIPISA--EESIPNKLIRELFDCFEENRSKNMLKEV 820
             + + + C ++  D    + +++++ I    + S+P  L + L + FE  R +  +KE 
Sbjct: 775 SQNLVSVFCLLVCTDPARTIDFLYNLEIGTPPQSSLPLVLTKWL-ESFEIIRGEKKIKEN 833

Query: 821 ALSLSELFFSNDQR------------------LTRSSYHDESDGVVR-PFKEYIVKMFAD 861
            L+LS+++F  D R                  +TRS      D   R    + IVK+F  
Sbjct: 834 ILALSKIYFLKDSRVSSIEVNGDIIPYTGDLIITRSMAKSMPDKYTRVSVYQKIVKLFVA 893

Query: 862 ELTRQT 867
           EL  QT
Sbjct: 894 ELGFQT 899

>NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {ON}
           Anc_3.564 YGL241W
          Length = 1012

 Score =  309 bits (792), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 240/869 (27%), Positives = 426/869 (49%), Gaps = 53/869 (6%)

Query: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
           M I  L+   QS   + RE AEN L   C  +    F  L+  A +  +  STRQ +LL 
Sbjct: 1   MDIYQLITQAQSSDTQTREAAENQLSSSCDQNASQIFTSLMSVALDPKSPLSTRQFSLLT 60

Query: 61  LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
           +RKF TMYWS             E  K+ +R  LL L  ++  + K+ ++ +YCIVQI A
Sbjct: 61  IRKFITMYWSPGFQSYRNTSTIQENTKEYIRNSLLQLCLDDAQDTKIKNSASYCIVQISA 120

Query: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
           VDFPD+WP LL  +   I   HS NA+SLL E+  D+I+ EMFF+   G + +  +   L
Sbjct: 121 VDFPDQWPQLLSTIYMAIEQNHSLNALSLLNEIYDDVISEEMFFEGQIGMETLQIIFQLL 180

Query: 181 NDDTLRLQAKSKLLQLYHHCISQLRNV---SMFVTSELMSEWLIPHLKAMNDCIDKLLES 237
            ++   L+AK    +L++ C+ Q+  V   S     E + E +   L+ +     +LLE 
Sbjct: 181 TNNNANLKAKIAGTKLFNACLLQMSVVDSSSKHNRKEFVKECIFKALEVLG----QLLEL 236

Query: 238 YGNNMESEVIGLKGELFMAL--------SKLFDLNQSILGSNGDLSYRLRITLDAIKSNA 289
           Y  + +S ++ L+ +++  +         KLF   Q+  G     S+R    L+A  +  
Sbjct: 237 YPVSNDSLILNLRTKIYENVVLISNEFSRKLF--TQAFKGLYKLQSFR---DLEACSNQF 291

Query: 290 NSYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYF 349
           N++   L+  D   LE +N   I+ + +L  I         +    +    LC L  D  
Sbjct: 292 NAFLENLSQADNDILESMNECVIHVLDFLTSISDSDFTMQEINLIVQSLTFLCCLDSDTL 351

Query: 350 KL--SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEA-- 405
           +    DFN+F+SKETGL AS+  RD+  +++S  S+  Y +  +S+  + +   + +   
Sbjct: 352 EQWSEDFNDFVSKETGLLASFTIRDQAAEFMSGLSNPNYSNFFNSIYAQVIYSLTGDVND 411

Query: 406 QYQEACLFLFQELCSNET----SMNV-PRYQDFLSLAVMILDDDACPTFVKSRTILTIPK 460
             +E+ L+L Q L +NE      +N+ P     L     + ++    TF+ SR IL  PK
Sbjct: 412 NLRESLLYLLQTLLTNEEDNDHDINIEPSV--ILKQFSSVFENGLQKTFLLSRIILLTPK 469

Query: 461 FFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQT 520
             E  M+ L ++KQL   +L +T++  +   ++ + +S +I+FTYY+ FAEL S+L  + 
Sbjct: 470 LLEKFMDQLQDVKQLTGNYLRRTLDLALETHNEIIKSSSIIAFTYYSYFAELPSVLGPEL 529

Query: 521 SMILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTK--QEILNLLLKLS 578
             I+Q++ LK I  L               +++I+ + +  ++L  +  Q   NL+L +S
Sbjct: 530 CSIVQENTLKIISELSKEAEEDTNGLLMETLNQII-SCNVHENLSPEILQTEFNLVLSIS 588

Query: 579 SSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVL 638
           S +P+NV++  E+   L +LL  +N   Y    + C PSFI  +     +Q  Y+P++ L
Sbjct: 589 SKDPANVQVTVEAQDCLEHLLEGMNTETYLHYVDICLPSFIHTIDASAINQYRYTPVLSL 648

Query: 639 ALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPK 698
            LEFL++F+K  PV   +   ++++    +   +    ++   + A  AF Y+  N+ P 
Sbjct: 649 ILEFLTIFMKKKPVDGFLPTSISDFSFKSLCNLLSLSTEDETLQLATDAFSYMVYNTEPS 708

Query: 699 FWKDSMFDLCSLVFDPERSLYKTI-DVAPIMLLSLRVT---------QPHENRFIGQIME 748
                + D+ +++   +R L   + D A + + +L VT         QP     I  I+ 
Sbjct: 709 AMVPKLQDIINVL---DRLLSINVSDTAAMNVGTLVVTLFSKFSNEIQP----LIPTILR 761

Query: 749 YTISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCF 808
             + +L+    +    + + + C +   D +  +  +++    ++ S   K++ + F+ F
Sbjct: 762 AAVGRLIQAQNISTQQNLVSLLCFLTCSDPKQVIDLLYN--FDSDHSTFTKVMNKWFESF 819

Query: 809 EENRSKNMLKEVALSLSELFFSNDQRLTR 837
           E  R +  +KE  ++LS+L+F+ D+RL +
Sbjct: 820 ETIRGEKKIKENIVALSKLYFTGDERLGK 848

>TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]
           {ON} Anc_3.564 YGL241W
          Length = 1018

 Score =  306 bits (783), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 238/869 (27%), Positives = 414/869 (47%), Gaps = 51/869 (5%)

Query: 6   LLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRKFT 65
           L++  QS     R  AE  LLE    D    F+  +  A+++    S+RQ AL+ LRK  
Sbjct: 12  LIKEAQSADDVVRRSAEAQLLELSDRDASLVFLSFMKVASDSQELLSSRQFALVSLRKLI 71

Query: 66  TMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDFPD 125
           TMYWS             E+ K+ VR  LL L  N+    KVIS   YC+VQI AVDFPD
Sbjct: 72  TMYWSPGFESYRSCSNLKEEAKETVRDYLLKLCLNDQEISKVISAAAYCVVQISAVDFPD 131

Query: 126 EWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALNDDTL 185
           +WP LL  L + ILN HS +A+SLLTE+  D+++ EMFF+   G + +  V   + D   
Sbjct: 132 QWPKLLTVLYDGILNKHSLSAMSLLTEIYDDVMSEEMFFEEGIGLETIRIVFQIVRDPNT 191

Query: 186 RLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMN-DCIDKLLESYGNNMES 244
            L+AK     L+H C+ Q+  V +            P  K M  +C  + L  +G +++S
Sbjct: 192 NLEAKLAGFNLFHACLQQILTVDLNSA---------PKRKEMTVECAKEALTVWGEHLQS 242

Query: 245 EVIG-------LKGELFMALSKLF-DLNQSILGSNGDLSYRLRITLDAIKSNANSYARAL 296
             I        +KG ++  LS +  +L++ ++     + ++  + +D   +     + + 
Sbjct: 243 HSITEHSLQLQIKGRIYEDLSLMKNELSKKLIPDALYVPFKELVLIDLETAGKVYLSISQ 302

Query: 297 TNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFK--LSDF 354
              +  RL+ +N   I+ +++L       +++  +        +LC L  D     L DF
Sbjct: 303 GFVEGYRLDDLNECAIHIIEFLTATCHFTMDSAEVERIITALGELCCLDNDTVTLWLEDF 362

Query: 355 NEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKC--LQVTSNEAQYQEACL 412
           N +IS E+GL+ASY+ RD+  + ++S     Y  +   +L K   L     E ++QE+ L
Sbjct: 363 NSYISMESGLTASYSVRDQASELLTSMDGRNYSLVCQHILYKVSHLNEWKQEWKFQESFL 422

Query: 413 FLFQELCSNET--SMN-VPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETL 469
           FL Q    NE+  S N +   ++ LS    +L  +   +FV SR IL +PK  E  M+ L
Sbjct: 423 FLVQAAALNESLPSGNFINEIREVLSFLGSMLCSEDVVSFVSSRIILLLPKILEKYMDLL 482

Query: 470 PEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLL 529
            +++ L    L K+    ++  DD + AS++I+FTY ++FAEL S+L  +   I Q+ +L
Sbjct: 483 DDVRILTSHLLTKSAELALATNDDIIKASVLIAFTYCSNFAELSSVLGQEVCEITQKRVL 542

Query: 530 KAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTK--------QEILNLLLKLSSSE 581
             I  +               ++ ++       D +T         Q   +L+LK+S+ +
Sbjct: 543 GLIARISEDAEDDTDGVLMEVLNNVI-------DCNTPGVPNNEIVQTEFSLVLKISAKD 595

Query: 582 PSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALE 641
           P+N++IV ES   L  LL +++   Y    E+  PSF++++    Q++  YSPL+ L L+
Sbjct: 596 PANIQIVVESQECLEKLLENLDIDHYKNYVETWLPSFMKSIEGSAQTKYAYSPLLSLVLQ 655

Query: 642 FLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWK 701
           FL+ FLK  P    +   +      P+ Q +    D+   + A +AF Y   N++P    
Sbjct: 656 FLTTFLKK-PTDYQLPTVMCNLTFEPLRQILLNSEDDETIQLATEAFSYFLYNTDPTVVA 714

Query: 702 DSMFDLCSLVFDPERSL-YKTIDVAPIMLLSLRVT-----QPHENRFIGQIMEYTISKLV 755
             +  + +++   +R L +   D A + + SL VT            +  I+    ++L+
Sbjct: 715 PHLEAIVAIL---DRLLSFDVSDAAAMYVGSLIVTVFTRFSTEIENMMPIILRAAANRLI 771

Query: 756 DPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPI-SAEESIPNKLIRELFDCFEENRSK 814
               L    + + + C +   D +  + ++F + + + E +    ++    + FE  R +
Sbjct: 772 QAKHLSTSQNLLSVFCFLTSVDPRQTVDFLFGLHLDNTEHNALYSIVSIWLESFESIRGE 831

Query: 815 NMLKEVALSLSELFFSNDQRLTRSSYHDE 843
              KE  ++L +L+  +D+RL     +DE
Sbjct: 832 RRTKENVIALIKLYLLHDKRLMEMQVNDE 860

>KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {ON}
           Anc_3.564 YGL241W
          Length = 1009

 Score =  305 bits (782), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 239/855 (27%), Positives = 412/855 (48%), Gaps = 29/855 (3%)

Query: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASAST-RQLALL 59
           M++  L+  +QSP    R  AE++L+     D       LI+ A N+     T RQ ALL
Sbjct: 1   MNMDELIALLQSPDNSVRTQAESNLMTVSDEDASHVLQSLINVALNSAEKPLTERQFALL 60

Query: 60  CLRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQIC 119
            +RK  T YWS                K  VR  LL L  N+  + K+  + +YCIVQI 
Sbjct: 61  SMRKLITFYWSPAFESYRNTATLDLLTKQYVRDSLLQLSLNDSQDTKIKKSASYCIVQIS 120

Query: 120 AVDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLA 179
           AVDFPDEWP LL+ L   I N+HS +AISLL E+  D+I+ EMFF+   G + +  +   
Sbjct: 121 AVDFPDEWPKLLEELYGAITNFHSLSAISLLNEIYDDVISEEMFFEGGIGLETLQIIFQL 180

Query: 180 LNDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYG 239
           L+ D   ++AK   + L+H  + Q+  V    T E   E +   +    D +  LLE   
Sbjct: 181 LSSDASTIEAKLAAINLFHATLLQMSTVDSHTTQEKRKEMVRNCVPICLDTLRTLLEGLA 240

Query: 240 NNMESEVIGLKGELFMALSKLFDLNQSILGSNGDLSY-RLRITLD--AIKSNANSYARAL 296
           +   +  + LKG ++ +L  + +   + L  +  + Y +++   D  A++ N +S+A   
Sbjct: 241 DINSALPLQLKGSIYKSLEFIKNKFPTQLFPSQFVEYFKIQAVRDLVALQINQDSFA--- 297

Query: 297 TNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFK--LSDF 354
              D+  +E  N   I+ ++ ++ I              +  + L  L  +  +   +DF
Sbjct: 298 ---DDTVVEAFNECAIHVIELISSIEITEYGTEDQHAILKALLSLSRLDANTKESWTTDF 354

Query: 355 NEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQ--EACL 412
           N+F+SKETGL+AS+  RD++  Y+ + +    + + +++LQ    + S+ A     E+ L
Sbjct: 355 NDFVSKETGLAASFTIRDQVADYLGTPTGAQSQTMFENILQLVSDILSSNADPTTIESSL 414

Query: 413 FLFQELCSNETSMNVPRYQDFLSLAVMILDDDACPT----FVKSRTILTIPKFFENNMET 468
           FL Q + + +T  +V   Q  + L   ++      T     ++SR ILTIPK  +  M++
Sbjct: 415 FLLQSVLAEDTDFSVSSPQTLVQLISALIGPQTINTHNDSILRSRIILTIPKILDVFMDS 474

Query: 469 LPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSL 528
           LP IKQL +  L+KT+   +S+ D+ +  S +I+FTYY  FAEL S+L  ++   LQ+++
Sbjct: 475 LPNIKQLTKDLLLKTLQDALSSTDELIFCSTLIAFTYYVYFAELPSVLGSESCRELQEAV 534

Query: 529 LKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIV 588
           L  +  +               ++ ++       D    Q+ L  +L +SS +PSN+ + 
Sbjct: 535 LGIVNHVASEAEEDTNGLLIEVLNHVISCNVASTDFKLLQKELTAMLSISSKDPSNIEVS 594

Query: 589 FESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLK 648
            ES   L  LL +IN   Y +    C PSF+  +      +  Y+PL+ L LEF+ +F+K
Sbjct: 595 VESQECLEKLLDNINTERYNKFISICLPSFVNIIKGNQPLKYKYNPLLSLILEFVRIFMK 654

Query: 649 NPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWKDSMFDLC 708
             P    +    +E ++  +V  +++  ++   + A  AF +L  N++P      +    
Sbjct: 655 KKPTNGMLPRNFSEGIIALLVDILERSEEDETLQLATAAFSHLLNNTDPTI----VIQHL 710

Query: 709 SLVFDPERSLYKTI--DVAPIMLLSLRVT-----QPHENRFIGQIMEYTISKLVDPNKLH 761
           ++V    + L      D A   + +L VT            I  I+E  I +L+D   + 
Sbjct: 711 TVVIKVLKRLLSMFVSDTAAQNVGTLIVTLFNKYSKELTNLIPDILESAIYRLIDAKNVT 770

Query: 762 PVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCFEENRSKNMLKEVA 821
             ++ I + C V   D    + ++F    S    IP+ +  + F+ FE  R +  +K+  
Sbjct: 771 TQENLISLICYVTCCDPLQMVNFLFKFSESERRDIPSLMFNKWFETFEIVRGERKIKDNI 830

Query: 822 LSLSELFFSNDQRLT 836
           ++LS++FF +D RLT
Sbjct: 831 IALSKIFFLSDFRLT 845

>NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]
           {ON} Anc_3.564 YGL241W
          Length = 1013

 Score =  304 bits (778), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 248/920 (26%), Positives = 433/920 (47%), Gaps = 70/920 (7%)

Query: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
           M I  L+   QS     R+ AE+ LL+ C T+    F  L+  A + N   ++RQ ALL 
Sbjct: 1   MDINQLIVQAQSSDNAVRDAAESQLLQACDTNAAQIFTSLMKGACDGNTDIASRQFALLS 60

Query: 61  LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
           LRK  TMYWS             +Q K+ +R  LL++  ++  + K+  +  YC+VQI A
Sbjct: 61  LRKLITMYWSPGFESYRNTSTINDQTKEYIRESLLNICLDDLQDSKITKSAAYCVVQISA 120

Query: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
           VDFPD+WP LL  L + I   HS NA+SLL E+  D+++ EMFF+   G + +  +   L
Sbjct: 121 VDFPDQWPQLLVILYDTISQSHSLNAMSLLNEIYDDVVSEEMFFEGQIGMETLQIIFQVL 180

Query: 181 NDDTLRLQAKSKLLQLYHHCISQLR--NVSMFVTSELMSEWLIPHLKAMNDCIDKLLESY 238
           +++  +++AK    +L++ CI Q+   + S  +  + ++E  IP  K++   + +LLE Y
Sbjct: 181 SNNEGKIEAKIAATKLFNACILQMSVLDPSSSLKRKKLAEECIP--KSIQ-VLGQLLEYY 237

Query: 239 ------GNNMESEVIGLKGELF--MALSKLFDLNQSILGSNGDLSYRLRITLDAIKSNAN 290
                  + M + ++ L+ +++  + L K  +L + +   N   S++ + TL  + S+  
Sbjct: 238 TIDTTVDSKMLTSILELRSKIYENVVLIK-NELPKRLFQRNLMASFKFQ-TLKDLSSSCT 295

Query: 291 SYARALTNNDELRLEIINSS---------CINTVQYLAYIPSDLIENPTLPDFTEDFIKL 341
            Y     NN    +E++NS           I+ + +L    S   +N  +    +D   L
Sbjct: 296 LYETYCLNN----IEVVNSDNLHDALSECSIHMLDFLTATCSLKFDNSEVSTIVQDLTVL 351

Query: 342 CLLPEDYFK--LSDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQ 399
           C L  D  +   +DFN F+SKETGL  SY  RD+  ++++S SD  Y  I  +++   + 
Sbjct: 352 CCLDNDSQEELAADFNAFVSKETGLLPSYTIRDQASEFLNSLSDPNYATILQAIINTFIS 411

Query: 400 VT---SNEAQYQEACLFLFQELCSNETSMNVPRYQDFLSLAVMILDDDACPTFVKSRTIL 456
                S   +  E+ L+L Q L +NE  +        L     + D +    F+ SR IL
Sbjct: 412 TMNQPSRNDRILESILYLLQSLMTNEDDVTNINPNILLEPLSSLFDYETENPFLHSRLIL 471

Query: 457 TIPKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSIL 516
            IPK  E  M+ +P +K + + FL K++  ++   D     S +I +TYY  FAEL S+L
Sbjct: 472 LIPKILEKFMDEIPNVKVVTKDFLTKSLKYSLQMNDGLNKISALIGYTYYAYFAELPSVL 531

Query: 517 DYQTSMILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIV----KTWHFQQDLHTKQEILN 572
                  +Q+++L  I  +               ++ ++    +    Q  L T+     
Sbjct: 532 GRDVCTQVQENILLLITQVVHESEEDTHGLLVEVLNHVIDCNPEDIAVQGILETE---FY 588

Query: 573 LLLKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTY 632
           ++L +SS +P+N+++   S   L  LL  +N   YT   + C PSFI  +     ++  Y
Sbjct: 589 MVLSISSKDPANIQVAIGSEECLEKLLEGVNTRTYTHYIDMCLPSFINVIKGHSVTEYKY 648

Query: 633 SPLVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLA 692
           SPL+ L LEF++VF+K  P    +   + E++  P++  +    ++   + A  AF YL 
Sbjct: 649 SPLLSLILEFVTVFMKKKPTDGPLPAIIFEHIFQPLLNVLNHSTEDETLQLATDAFSYLL 708

Query: 693 CNSNPKFWKDSMFDLCSLVFDPERSLYKTI-DVAPIMLLSLRVT-----QPHENRFIGQI 746
            N++       + ++ +++   +R L   + D A + + +L VT            I  I
Sbjct: 709 YNTDSTLMIPHLEEIVAVL---DRLLSINVSDTAAMNVGTLIVTIFSKFSNELQSLIPTI 765

Query: 747 MEYTISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFD 806
           +   ++KLV    +    + I + C +   D    + +++   +    S    ++ + F+
Sbjct: 766 LRAAVTKLVQAKNISTQQNLISLLCFLTCTDPLQTIEFLYG--LDETHSTFAAVMNKWFE 823

Query: 807 CFEENRSKNMLKEVALSLSELFFSNDQRL------------------TRSSYHDESDGVV 848
            FE  R +  +KE  L+LS+L+F+ D RL                  TRS      D   
Sbjct: 824 AFEVIRGEKKIKENILALSKLYFTCDPRLGSLLVNGDLIPYEGDLIITRSMAKTMPDKYT 883

Query: 849 R-PFKEYIVKMFADELTRQT 867
           + P    I+K+F  EL+ QT
Sbjct: 884 QIPAYTKIIKLFVSELSFQT 903

>KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1021

 Score =  303 bits (775), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 265/1006 (26%), Positives = 452/1006 (44%), Gaps = 76/1006 (7%)

Query: 9    GIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRKFTTMY 68
            G QS   + RE++EN+L   C+ +P  T   L+  A     +   R  +LL LRK  TMY
Sbjct: 22   GAQSTNGQVRENSENALWSLCSENPSATCTSLMQLACGIENAVEDRIFSLLSLRKLITMY 81

Query: 69   WSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDFPDEWP 128
            WSA            ++GK ++R  LL+L  ++  + ++ +  +YCIVQI AVDFPDEWP
Sbjct: 82   WSAGFESYRGPPGIGDEGKRMIRESLLNLGLDDSQDTRLKNCSSYCIVQIAAVDFPDEWP 141

Query: 129  GLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALNDDTLRLQ 188
             L+D + + IL   S +A+ +L E+  D+++ EMFF    G + +  +   L++     Q
Sbjct: 142  TLVDSIFDAILQRQSLSALYVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRILSNSDSSTQ 201

Query: 189  AKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESY--GNNMESEV 246
            AK+   +LY  C+ QL++  M  +++     L  H++     + K+L+ +     + +  
Sbjct: 202  AKTASAKLYQACLLQLQS-PMATSTQDYKYALSNHIQESVLLLIKVLKEHHIAKGINTSA 260

Query: 247  IGLKGELFMALSKL---FDLNQSILGSNGDLSYRLRITLDAIKSNANSYARA---LTNND 300
            + L+  L   L+ +   F      + S  +L       ++ +  N    A     +T + 
Sbjct: 261  LNLQQVLLSCLNTIKTGFSKKLFTIESAQEL-------IEFLFENFRKIAELCIDVTIDP 313

Query: 301  ELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFKL--SDFNEFI 358
            +++L   N   I  V   A +   L EN       E F+   ++ ++  +   +DFN F 
Sbjct: 314  DMKLA-ANEVGIQMVSLFATLMDTLTENQNWNFIVESFVIAGMISDEDAECWDNDFNVFA 372

Query: 359  SKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQEACLFLFQEL 418
            SKETGLS S+  RDE  Q++   S   Y  + +++    +   S   + QE+ LF  Q L
Sbjct: 373  SKETGLSTSFTVRDECEQFMQGLSGFAYNSVFNALTSALIYNESPNWKVQESILFFIQAL 432

Query: 419  CSN---ETSMNVPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETLPEIKQL 475
            C N   E S N  + Q  L+    IL+ +     VK+R+++ +PK  E  METL  +K L
Sbjct: 433  CGNEDDEVSFNFEKTQSLLNTLRQILELEDSHILVKTRSLIALPKVIERFMETLESVKAL 492

Query: 476  VQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKAIKTL 535
            V+  L  + +         +    +ISFTYY SFAEL S+L        Q+S+   I+ L
Sbjct: 493  VKDSLFHSFSLARQTPSYTVKIGCLISFTYYASFAELDSVLGPGFYGEAQRSVSAIIQEL 552

Query: 536  YVXXXXXXXXXXXXAMHEIVKTWH-FQQDLHTKQEILNLLLKLSSSEPSNVRIVFESVRS 594
                          A+   + + H   + +   Q  L L+LK+SS  PSN+++  E+   
Sbjct: 553  LEEAEEDTPSILLEALAPTLSSNHKTTETISFYQLALQLILKISSKHPSNIQVGLEAQDC 612

Query: 595  LPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPPVGN 654
            L  LL+  +  +Y    ++C P F   ++  ++++  Y+P+V L+LE L+VF+K  P   
Sbjct: 613  LSNLLKSTSTEEYVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSLEMLTVFIKRKPRDG 672

Query: 655  HISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNP-KFWKDSMFDLCSL--V 711
             +  ++  YV NP+   +    D+ I +    A VYL  NS P + +      LC L  +
Sbjct: 673  CLPSDITSYVFNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQLFPHLNVVLCDLEKL 732

Query: 712  FDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHPVDSFIIISC 771
               E S    I V  ++++ L            +I+E    K +  + +   ++   + C
Sbjct: 733  LSAETSDSGAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGAHNVFTTENLANVFC 792

Query: 772  EVILKDIQSFLAYIFSIPI-SAEESIPNKLIRELFDCFEENRSKNMLKEVALSLSELFFS 830
             ++  +    + ++ S  I   E+S+   ++ +  + FE  R +  +KE  ++LS+LFF 
Sbjct: 793  YLVSLNPAEVINFLSSFSIDQQEQSVLCPVLSKWLESFEVLRGEKRIKENIMALSKLFFQ 852

Query: 831  NDQR------------------LTRSSYHDESDGVVR-PFKEYIVKMFADEL---TRQTD 868
             D R                  +TRS      +   R    + IVK+F  EL   T QTD
Sbjct: 853  ADSRIDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIVKLFVAELDFQTSQTD 912

Query: 869  IXXXXXXXXXXXNDIT---------PKDYE----------------EDYVSQLNDDVVLL 903
            +              T           D+E                +D  S   D+  ++
Sbjct: 913  LEKYIPMSAKKTECSTIANAEAGQEESDWEDVDDVLEYEQLQHFVDQDTFSSDRDEEDVI 972

Query: 904  TG-RVIDMELKEILVQFFKSTQQSNDNSLGRVLKNLDEQERLKILS 948
             G + +    +E+L+ FFK     N N    +  NL E E+ +ILS
Sbjct: 973  PGIKNVQQSTRELLISFFKEAASQNINDFKTIYDNLSENEK-RILS 1017

>Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W
           (REAL)
          Length = 1015

 Score =  301 bits (771), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 252/923 (27%), Positives = 438/923 (47%), Gaps = 82/923 (8%)

Query: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
           M I  L+   QS     RE AE  LL+ C +D    F  L++ A    ++  +RQ ALL 
Sbjct: 11  MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTALVNAALQQQSALQSRQFALLS 70

Query: 61  LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
           LRK  TMYWS              + K+ +R  LL L  N++   ++ +  +YCIVQI A
Sbjct: 71  LRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130

Query: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
           VDFPD+WP LL  + + I   HS NA+ LL E+  D+++ EMFF+   G +    +   L
Sbjct: 131 VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190

Query: 181 NDDTLRLQAK--------SKLLQLYHH--------------CIS-QLRNVSMFVTSELMS 217
             +T  L AK        + LLQ+  H              CIS  L+ +   +T    +
Sbjct: 191 VAETSSLVAKIAALKLLKACLLQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250

Query: 218 EWLIPHLKAMNDCIDKLLESYGNNMESEVIGLKGELFMALSKLFDL-NQSILGSNGDLSY 276
           E +I  LK +   I + L    N+   +    K +    L  + DL N S++ +N D  Y
Sbjct: 251 EDVISQLK-LKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDY 309

Query: 277 RLRITLDAIKSNANSYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTE 336
                       + ++ + + +     +E + S C  T+ +     S +I   T      
Sbjct: 310 ----------PESENFVKTVHDCSVYIVEFLTSVC--TISFTIEEISVIIGALT------ 351

Query: 337 DFIKLCLLPEDYFKL--SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVL 394
               LC +  D  +L  SDFNEF+SKETGL+ASYN RD+  ++ +S S+     I   V+
Sbjct: 352 ---TLCKVGSDASELWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIF-GVV 407

Query: 395 QKCLQVTSNEAQYQEACLFLFQELCSNE---TSMNVPR-YQDFLSLAVMILDDDACPTFV 450
            K + + ++  Q  E+ L+L Q +  N+   +S N+ +  Q+ L +    L         
Sbjct: 408 SKNIDLNTSNHQTFESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELT 467

Query: 451 KSRTILTIPKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFA 510
            +R IL IPK  +  ++ LP+IK +  +FL K+++  +  + + + ++ +I+F YY  FA
Sbjct: 468 LARVILVIPKLLDKFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFA 527

Query: 511 ELGSILDYQTSMILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTKQEI 570
           EL S+L  Q    LQ+ +++ I  +               +++++   +  +  ++K+E+
Sbjct: 528 ELDSVLGPQLCTELQEKVIQIINEISNDAEEDTNGTIMEVLNQVIS--YNSKGPYSKKEV 585

Query: 571 L----NLLLKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFL 626
           L    +L+  +SS +P+NV++V +S   L  LL DIN  +Y    E C PSFI  ++   
Sbjct: 586 LQAEVHLVFTISSKDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNAND 645

Query: 627 QSQQTYSPLVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQ 686
           ++   YSPL+ L LEF++VFLK  P   ++ DE+ +Y+  P+ + +    ++   + A +
Sbjct: 646 ENNYKYSPLLSLVLEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATE 705

Query: 687 AFVYLACNSNPKFWKDSMFDLCSL---VFDPERSLYKTIDVAPIMLLSLRVTQPHENRFI 743
           AF YL  N++ +  +  + D+  +   +   E S    ++V  +++             +
Sbjct: 706 AFSYLIFNTDTQTMQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLV 765

Query: 744 GQIMEYTISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRE 803
           G+I++  + +LV    +    + + + C +   D +  + ++ S  I  +E++ + ++ +
Sbjct: 766 GRILQAVVVRLVKAQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEAL-SLVMSK 824

Query: 804 LFDCFEENRSKNMLKEVALSLSELFFSNDQRL------------------TRSSYHDESD 845
             + FE  R +  +KE  ++LS+ FF ND RL                  TRS      D
Sbjct: 825 WMEAFEVIRGERKIKESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPD 884

Query: 846 GVVR-PFKEYIVKMFADELTRQT 867
             V+ P    I+K+F  EL  Q 
Sbjct: 885 KYVQVPLYTKIIKLFISELGFQA 907

>CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P53067 Saccharomyces cerevisiae YGL241w
           KAP114
          Length = 1021

 Score =  300 bits (767), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 263/915 (28%), Positives = 435/915 (47%), Gaps = 73/915 (7%)

Query: 6   LLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRKFT 65
           L+E  QSP    RE AE  LL  C T+  + F  LI+   NN    ++R  +LL LRKF 
Sbjct: 9   LIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIELGENNQTPLASRLFSLLSLRKFI 68

Query: 66  TMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDFPD 125
           TMYWS                K+ +R  LL L  ++    KV ++ +YC+VQI AVDFPD
Sbjct: 69  TMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDDQQSNKVRNSSSYCVVQISAVDFPD 128

Query: 126 EWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALNDDTL 185
           EWP LL  L   I   HS NA+SLL E+  D+I+ EMFF+   G + +  +   L +  +
Sbjct: 129 EWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISEEMFFEGGIGYETLQIIFTLLTNAQV 188

Query: 186 RLQAKSKLLQLYHHCISQ---LRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGNNM 242
           RL +K+  L+L+  CISQ   L N S      L+SE L   L+ +     KLL      +
Sbjct: 189 RLASKTSALKLFGACISQMSVLDNNSSQKRKLLVSECLGQALQTI-----KLLLEQCEII 243

Query: 243 ESEVIGLKGELFMALSKLFDLN-------QSILGSNGDLSYRLRITLDAIKSNANSYARA 295
           +S++  +   L    +   D+N       +     + +L Y   I +  +   A  Y  +
Sbjct: 244 QSDLTSINETLEFKDNLYDDINSIKENFPRKFFPEDVNL-YVTNIAVRDLDQLAGLYQES 302

Query: 296 LTNN-DELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLC---LLPEDYFKL 351
             +N DE  + I  +  I+ + +LA  P   + N  + +     I LC    L +D ++ 
Sbjct: 303 FKDNFDEQSMSIFENCVIHLLDFLAN-PISPLNNELISNILTASITLCEQSALTKDSWE- 360

Query: 352 SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQ--- 408
           SDFNEF SKETGLSAS+  RDE+ + V++   EI +   ++  +  +   SN + +    
Sbjct: 361 SDFNEFASKETGLSASFTIRDEVAELVNAF--EIPQ--LETSFELIVGYLSNNSSHLSAD 416

Query: 409 --EACLFLFQELCSNE-----TSMNVPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKF 461
             E+ L+L Q L + E     TS+ VP   +F+    M+   +      + R +L IPK 
Sbjct: 417 KIESALYLLQCLMNVEDDFSNTSL-VPSLIEFIK--SMLSQQNNLDQMSQIRLLLLIPKT 473

Query: 462 FENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTS 521
               M+ LP +KQL  + L + ++   ++    ++ S +ISFTY+ S+AE+ S+L    +
Sbjct: 474 LAKFMDILPNVKQLTAETLNEILSMATNSNSHLIIISALISFTYFASYAEILSVLGNDQT 533

Query: 522 MILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQ-QDLHTKQEILNLLLKLSSS 580
           +++Q   L  I+ +               ++ ++        ++   +    L+L +S  
Sbjct: 534 LLVQNKTLHLIQEISEESTEDTNGLLMEVLNCVIDCNDKNVANMELFKFEFKLILVISGK 593

Query: 581 EPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLAL 640
           +P+N+++  ES   L  LL ++N  DY    + C PSFI  + +   +  +YSPL+ L L
Sbjct: 594 DPANIQVSIESQECLEKLLLNVNTNDYLSFVDICIPSFINIIKSSEVTNYSYSPLLSLVL 653

Query: 641 EFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSN---- 696
           EF++VF+KN P    +   V+EYV +P+V  + +  +E + + A +AF Y+  NS+    
Sbjct: 654 EFITVFMKNKPQEALLPSSVSEYVFDPLVSCLLKSTEEELLQIATEAFSYMIHNSSKDVI 713

Query: 697 -PKFWKDSMFDLCSLVFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLV 755
            PK   +++ ++   +     S    ++V  ++L  +       N  +  I+   + KLV
Sbjct: 714 TPKL--ETIVNILDRLLSSNISDSAAMNVGTLILALITEYSEPMNPLLPSIISAAVRKLV 771

Query: 756 DPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPI---SAEESIPNKLIRELFDCFEENR 812
             N +    + + + C ++  D +  + ++  + I     E+     +I++  D F   R
Sbjct: 772 VSNNITTQQNLVTLLCFLVCHDPKQTVDFLCELTIKNDKGEQVALPVIIQKWLDTFAVVR 831

Query: 813 SKNMLKEVALSLSELFFSNDQR------------------LTRS---SYHDESDGVVRPF 851
            +N +KE  ++LS+LF   D R                  +TRS   S  D    V  P 
Sbjct: 832 GENRIKENIVALSQLFLLGDDRVNEVKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAP- 890

Query: 852 KEYIVKMFADELTRQ 866
            E IVKMF  EL  Q
Sbjct: 891 -EKIVKMFLGELGFQ 904

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa]
           {ON} similar to uniprot|P53067 Saccharomyces cerevisiae
           YGL241W
          Length = 1009

 Score =  291 bits (746), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 231/858 (26%), Positives = 395/858 (46%), Gaps = 42/858 (4%)

Query: 4   PYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRK 63
           P L+   QSP    R+ +E  LL+ C  D    F++ +  A +      +RQ ALL LRK
Sbjct: 5   PSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVAADTQQELPSRQFALLTLRK 64

Query: 64  FTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDF 123
             TMYW+              + + ++R  LL L  +E    K+ +  +Y +VQI AVDF
Sbjct: 65  LVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAVDF 124

Query: 124 PDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALNDD 183
           PD+WP LL+ +   I+  HS  A+ LL E+  D+I+ EMFF+   G + +  V   +N  
Sbjct: 125 PDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEMFFEEGIGFETLKIVFHVMNSY 184

Query: 184 TLRLQAKSKLLQLYHHCISQLRNVSMFVTS-----------ELMSEWLIPHLKAMNDCID 232
               +AK   L L H CI Q+  V+   T+           E++  W +  L   N  I 
Sbjct: 185 DANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMW-VNFLTTQNKTIS 243

Query: 233 KLLE-SYGNNMESEVIGLKGELFMALSKLFDLNQSILGSNGDLSYRLR-ITLDAIKSNAN 290
           + L+   G  +   +  LK E           ++ I+    D+ ++ R I +  +++ + 
Sbjct: 244 ETLQLMAGAKIYQGLTLLKNE----------FSKKIVAP--DMYHQFRTIVMRDLENASQ 291

Query: 291 SYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFK 350
            Y + + N+ + +L+ IN   +N +++L+ +         L        +LC L +D   
Sbjct: 292 IYMQMVENSSQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVD 351

Query: 351 --LSDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVT--SNEAQ 406
              +DFN F+SKETGL AS+  RD+  + +SS   + Y  +   ++ +  Q++  S+   
Sbjct: 352 SWQTDFNSFVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWI 411

Query: 407 YQEACLFLFQELCSNETSMNVPRYQDFLSLAVM----ILDDDACPTFVKSRTILTIPKFF 462
           + E+ L+L Q L  NE   N   + D ++        IL+      FV  R IL IPK  
Sbjct: 412 FNESLLYLLQSLLLNEA--NSLEFMDAVTRIFTKLQSILEKSLSCVFVNCRIILLIPKLL 469

Query: 463 ENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSM 522
           E  M++ P ++ LVQ FL  +++  +S +++ + ++ +ISFTYY+ FAEL S+L     +
Sbjct: 470 EKIMDSFPNVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCI 529

Query: 523 ILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTK--QEILNLLLKLSSS 580
            +QQ  LK I  LY              +  ++       D  +   Q   +L+  +SS 
Sbjct: 530 QVQQKTLKLIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSK 589

Query: 581 EPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLAL 640
           +PSN++   E    L  LL++++   +    E CFP  +  M     S   YSPL+ L L
Sbjct: 590 DPSNIQTTIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPLLSLTL 649

Query: 641 EFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKF- 699
           + L V +K  P+   +S  +   V  P+   + Q  DE I + A +A  YL  N+  +  
Sbjct: 650 QVLGVLMKRKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVI 709

Query: 700 --WKDSMFDLCSLVFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDP 757
                S+ ++   +  P         V  + +             I  I++   ++L   
Sbjct: 710 LPHLKSIVNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQA 769

Query: 758 NKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCFEENRSKNML 817
             +    + + + C V   D Q  + ++F+  IS +  + N ++ +  + F+  R +   
Sbjct: 770 TNITTTQNLLSVFCFVTSADAQQTVDFLFNTTISNQNGL-NLVMSKWLESFDVVRGEKRT 828

Query: 818 KEVALSLSELFFSNDQRL 835
           KE  ++LS+LFF NDQRL
Sbjct: 829 KENIITLSKLFFLNDQRL 846

>KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.564
           YGL241W
          Length = 1012

 Score =  290 bits (741), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 237/883 (26%), Positives = 439/883 (49%), Gaps = 59/883 (6%)

Query: 3   IPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLR 62
           I  L+   QSP    RE AE  LL+ C ++    F  L D A NN+   + RQ ALL LR
Sbjct: 5   ISQLISQAQSPDNSLREHAEQQLLQSCDSNASLIFQALTDVAINNSNKLAARQFALLSLR 64

Query: 63  KFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVD 122
           K  T YWS                K  +R  L+ L  +++ + K+ S+ +YC+ QI AVD
Sbjct: 65  KLITFYWSPGFESYRNTSQIDLDTKSSLRNYLIQLALDDNQDSKIKSSASYCVTQISAVD 124

Query: 123 FPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL-N 181
           FPD+WP LL  L   I  ++S +AI LL E+  DI++ EMFF+ + G + ++ V   L +
Sbjct: 125 FPDQWPELLSILYGCITQHYSLSAIKLLNEIYDDIVSEEMFFEGNIGLETLSIVYQLLES 184

Query: 182 DDTLRLQAKSKLLQLYHHCISQLRNVSMFVT---SELMSEWLIPHLKAMNDCIDKLLESY 238
            D + +QA+  L+ L +  I+Q+ NV   +T    +L+SE  IP    +   +  +LE  
Sbjct: 185 GDNVSIQARIALVDLLNATITQMTNVDSNLTEKRKQLLSES-IPRALGL---LSNILEMS 240

Query: 239 GNNMESEVIGLKGELFMALSKLF-DLNQSILGSNGDLSYRLRITLDAIKSNANSYARALT 297
             ++ ++ +   G+++  L  +  +L +    +    +Y+ RITL+ +    N YA ++T
Sbjct: 241 HRDISTDSLTFIGKIYEILVLIKNELPKKFFSAQTRDAYK-RITLNTLSLLQNKYA-SMT 298

Query: 298 NNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTED--------FIKLCLL----P 345
              E  LE  +   I+T+++L  +  +        +FTE+         + LC L     
Sbjct: 299 EPAETELESFSECAIHTLEFLTSLSYN-------TNFTEEERTIILNSLLVLCSLDPVTK 351

Query: 346 EDYFKLSDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEA 405
           E +  L+DFN F+SKETGL  SY  RD+  ++++S  D+ ++ I  S+ Q    + S+ +
Sbjct: 352 ETW--LADFNHFVSKETGLLPSYTIRDQSFEFLTSLIDQNFQLILKSIFQYFFTLISSSS 409

Query: 406 QYQ-----EACLFLFQELCSNETSMNVPRYQDFLSLAVMI--LDDDACPTFVKSRTILTI 458
                   E   +L Q + SN+  +     ++  S+  ++  L  +   + + SR IL +
Sbjct: 410 PSVDPSQLETTFYLLQSILSNDDDIENVNNEEITSVLRVLPSLLTNVHDSLMVSRIILAL 469

Query: 459 PKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLL-ASLVISFTYYTSFAELGSILD 517
           PK  E  M+ LP++K +VQ FLV++    +    D+++ +S++ISFT Y  FAEL S+L 
Sbjct: 470 PKILEKFMDDLPDVKAMVQTFLVQSTELALRLSGDYIIKSSVLISFTSYCYFAELPSVLG 529

Query: 518 YQTSMILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTKQEIL----NL 573
            +    +Q+S+L  +K +               ++ I++        +T QEIL    +L
Sbjct: 530 PELCASIQKSILTLMKQVSNESEDDTNGLLTEVLNNIIEC----NSTNTSQEILQTEFSL 585

Query: 574 LLKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYS 633
           L  +SS +PSNV+IV ES  SL  LL ++    Y    +   P FI  +     +   YS
Sbjct: 586 LFSISSKDPSNVQIVVESQESLEKLLTNVTEKVYLEYIQIYLPPFINIIHANSTTSYRYS 645

Query: 634 PLVVLALEFLSVFLKNPPVGNHISDE-VAEYVLNPIVQFIKQCPDENIAETALQAFVYLA 692
           PL+ L LEF+++F+K  P  + I  E +   +  P+V  +    ++   +    AF Y+ 
Sbjct: 646 PLLSLVLEFITIFMKKKPSDSKILPESIIANLFQPLVDILTTSTEDETLQLTTDAFTYII 705

Query: 693 CNSNPKF---WKDSMFDLCSLVFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEY 749
            N++ +    + +++ ++   +   + +    ++V  +++          +  I  I+  
Sbjct: 706 YNTDSEKVMPYLETVVNILDRLLSLDVTDTAAMNVGTLIVTIFTKFSAQISSLIPTILNA 765

Query: 750 TISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCFE 809
            +++L+D   +    + + + C +   + Q  + ++F++P   +++I   ++ + F+ FE
Sbjct: 766 AVNRLIDCKNISTQQNLVSLLCFLFYSNTQETVDFLFNLP---QQNIVRDVLIKWFESFE 822

Query: 810 ENRSKNMLKEVALSLSELFFSNDQRLTRSSYHDESDGVVRPFK 852
             R +  +KE  ++L +L+  +D++L    +  + +G + P++
Sbjct: 823 IIRGEKKIKENIIALGKLYCLHDEKL----FSIKVNGDIIPYE 861

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1022

 Score =  289 bits (740), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 256/1023 (25%), Positives = 468/1023 (45%), Gaps = 86/1023 (8%)

Query: 6    LLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRKFT 65
            L+   QS     RE+AE+ LL++C  +    F  LI+ A N N   S+RQ  +L L+K  
Sbjct: 7    LIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLI 66

Query: 66   TMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDFPD 125
            TMYWS             E+ K+ +R  LL L  N + + K+ S+ +YCIVQI A+DFPD
Sbjct: 67   TMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPD 126

Query: 126  EWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALNDDTL 185
             WP LL  +   IL  HS  A+SLL E+  D+I+ EMFF+   G + + T+         
Sbjct: 127  LWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISEEMFFEGGVGEETIKTIFAIFTSPET 186

Query: 186  RLQAKSKLLQLYHHCISQ---LRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGNNM 242
             ++AK    +L H  + Q   L N   F   + +S+ +   L    D +  +L     N 
Sbjct: 187  NIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCITKLL----DILLTILPHLDVNQ 242

Query: 243  ESEVIGLKGELFMALSKLFDLNQSILGSNGDLSYRLRITLDAIKSNANSYARAL-TNNDE 301
              + + LK   +  L+ +       L  N  ++    I+L  ++   +SY + + ++   
Sbjct: 243  SEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDASG 302

Query: 302  LRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFKL--SDFNEFIS 359
             +L++IN   ++ + +++ +     +   L       + LC L  + ++   SDFN FIS
Sbjct: 303  SQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTFIS 362

Query: 360  KETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQY--QEACLFLFQE 417
            KE GL A+Y  RD+  Q+ S      Y      +L++  +   N   +  QE+ L+  Q 
Sbjct: 363  KEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTLQS 422

Query: 418  LCSNETSMN---VPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETLPEIKQ 474
            + S+E   N   +   ++ L+    +L D +    VKSR +L  PK+ E  ME+   +K 
Sbjct: 423  IISSEEEFNSELLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAVKP 482

Query: 475  LVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKAIKT 534
            + ++ L  ++N +++   + L +S++I+F+YY S+A+L S+L     + +QQ LLK IK 
Sbjct: 483  MTKELLSTSLNLSLNTSSEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKIIKD 542

Query: 535  LYVXXXXXXXXXXXXAMHEIV--KTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIVFESV 592
            +               +  ++   +     D   +    N+LL++S  +P N+++  ES 
Sbjct: 543  IANDAEEDTYAICVETISNVIDNNSSGTGSD-EVRDNEFNILLEISFKDPGNIQLSVESQ 601

Query: 593  RSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPPV 652
              L  LL  ++ + Y    E   P  I+ ++    +   YSPL+ L L+FL  F+K  PV
Sbjct: 602  ECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKPV 661

Query: 653  GNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWK---DSMFDLCS 709
             + +  E+++ V NP+ + +    +E   + A +AF +L  NS+    +   +++ ++ S
Sbjct: 662  DSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVLS 721

Query: 710  LVFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHPVDSFIII 769
             +     S    ++V  +++             +  I++ T  K V+   +    + +++
Sbjct: 722  KLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLMV 781

Query: 770  SCEVILKDIQSFLAYIFSIPI--SAEESIPNKLIRELFDCFEENRSKNMLKEVALSLSEL 827
             C +I  D Q  + +++++ +    EE+    ++++  + F+  R +  +KE  ++LS++
Sbjct: 782  FCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSKI 841

Query: 828  F------------------FSNDQRLTRSSYHDESDGVVR-PFKEYIVKMFADELTRQT- 867
            +                  +S D+ +TRS      D   + P  E IVK+F  EL  Q+ 
Sbjct: 842  YLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQSK 901

Query: 868  ----------DIXXXXXXXXXXXNDITPK----------------DYE--EDYVSQLNDD 899
                      DI           N +  K                DYE  ++YV   +D+
Sbjct: 902  NISDANLHSIDI---QKLARAEENQVEQKLDSSEDDDWEDVEDVLDYEKLQEYVDDDDDE 958

Query: 900  VV---------LLTGRV---IDMELKEILVQFFKSTQQSNDNSLGRVLKNLDEQERLKIL 947
            +            TG++   I+  + E+++ FFK     N NS   +  +L E E+  + 
Sbjct: 959  LANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLA 1018

Query: 948  SAL 950
            +AL
Sbjct: 1019 NAL 1021

>Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (REAL)
          Length = 1008

 Score =  284 bits (727), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 284/1030 (27%), Positives = 470/1030 (45%), Gaps = 108/1030 (10%)

Query: 1    MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
            M I +L+ G QS     RE AE  LL+ C +D    F  L   A ++  S  +RQ ALL 
Sbjct: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60

Query: 61   LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
            LRK  TMYWS                K+ +R  LL+L  N +   K+ +  +YCIVQI A
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIREALLNLCLNANENTKIKNGASYCIVQISA 120

Query: 121  VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
            VDFPD+WP LL  + + I  +HS NA+SLL E+  D+++ EMFF+   G + V  +   L
Sbjct: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180

Query: 181  NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLE-SYG 239
              +   L AK   L+L+  C+SQ            MS     + ++ N+ I++ L  S  
Sbjct: 181  TTEASNLVAKIAALKLFKACLSQ------------MSSHDKHNDESRNNFINQCLSTSLQ 228

Query: 240  NNMESEVIGLKGELFMALSKLFDLNQSILGSN-----GDLS-------YRLRITLDAIKS 287
               +   + L  E     SK     +SI+  N      + S       ++++  L AIK 
Sbjct: 229  TLGQLLTLDLVNEDVTCQSKF----RSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKD 284

Query: 288  NANSYARALTNN---DELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLL 344
              N  +  + +    +E  LE + +  +  V++L  + S       +    +    LC +
Sbjct: 285  LKNIASMNVNDGPTENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRV 344

Query: 345  PEDYFKL--SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTS 402
              D  +L   DFN F+SKETGL+ASYN RD++ ++ +S SD     + D V Q  +Q TS
Sbjct: 345  DSDTTQLWIGDFNYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTS 404

Query: 403  NEAQYQEACLFLFQELCSNE---TSMNVPR-YQDFLSLAVMILDDDACPTFVKSRTILTI 458
            N  Q  E+ L+L Q +  N+   T  N+ +  Q  +      L          +R IL I
Sbjct: 405  NH-QTLESLLYLLQCILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILII 463

Query: 459  PKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDY 518
            PK  +  ++ LP+IK L   FL  +++  +    + + ++++I+FTYY  FAEL S+L  
Sbjct: 464  PKVLDKFIDVLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGP 523

Query: 519  QTSMILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDLHTKQEIL----NLL 574
            +    +QQ++++ I  +               ++E++      +  H  +E+L    +L+
Sbjct: 524  EACTEVQQNIIQIINEISDDAEEDTNGTIMEVLNEVISCN--TKGPHHSEEVLQAEFHLV 581

Query: 575  LKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSP 634
              +SS +P+NV++V +S   L  LL +I   +Y    E C PSFI  +     +   Y+P
Sbjct: 582  FSISSKDPANVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTP 641

Query: 635  LVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACN 694
            L+ L LEF++VFLK  P    +  E+ +++  P+ + +    ++   + A +AF YL  N
Sbjct: 642  LLSLVLEFITVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFN 701

Query: 695  SNPKFWKDSMFDLCSLVFDPERSLYKTI-DVAPIMLLSLRVTQPHENRFIGQ-------I 746
            ++ +  +  + D+  ++   ER L   + D A + + SL VT     RF G+       I
Sbjct: 702  TDTQVMEPRLMDIMKVL---ERLLSLEVSDSAAMNVGSLVVTIF--TRFSGEIQPLVERI 756

Query: 747  MEYTISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFD 806
            ++  + +LV    +    +   + C +   D +  + ++ S  I   +++ + ++ +  +
Sbjct: 757  LQAVVIRLVKAQNISTQQNLFSVLCFLTCNDPKQTVDFLCSFQIDNMDAL-SLVMPKWME 815

Query: 807  CFEENRSKNMLKEVALSLSELFFSNDQRL------------------TRSSYHDESDGVV 848
             FE  R +  +KE  ++L +LF  +D RL                  TRS      D  V
Sbjct: 816  SFEVVRGERRIKENIIALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYV 875

Query: 849  R-PFKEYIVKMFADELTRQ-----------TDIXX----------XXXXXXXXXNDITPK 886
            + P    I+K+F  EL  Q           TDI                     +     
Sbjct: 876  QVPLYTKIIKLFVSELGFQNKQPNPEQLITTDIAKDAANNDNDDDNDADNDDWEDVDDVL 935

Query: 887  DYE--EDYVSQLNDDVVLLTGRVID--MELKE----ILVQFFKSTQQSNDNSLGRVLKNL 938
            DYE  +DY+    D         I   M++KE    ILV FFK     + +   R+ ++L
Sbjct: 936  DYEKLKDYIGDDVDGGEEDDSEDITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESL 995

Query: 939  DEQERLKILS 948
             E ER K+LS
Sbjct: 996  SENER-KVLS 1004

>TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.564
            YGL241W
          Length = 1010

 Score =  273 bits (697), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 281/1024 (27%), Positives = 465/1024 (45%), Gaps = 96/1024 (9%)

Query: 1    MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60
            + I  L++  QSP+   RE AENSLLE C  D    F  L + A NN    S+RQ +LL 
Sbjct: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDACSAFAALANVAANNTEILSSRQYSLLA 62

Query: 61   LRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120
            LRK  TMYWS             E  K  VR  +L L  +++ + K+  + +YCIVQ+ A
Sbjct: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122

Query: 121  VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180
            VDFPD WP LL  L ++IL  HS  A+S+L E+  DII+ EMFF+   G + +  +   L
Sbjct: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182

Query: 181  NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN 240
            +D T  ++ K    +L++ C+ Q+  VS   TS          LK MN  ID L E    
Sbjct: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVS--PTSS---------LKRMNLVIDSLKEIISK 231

Query: 241  ---------------NMESEVIGLK--GELFMALSKLF-DLNQSILGSNGDLSYRLRITL 282
                           + E  ++  K  G ++  L+ +  + ++ IL  N    +R + +L
Sbjct: 232  WEQILQFPLEDALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFR-KCSL 290

Query: 283  DAIKSNANSYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLC 342
              +   +  Y   ++  D +    +N   I+  +YL+ I     E   L    E   KLC
Sbjct: 291  QDLTPASTLYINMIS-GDNIAFNALNKYIIHIFEYLSNISRANYEREELILILESIYKLC 349

Query: 343  LLPEDYFKL--SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSV---LQKC 397
             L     +   S+FNEF+SKE GL ASY+ RD+I  ++ S S   +  I       L  C
Sbjct: 350  CLDNLIVETWNSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNC 409

Query: 398  LQVTSNEAQYQEACLFLFQELCSN-ETSMNVPRY--QDFLSLAVMILDDDACPTFVKSRT 454
            L +   + +  E+ L++FQ L  N E  +NV     ++ LS            T + SR 
Sbjct: 410  LII--EDWRQLESMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRL 467

Query: 455  ILTIPKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGS 514
            IL IPK  E  M+ +  IK +  +FL +++   +   +  + +S ++    Y SFAEL +
Sbjct: 468  ILLIPKILEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLT 527

Query: 515  ILDYQTSMILQQSLLKAIKTLYVXXXXXXXXXXXXAMHEIVKTWHFQQDL-HTKQEILNL 573
            +L  +T   +QQ  LK I  +               ++ ++        L    Q+  NL
Sbjct: 528  VLGDKTCQEVQQITLKIILQILDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNL 587

Query: 574  LLKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYS 633
            +L ++S +PSNV++  ES   L  LL  +N  +Y+   E CFPS ++ +     +Q  YS
Sbjct: 588  ILSITSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYS 647

Query: 634  PLVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLAC 693
             L+ LALEF+++F+K  P   ++  E+ +++ NP+   +    ++   + +  AF YL  
Sbjct: 648  ALLSLALEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIY 707

Query: 694  NSNPKFWKDSMFDLCSLVFDPERSLYKTIDVAPIMLLSLRVT--QPHENR---FIGQIME 748
            N++P    +S+  +   V D   SL  T D A +   SL VT     EN    ++ QI+ 
Sbjct: 708  NTDPIVMVESLPGILE-VMDRLLSLDVT-DSAAMNAGSLVVTVFTHFENEIKPYMKQILS 765

Query: 749  YTISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCF 808
             T  +L+    +  + + I + C +I  + +  +  +    +  E  I   ++ +    F
Sbjct: 766  GTTKRLIQAKNISTIQNLISVICYLICSNTEDTINLLSR--LGTEGDILKLVLNKWISNF 823

Query: 809  EENRSKNMLKEVALSLSELF------------------FSNDQRLTRSSYHDESDGVVR- 849
            E  R +  +K+  L+L++L+                  +  D+ +TRS   +  D   + 
Sbjct: 824  EIIRGERRIKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQI 883

Query: 850  PFKEYIVKMFADELTRQTDIXXXXXXXXXXXNDITPK----------------DYE--ED 891
            P    I+K+F  EL+ Q                I                   DYE  ++
Sbjct: 884  PVYSKIIKLFIQELSEQMKQPEHNLKIEETVETIGDGNAAAADDDWEDVEDVLDYEKLQE 943

Query: 892  YVSQLNDDVV-------LLTGRVIDMELKEILVQFFKSTQQSNDNSLGRVLKNLDEQERL 944
            YV   +D++        +L    I++++KE+L++  K     N +   ++   L E E+ 
Sbjct: 944  YVDDEDDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEK- 1002

Query: 945  KILS 948
            +ILS
Sbjct: 1003 RILS 1006

>AFR273W Chr6 (923039..925948) [2910 bp, 969 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL238W (CSE1)
          Length = 969

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 6/95 (6%)

Query: 38  IELIDTATNNNASASTRQLALLCLRKFTTMYWSAXXXXXXXXXXXXEQGKDLVRRGLLSL 97
           + L+    +NN +ASTR    L  + F    W              E    LV++ ++ L
Sbjct: 52  LTLLHVVASNNLAASTRLAGALFFKNFIRRRWVDENGEHLLSARDVE----LVKKEIVPL 107

Query: 98  LANEDTEKKVISTVTYCIVQICAVDFPDEWPGLLD 132
           +    +  +V   +   I  I   DFP+ WP LLD
Sbjct: 108 MIQLGSHLQV--QIGESIAVIADSDFPERWPTLLD 140

>TPHA0E02950 Chr5 (619747..621927) [2181 bp, 726 aa] {ON} Anc_5.229
           YJR005W
          Length = 726

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 10/103 (9%)

Query: 503 FTYYTSFAELGSILDYQTSMILQQSLLK---AIKTLYVXXXXXXXXXXXXAMHEIVKTWH 559
           FT Y + +E+G  L    S  L+ ++L    A++ +               + EI+K W 
Sbjct: 7   FTRYRA-SEIGVDLQNSESKKLKNNVLGRKTALRKIIANLTLGNVNEMSYLLPEILKYWQ 65

Query: 560 FQQDLHTKQEILNLLLKLSSSEPSNVRIVFESVRSLPYLLRDI 602
            + D   K+     + KL  S+P NV+       +LPY+L D+
Sbjct: 66  IEDDYEVKRICHEYIRKLGPSKPKNVQ------EALPYILNDL 102

>Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {ON}
           YPL125W (KAP120) - karyopherin [contig 67] FULL
          Length = 1034

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%)

Query: 116 VQICAVDFPDEWPGLLDYLNENILNY 141
            +I  +DFP EWPGL D L E +L+Y
Sbjct: 119 ARIARLDFPGEWPGLFDQL-EKLLSY 143

>TPHA0N01280 Chr14 complement(277121..279994) [2874 bp, 957 aa] {ON}
           Anc_3.561 YGL238W
          Length = 957

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 44/116 (37%), Gaps = 8/116 (6%)

Query: 19  EDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRKFTTMYWSAXXXXXXX 78
           +DAE SL E    D     + L+   +++N   STR    L  + F    W         
Sbjct: 21  KDAERSLKELEVED--GFGLTLLQVVSSDNLPNSTRLAGALFFKNFIKRKWVDVDGNYLL 78

Query: 79  XXXXXEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDFPDEWPGLLDYL 134
                E  K  +   ++ L AN   +      +   I  I   DFPD WP LL+ L
Sbjct: 79  PLSNAELIKKEIIPLMIILPANLQKQ------IGEAISVIADSDFPDRWPSLLNDL 128

>Kpol_499.7 s499 (15347..17938) [2592 bp, 863 aa] {ON}
           (15347..17938) [2592 nt, 864 aa]
          Length = 863

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 50/121 (41%), Gaps = 16/121 (13%)

Query: 569 EILNLLLKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQS 628
           E++ L +   +SEP N      ++ +L Y         + ++ ES   +++  ++     
Sbjct: 725 EVMTLCVTAQNSEPEN-----GTLEALDY---------HMKILESVLDAYVGIVAGLHSD 770

Query: 629 QQTYSPLVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAF 688
           QQ+  P V    +FL+   + P +  H  D  A   +  I       PD +I +   Q +
Sbjct: 771 QQSLYPFVGTIFQFLAKVAEEPQLAGH--DSTARSAVGLIGDISSMYPDGSIKQFFTQDW 828

Query: 689 V 689
           V
Sbjct: 829 V 829

>ACL187W Chr3 (30322..32907) [2586 bp, 861 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR347C (KAP95)
          Length = 861

 Score = 32.3 bits (72), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 95  LSLLANEDTEKKVISTVTYCIVQICAVDFP-DEWPGLLDYLNENILNYHSEN 145
            +L A  D + +V +     I  I  ++ P DEWP L+  L EN   +  EN
Sbjct: 99  FALAALVDKQPRVANASAQLIAAIADIELPRDEWPDLMKILVENTTQHQPEN 150

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 249 LKGELFMALSKLFD----LNQSILGSNGDLSYRLRITLDAIKSNANSYARALTNNDELRL 304
           L   +F    + FD    L++ I+ SN  ++Y+ +      +SN NS +  +T  +EL+L
Sbjct: 60  LVKNIFCINRRFFDSPIYLDEKIISSNISINYKDKTFELQFQSNTNSVSNNITEQNELKL 119

Query: 305 EIINSSCI 312
            ++++ C+
Sbjct: 120 PLVSTDCL 127

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,704,081
Number of extensions: 4279752
Number of successful extensions: 14631
Number of sequences better than 10.0: 73
Number of HSP's gapped: 14972
Number of HSP's successfully gapped: 75
Length of query: 952
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 833
Effective length of database: 39,836,145
Effective search space: 33183508785
Effective search space used: 33183508785
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)