Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00781g3.565ON1711718111e-112
Skud_7.253.565ON1811515262e-68
TPHA0A059903.565ON1761535253e-68
Smik_7.193.565ON1811515244e-68
YGL242C3.565ON1811505236e-68
NDAI0B062703.565ON1821525236e-68
Suva_7.193.565ON1811515166e-67
TDEL0D063303.565ON1791525045e-65
Kpol_507.113.565ON1891534993e-64
CAGL0H07755g3.565ON1721514974e-64
SAKL0F00858g3.565ON1731524914e-63
KAFR0J001803.565ON1821514863e-62
ZYRO0E09482g3.565ON1751494811e-61
Kwal_47.192623.565ON1711724793e-61
Ecym_25953.565ON1701694741e-60
TBLA0I034903.565ON1751484671e-59
KLTH0G00770g3.565ON1711544671e-59
KNAG0D029503.565ON1741534566e-58
NCAS0F039603.565ON1861504569e-58
AFR268C3.565ON1681544114e-51
NDAI0I005106.319ON2121061431e-10
CAGL0C03003g6.319ON2061271323e-09
Kpol_1028.586.319ON2081291262e-08
NCAS0D044306.319ON2301021263e-08
ZYRO0D08690g6.319ON2081291211e-07
TBLA0F040206.319ON2191051192e-07
NDAI0D025405.97ON236921202e-07
Ecym_20996.319ON2071111165e-07
KAFR0J025006.319ON2121421165e-07
TDEL0A073406.319ON2151031166e-07
AAR063C6.319ON2201171104e-06
KLTH0A06248g6.319ON2021281095e-06
KLLA0C09108g6.319ON2081301079e-06
KNAG0I025906.319ON2141151016e-05
Smik_3.1536.319ON2461431026e-05
ZYRO0B15114g5.97ON2261031008e-05
Skud_3.1296.319ON222111991e-04
Kwal_23.62186.319ON202134991e-04
NCAS0F005905.97ON23593991e-04
YCR051W6.319ON222121982e-04
SAKL0A01870g6.319ON206128972e-04
Suva_3.896.319ON223105963e-04
Skud_9.592.257ON107785973e-04
YIL112W (HOS4)2.257ON108385964e-04
TDEL0G012005.97ON227103946e-04
Skud_16.1708.599ON122495930.001
YGR232W (NAS6)5.97ON228112910.001
Suva_16.2008.599ON1219131920.001
Suva_9.822.257ON114191920.001
KLLA0F00660g8.599ON137492920.001
CAGL0L06600g5.97ON23191900.002
Smik_16.745.97ON228105900.002
KNAG0A015705.97ON232133890.003
Smik_9.572.257ON108591900.003
CAGL0F06831g2.662ON1092120900.003
SAKL0E08382g2.257ON1085128880.005
KLLA0E15709g5.97ON230100860.006
Kpol_1050.625.97ON23094860.007
TBLA0A070301.60ON45879860.008
ZYRO0C11132g5.626ON759106860.010
Skud_7.5665.97ON228106840.013
KAFR0B042605.97ON230104830.014
Kwal_23.49142.257ON1043151830.024
Smik_16.1268.599ON121695830.026
KNAG0A015605.96ON1159117820.030
ZYRO0D02332g2.257ON88186820.031
TPHA0D037906.319ON213129800.036
YAR042W (SWH1)3.175ON118867810.041
SAKL0H08580g8.599ON1367119810.046
TDEL0C040402.257ON1007155800.047
Suva_7.5245.97ON228103790.048
KLLA0F03619g2.257ON96091800.051
ZYRO0A10296g8.599ON1339111800.062
NCAS0B064102.257ON1054118790.067
SAKL0G15532g5.97ON23399770.094
TDEL0D044803.175ON126867780.094
Ecym_70948.599ON134791780.095
Smik_1.1073.175ON117967780.10
NCAS0C051602.639ON40881770.11
Skud_1.913.175ON116567780.11
Suva_1.1103.175ON115959770.12
AER388C5.626ON72489770.14
YPL110C (GDE1)8.599ON122395770.14
TDEL0A054408.599ON1288120770.15
Suva_16.686.265ON199128750.15
KNAG0E018802.257ON99289760.18
ZYRO0E00924g2.639ON408137750.21
TPHA0I015808.599ON124688750.21
Smik_15.2135.626ON744107750.22
YMR068W (AVO2)2.639ON426104750.23
CAGL0H00935g6.265ON193127730.28
Kpol_1019.307.310ON1252103740.28
Ecym_30246.20ON1079111740.30
Skud_13.2242.639ON422104740.32
KAFR0A001702.662ON105486740.32
CAGL0C01309g2.257ON1110118740.32
Smik_13.2472.639ON430104730.38
NDAI0B037002.257ON1141110730.40
NCAS0C036803.175ON120860730.40
Kwal_14.9822.639ON41638730.41
TBLA0A007802.639ON726123730.42
ACR006C6.20ON1071105730.42
KNAG0M025102.639ON41136720.50
SAKL0G07326g5.626ON73796720.52
KNAG0K012303.175ON122857720.54
KLTH0E13882g8.599ON128576710.70
ZYRO0A05258g3.175ON154859710.70
KNAG0K017003.175ON135651710.71
KAFR0A002802.639ON38783710.73
NDAI0F008305.626ON51569710.77
Kpol_1039.262.257ON1204120710.81
Smik_6.4436.265ON199128690.83
CAGL0F06655g2.639ON408100700.87
ADL244W2.257ON1089139710.87
Suva_7.5255.96ON1155121710.89
TBLA0G025002.257ON125982701.0
KAFR0J015402.257ON1068141691.2
Kwal_33.132591.60ON66446691.2
Kwal_27.97523.175ON119659691.2
NDAI0A064303.175ON131267691.4
NCAS0B086601.60ON75163691.5
KLTH0H03014g6.265ON19762671.5
TPHA0F012202.257ON1078119681.7
NDAI0G030203.175ON149557681.8
Sklu_YGOB_Anc_6.20singletonOFF84951681.8
Suva_13.2432.639ON416107681.9
SAKL0C07678g3.175ON130967681.9
KLTH0F01826g1.60ON66346681.9
Kpol_1002.186.265ON20656671.9
Sklu_YGOB_Anc_6.20b6.20ON108851672.2
Skud_16.406.265ON19970662.2
KLLA0C04147g3.175ON124061672.3
Suva_8.875.626ON73064672.4
AFR600C4.232ON81557672.6
NCAS0C018208.599ON113383672.8
AER225W3.175ON129964663.5
YPL239W (YAR1)6.265ON200128643.7
KAFR0G031704.232ON78069653.9
TPHA0P005803.175ON125763654.1
TPHA0H019106.265ON20146644.5
TBLA0B043008.599ON135087654.5
TBLA0G008403.175ON156167654.6
Ecym_13305.626ON739100645.2
Ecym_52493.175ON137858645.3
NCAS0H033002.639ON37374645.5
KLTH0E02420g5.626ON73458646.3
CAGL0M04477g8.347ON56337646.4
Suva_4.2293.175ON129256646.5
KAFR0F027704.33ON74337637.0
Kpol_1037.53.175ON121268637.3
KLTH0G09724g2.257ON1073144637.3
CAGL0J07040g8.599ON1245107637.4
CAGL0K01749g3.175ON124967637.4
KAFR0C009403.175ON112066637.6
Kwal_33.140171.216ON267744637.6
YOR034C (AKR2)5.626ON74955638.4
TDEL0A067806.265ON200126618.7
TBLA0I005803.6ON51434629.1
Kwal_27.127515.96ON1093109639.2
Skud_4.2303.175ON129456629.7
NCAS0E025507.401ON144350629.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00781g
         (171 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}...   317   e-112
Skud_7.25 Chr7 complement(48834..49379) [546 bp, 181 aa] {ON} YG...   207   2e-68
TPHA0A05990 Chr1 (1356065..1356595) [531 bp, 176 aa] {ON} Anc_3....   206   3e-68
Smik_7.19 Chr7 complement(39474..40019) [546 bp, 181 aa] {ON} YG...   206   4e-68
YGL242C Chr7 complement(44652..45197) [546 bp, 181 aa] {ON} Puta...   206   6e-68
NDAI0B06270 Chr2 (1518518..1519066) [549 bp, 182 aa] {ON} Anc_3....   206   6e-68
Suva_7.19 Chr7 complement(39229..39774) [546 bp, 181 aa] {ON} YG...   203   6e-67
TDEL0D06330 Chr4 (1138062..1138601) [540 bp, 179 aa] {ON} Anc_3....   198   5e-65
Kpol_507.11 s507 complement(58716..59285) [570 bp, 189 aa] {ON} ...   196   3e-64
CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {O...   196   4e-64
SAKL0F00858g Chr6 complement(76158..76679) [522 bp, 173 aa] {ON}...   193   4e-63
KAFR0J00180 Chr10 complement(29811..30359) [549 bp, 182 aa] {ON}...   191   3e-62
ZYRO0E09482g Chr5 (756328..756855) [528 bp, 175 aa] {ON} highly ...   189   1e-61
Kwal_47.19262 s47 (1160155..1160670) [516 bp, 171 aa] {ON} YGL24...   189   3e-61
Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar ...   187   1e-60
TBLA0I03490 Chr9 (839793..840320) [528 bp, 175 aa] {ON} Anc_3.56...   184   1e-59
KLTH0G00770g Chr7 complement(52958..53473) [516 bp, 171 aa] {ON}...   184   1e-59
KNAG0D02950 Chr4 (532378..532902) [525 bp, 174 aa] {ON} Anc_3.56...   180   6e-58
NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.56...   180   9e-58
AFR268C Chr6 complement(915788..916294) [507 bp, 168 aa] {ON} Sy...   162   4e-51
NDAI0I00510 Chr9 complement(104836..105474) [639 bp, 212 aa] {ON...    60   1e-10
CAGL0C03003g Chr3 (297244..297864) [621 bp, 206 aa] {ON} similar...    55   3e-09
Kpol_1028.58 s1028 complement(133357..133983) [627 bp, 208 aa] {...    53   2e-08
NCAS0D04430 Chr4 (843610..844302) [693 bp, 230 aa] {ON} Anc_6.319      53   3e-08
ZYRO0D08690g Chr4 complement(747083..747709) [627 bp, 208 aa] {O...    51   1e-07
TBLA0F04020 Chr6 (993029..993688) [660 bp, 219 aa] {ON} Anc_6.31...    50   2e-07
NDAI0D02540 Chr4 (584626..585336) [711 bp, 236 aa] {ON} Anc_5.97       51   2e-07
Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON} ...    49   5e-07
KAFR0J02500 Chr10 (476605..477243) [639 bp, 212 aa] {ON} Anc_6.3...    49   5e-07
TDEL0A07340 Chr1 (1284474..1285121) [648 bp, 215 aa] {ON} Anc_6....    49   6e-07
AAR063C Chr1 complement(453099..453761) [663 bp, 220 aa] {ON} Sy...    47   4e-06
KLTH0A06248g Chr1 (524183..524791) [609 bp, 202 aa] {ON} similar...    47   5e-06
KLLA0C09108g Chr3 complement(795433..796059) [627 bp, 208 aa] {O...    46   9e-06
KNAG0I02590 Chr9 complement(499721..500365) [645 bp, 214 aa] {ON...    44   6e-05
Smik_3.153 Chr3 (212077..212817) [741 bp, 246 aa] {ON} YCR051W (...    44   6e-05
ZYRO0B15114g Chr2 complement(1233061..1233741) [681 bp, 226 aa] ...    43   8e-05
Skud_3.129 Chr3 (198354..199022) [669 bp, 222 aa] {ON} YCR051W (...    43   1e-04
Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051...    43   1e-04
NCAS0F00590 Chr6 complement(117069..117776) [708 bp, 235 aa] {ON...    43   1e-04
YCR051W Chr3 (214071..214739) [669 bp, 222 aa] {ON} Putative pro...    42   2e-04
SAKL0A01870g Chr1 complement(167727..168347) [621 bp, 206 aa] {O...    42   2e-04
Suva_3.89 Chr3 (127217..127888) [672 bp, 223 aa] {ON} YCR051W (R...    42   3e-04
Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W ...    42   3e-04
YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subun...    42   4e-04
TDEL0G01200 Chr7 complement(246082..246765) [684 bp, 227 aa] {ON...    41   6e-04
Skud_16.170 Chr16 complement(312641..316315) [3675 bp, 1224 aa] ...    40   0.001
YGR232W Chr7 (953960..954646) [687 bp, 228 aa] {ON}  NAS6Proteas...    40   0.001
Suva_16.200 Chr16 complement(350324..353983) [3660 bp, 1219 aa] ...    40   0.001
Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W ...    40   0.001
KLLA0F00660g Chr6 (54232..58356) [4125 bp, 1374 aa] {ON} similar...    40   0.001
CAGL0L06600g Chr12 (744800..745495) [696 bp, 231 aa] {ON} simila...    39   0.002
Smik_16.74 Chr16 complement(142064..142750) [687 bp, 228 aa] {ON...    39   0.002
KNAG0A01570 Chr1 complement(78024..78722) [699 bp, 232 aa] {ON} ...    39   0.003
Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W ...    39   0.003
CAGL0F06831g Chr6 (668173..671451) [3279 bp, 1092 aa] {ON} simil...    39   0.003
SAKL0E08382g Chr5 complement(676318..679575) [3258 bp, 1085 aa] ...    39   0.005
KLLA0E15709g Chr5 complement(1406502..1407194) [693 bp, 230 aa] ...    38   0.006
Kpol_1050.62 s1050 (137219..137911) [693 bp, 230 aa] {ON} (13721...    38   0.007
TBLA0A07030 Chr1 (1721376..1722752) [1377 bp, 458 aa] {ON}             38   0.008
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    38   0.010
Skud_7.566 Chr7 (928849..929535) [687 bp, 228 aa] {ON} YGR232W (...    37   0.013
KAFR0B04260 Chr2 (884243..884935) [693 bp, 230 aa] {ON} Anc_5.97...    37   0.014
Kwal_23.4914 s23 (921368..924499) [3132 bp, 1043 aa] {ON} YIL112...    37   0.024
Smik_16.126 Chr16 complement(224488..228138) [3651 bp, 1216 aa] ...    37   0.026
KNAG0A01560 Chr1 (74485..77964) [3480 bp, 1159 aa] {ON} Anc_5.96...    36   0.030
ZYRO0D02332g Chr4 (180577..183222) [2646 bp, 881 aa] {ON} simila...    36   0.031
TPHA0D03790 Chr4 (797282..797923) [642 bp, 213 aa] {ON} Anc_6.31...    35   0.036
YAR042W Chr1 (192619..196185) [3567 bp, 1188 aa] {ON}  SWH1Prote...    36   0.041
SAKL0H08580g Chr8 complement(737581..741684) [4104 bp, 1367 aa] ...    36   0.046
TDEL0C04040 Chr3 complement(707532..710555) [3024 bp, 1007 aa] {...    35   0.047
Suva_7.524 Chr7 (908440..909126) [687 bp, 228 aa] {ON} YGR232W (...    35   0.048
KLLA0F03619g Chr6 (342770..345652) [2883 bp, 960 aa] {ON} simila...    35   0.051
ZYRO0A10296g Chr1 complement(834376..838395) [4020 bp, 1339 aa] ...    35   0.062
NCAS0B06410 Chr2 complement(1209149..1212313) [3165 bp, 1054 aa]...    35   0.067
SAKL0G15532g Chr7 (1336097..1336798) [702 bp, 233 aa] {ON} simil...    34   0.094
TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3....    35   0.094
Ecym_7094 Chr7 (181244..185287) [4044 bp, 1347 aa] {ON} similar ...    35   0.095
Smik_1.107 Chr1 (171768..175307) [3540 bp, 1179 aa] {ON} YAR042W...    35   0.10 
NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa] ...    34   0.11 
Skud_1.91 Chr1 (162916..166413) [3498 bp, 1165 aa] {ON} YAR042W ...    35   0.11 
Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W...    34   0.12 
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    34   0.14 
YPL110C Chr16 complement(341068..344739) [3672 bp, 1223 aa] {ON}...    34   0.14 
TDEL0A05440 Chr1 (953042..956908) [3867 bp, 1288 aa] {ON} Anc_8....    34   0.15 
Suva_16.68 Chr16 (108464..109063) [600 bp, 199 aa] {ON} YPL239W ...    33   0.15 
KNAG0E01880 Chr5 (389045..392023) [2979 bp, 992 aa] {ON} Anc_2.2...    34   0.18 
ZYRO0E00924g Chr5 complement(62334..63560) [1227 bp, 408 aa] {ON...    33   0.21 
TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {...    33   0.21 
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    33   0.22 
YMR068W Chr13 (406304..407584) [1281 bp, 426 aa] {ON}  AVO2Compo...    33   0.23 
CAGL0H00935g Chr8 (91979..92560) [582 bp, 193 aa] {ON} highly si...    33   0.28 
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    33   0.28 
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...    33   0.30 
Skud_13.224 Chr13 (380698..381966) [1269 bp, 422 aa] {ON} YMR068...    33   0.32 
KAFR0A00170 Chr1 complement(27115..30279) [3165 bp, 1054 aa] {ON...    33   0.32 
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    33   0.32 
Smik_13.247 Chr13 (390443..391735) [1293 bp, 430 aa] {ON} YMR068...    33   0.38 
NDAI0B03700 Chr2 complement(925092..928517) [3426 bp, 1141 aa] {...    33   0.40 
NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {...    33   0.40 
Kwal_14.982 s14 complement(141369..142619) [1251 bp, 416 aa] {ON...    33   0.41 
TBLA0A00780 Chr1 complement(168204..170384) [2181 bp, 726 aa] {O...    33   0.42 
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...    33   0.42 
KNAG0M02510 Chr13 complement(465793..467028) [1236 bp, 411 aa] {...    32   0.50 
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    32   0.52 
KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa] ...    32   0.54 
KLTH0E13882g Chr5 (1222695..1226552) [3858 bp, 1285 aa] {ON} sim...    32   0.70 
ZYRO0A05258g Chr1 (424968..429614) [4647 bp, 1548 aa] {ON} some ...    32   0.70 
KNAG0K01700 Chr11 (352052..356122) [4071 bp, 1356 aa] {ON}             32   0.71 
KAFR0A00280 Chr1 complement(53403..54566) [1164 bp, 387 aa] {ON}...    32   0.73 
NDAI0F00830 Chr6 (198222..199769) [1548 bp, 515 aa] {ON} Anc_5.6...    32   0.77 
Kpol_1039.26 s1039 (82489..86103) [3615 bp, 1204 aa] {ON} (82489...    32   0.81 
Smik_6.443 Chr6 complement(724235..724834) [600 bp, 199 aa] {ON}...    31   0.83 
CAGL0F06655g Chr6 (654908..656134) [1227 bp, 408 aa] {ON} simila...    32   0.87 
ADL244W Chr4 (273377..276646) [3270 bp, 1089 aa] {ON} Syntenic h...    32   0.87 
Suva_7.525 Chr7 complement(909154..912621) [3468 bp, 1155 aa] {O...    32   0.89 
TBLA0G02500 Chr7 complement(648451..652230) [3780 bp, 1259 aa] {...    32   1.0  
KAFR0J01540 Chr10 complement(277907..281113) [3207 bp, 1068 aa] ...    31   1.2  
Kwal_33.13259 s33 (143081..145075) [1995 bp, 664 aa] {ON} YLR182...    31   1.2  
Kwal_27.9752 s27 complement(49387..52977) [3591 bp, 1196 aa] {ON...    31   1.2  
NDAI0A06430 Chr1 (1461045..1464983) [3939 bp, 1312 aa] {ON} Anc_...    31   1.4  
NCAS0B08660 Chr2 (1665156..1667411) [2256 bp, 751 aa] {ON} Anc_1...    31   1.5  
KLTH0H03014g Chr8 (271566..272159) [594 bp, 197 aa] {ON} similar...    30   1.5  
TPHA0F01220 Chr6 complement(275858..279094) [3237 bp, 1078 aa] {...    31   1.7  
NDAI0G03020 Chr7 complement(699746..704233) [4488 bp, 1495 aa] {...    31   1.8  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...    31   1.8  
Suva_13.243 Chr13 (387561..388661,388691..388840) [1251 bp, 416 ...    31   1.9  
SAKL0C07678g Chr3 complement(710170..714099) [3930 bp, 1309 aa] ...    31   1.9  
KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} simila...    31   1.9  
Kpol_1002.18 s1002 (48873..49493) [621 bp, 206 aa] {ON} (48873.....    30   1.9  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...    30   2.2  
Skud_16.40 Chr16 (72992..73591) [600 bp, 199 aa] {ON} YPL239W (R...    30   2.2  
KLLA0C04147g Chr3 complement(377185..380907) [3723 bp, 1240 aa] ...    30   2.3  
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    30   2.4  
AFR600C Chr6 complement(1517783..1520230) [2448 bp, 815 aa] {ON}...    30   2.6  
NCAS0C01820 Chr3 complement(336290..339691) [3402 bp, 1133 aa] {...    30   2.8  
AER225W Chr5 (1051497..1055396) [3900 bp, 1299 aa] {ON} Syntenic...    30   3.5  
YPL239W Chr16 (99484..100086) [603 bp, 200 aa] {ON}  YAR1Cytopla...    29   3.7  
KAFR0G03170 Chr7 complement(658032..660374) [2343 bp, 780 aa] {O...    30   3.9  
TPHA0P00580 Chr16 (117136..120909) [3774 bp, 1257 aa] {ON} Anc_3...    30   4.1  
TPHA0H01910 Chr8 complement(448970..449575) [606 bp, 201 aa] {ON...    29   4.5  
TBLA0B04300 Chr2 complement(994891..998943) [4053 bp, 1350 aa] {...    30   4.5  
TBLA0G00840 Chr7 (200837..205522) [4686 bp, 1561 aa] {ON} Anc_3....    30   4.6  
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    29   5.2  
Ecym_5249 Chr5 complement(514146..518282) [4137 bp, 1378 aa] {ON...    29   5.3  
NCAS0H03300 Chr8 (633593..634714) [1122 bp, 373 aa] {ON} Anc_2.6...    29   5.5  
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    29   6.3  
CAGL0M04477g Chr13 (491638..493329) [1692 bp, 563 aa] {ON} some ...    29   6.4  
Suva_4.229 Chr4 complement(408561..412439) [3879 bp, 1292 aa] {O...    29   6.5  
KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {O...    29   7.0  
Kpol_1037.5 s1037 complement(8144..11782) [3639 bp, 1212 aa] {ON...    29   7.3  
KLTH0G09724g Chr7 (818249..821470) [3222 bp, 1073 aa] {ON} simil...    29   7.3  
CAGL0J07040g Chr10 (677513..681250) [3738 bp, 1245 aa] {ON} simi...    29   7.4  
CAGL0K01749g Chr11 complement(155385..159134) [3750 bp, 1249 aa]...    29   7.4  
KAFR0C00940 Chr3 (189934..193296) [3363 bp, 1120 aa] {ON} Anc_3....    29   7.6  
Kwal_33.14017 s33 (485065..493098) [8034 bp, 2677 aa] {ON} YKR05...    29   7.6  
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    29   8.4  
TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {...    28   8.7  
TBLA0I00580 Chr9 complement(102907..104451) [1545 bp, 514 aa] {O...    28   9.1  
Kwal_27.12751 s27 complement(1361084..1364365) [3282 bp, 1093 aa...    29   9.2  
Skud_4.230 Chr4 complement(410772..414656) [3885 bp, 1294 aa] {O...    28   9.7  
NCAS0E02550 Chr5 (506706..511037) [4332 bp, 1443 aa] {ON} Anc_7....    28   9.8  

>KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 171

 Score =  317 bits (811), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 159/171 (92%), Positives = 159/171 (92%)

Query: 1   MTEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYG 60
           MTEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYG
Sbjct: 1   MTEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYG 60

Query: 61  SWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           SWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN
Sbjct: 61  SWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADNKGKXXXXXXXXXXXXGPEDD 171
           KRGQTPLQLVHSDELESLVNLLQGAEIAADNKGK            GPEDD
Sbjct: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADNKGKIINEEDAEEIDDGPEDD 171

>Skud_7.25 Chr7 complement(48834..49379) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  207 bits (526), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 99/151 (65%), Positives = 122/151 (80%), Gaps = 1/151 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           TEGASL EQLLDA+RRNN DLL  V + LDGD + I  LIN SK+PLGNTA+HLC KYGS
Sbjct: 3   TEGASLSEQLLDAARRNNLDLLETVFDGLDGDSEKIAKLINKSKEPLGNTALHLCCKYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LDQ+G ++++ QN +DGDT LH+ V YS +EPE+GTFIA NLIEVGADPR+RN
Sbjct: 63  WEVLDRILDQDGGIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADN 151
              Q P+ LVH DEL+ L++LLQGAE+A D+
Sbjct: 123 YNNQKPIDLVHGDELDELIDLLQGAELAIDS 153

>TPHA0A05990 Chr1 (1356065..1356595) [531 bp, 176 aa] {ON} Anc_3.565
           YGL242C
          Length = 176

 Score =  206 bits (525), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 123/153 (80%), Gaps = 1/153 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           +EGASL EQLLD +RRNN DL N++LE+L  D   I  LIN S+DP GNTA+HL  +YGS
Sbjct: 3   SEGASLNEQLLDCARRNNEDLFNSILESLGNDTYNISELINTSRDPFGNTALHLACQYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LDQEG ++++ QN+ DGDT LH+ V Y+H+EPE+GTFIA+NLIEVGADPRIRN
Sbjct: 63  WEVLDKILDQEGDIEIDPQNTTDGDTPLHVTVKYAHNEPEHGTFIAKNLIEVGADPRIRN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADNKG 153
            R + P+  +H DELE L++LLQGAEI+ADN G
Sbjct: 123 NRNERPIDCIHGDELEELIDLLQGAEISADNGG 155

>Smik_7.19 Chr7 complement(39474..40019) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  206 bits (524), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 98/151 (64%), Positives = 122/151 (80%), Gaps = 1/151 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           TEGASL EQLLDA+RRNN DLL  V  +LD + + I  LIN+S++PLGNTA+HLC KYGS
Sbjct: 3   TEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LDQEG ++++ QN +DGDT LH+ V YS +EPE+GTFIA NLIEVGADPR+RN
Sbjct: 63  WEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADN 151
              Q P+ LVH DEL+ L++LLQGAE+A DN
Sbjct: 123 YNNQKPIDLVHGDELDELIDLLQGAELAIDN 153

>YGL242C Chr7 complement(44652..45197) [546 bp, 181 aa] {ON}
           Putative protein of unknown function; deletion mutant is
           viable
          Length = 181

 Score =  206 bits (523), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 122/150 (81%), Gaps = 1/150 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           TEGASL EQLLDA+RRNN DLL  V ++LD D + I  LIN+SK+PLGNTA+HLC KYGS
Sbjct: 3   TEGASLSEQLLDAARRNNLDLLETVFDSLDNDPEKIAKLINESKEPLGNTALHLCCKYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LDQ+G ++++ QN +DGDT LH+ V YS +EPE+GTFIA NLIEVGADPR+RN
Sbjct: 63  WEVLDKILDQDGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAAD 150
              Q P+ LVH DEL+ L++LLQGAE+A D
Sbjct: 123 YNNQKPVDLVHGDELDELIDLLQGAELAID 152

>NDAI0B06270 Chr2 (1518518..1519066) [549 bp, 182 aa] {ON} Anc_3.565
           YGL242C
          Length = 182

 Score =  206 bits (523), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 122/152 (80%), Gaps = 1/152 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
            EGASLKEQLLDASRRNN DLL  +  TLD D++ I  LIN +KDPLGNTA+HL  KYGS
Sbjct: 3   VEGASLKEQLLDASRRNNVDLLEQIFTTLDNDEEKIADLINTAKDPLGNTALHLSCKYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LDQEG ++++ +N +DGDT LH  V Y+ DEPE+G FIA+NLIEVGADPRIRN
Sbjct: 63  WEVLDKILDQEGDIEIDPKNDMDGDTPLHSAVRYAQDEPEHGEFIAQNLIEVGADPRIRN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADNK 152
              Q P+ L+H D+ +SL++LLQGAE+AADN+
Sbjct: 123 NHNQKPIDLIHGDDFDSLIDLLQGAELAADNR 154

>Suva_7.19 Chr7 complement(39229..39774) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  203 bits (516), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 96/151 (63%), Positives = 123/151 (81%), Gaps = 1/151 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           TEGASL EQLLDA+RRNN DL+  V ++LD D + I  LIN+S++PLGNTA+HLC KYGS
Sbjct: 3   TEGASLSEQLLDAARRNNLDLVETVFDSLDNDPEKIAKLINESREPLGNTALHLCCKYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LDQ+G ++++ QN +DGDT LH+ V YS +EPE+GTFIA NLIEVGADPRI+N
Sbjct: 63  WEVLDKILDQDGGIEIDPQNDVDGDTPLHVTVKYSQEEPEHGTFIARNLIEVGADPRIKN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADN 151
              Q P+ LVH DEL+ L++LLQGAE+A D+
Sbjct: 123 YNNQKPIDLVHGDELDELIDLLQGAELAIDS 153

>TDEL0D06330 Chr4 (1138062..1138601) [540 bp, 179 aa] {ON} Anc_3.565
           YGL242C
          Length = 179

 Score =  198 bits (504), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 118/152 (77%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           +EGAS  EQLL+ASRRNN DLLN +LE++  D   I  ++N SKDP GNTA+HLC K GS
Sbjct: 3   SEGASYGEQLLEASRRNNVDLLNDILESVKNDPVKIAEIVNFSKDPFGNTALHLCCKSGS 62

Query: 62  WDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNK 121
           W+VLD+LLDQ  ++++ QN +DGDT LH  V Y+ DEPE+GTFIA NLIEVGADPR+RNK
Sbjct: 63  WEVLDILLDQGDIEIDPQNKLDGDTPLHFTVRYAQDEPEHGTFIARNLIEVGADPRLRNK 122

Query: 122 RGQTPLQLVHSDELESLVNLLQGAEIAADNKG 153
             Q P+ L+HS++L+ L +LLQGAE+A D  G
Sbjct: 123 HNQKPIDLIHSEDLDELTDLLQGAELAIDMGG 154

>Kpol_507.11 s507 complement(58716..59285) [570 bp, 189 aa] {ON}
           complement(58716..59285) [570 nt, 190 aa]
          Length = 189

 Score =  196 bits (499), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 125/153 (81%), Gaps = 1/153 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           TEGASL EQLLD SRRNN DLL+ +LETL+ D + I  LIN SKDP GNTA+HLC KYGS
Sbjct: 3   TEGASLSEQLLDLSRRNNVDLLDTILETLENDPEKIAGLINTSKDPFGNTALHLCCKYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LDQEG ++++ +N+ DGDT LH+ V YS +EPE+GTFIA NLIEVG+DPRI+N
Sbjct: 63  WEVLDKILDQEGDIEIDPKNTTDGDTPLHVTVRYSMEEPEHGTFIASNLIEVGSDPRIKN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADNKG 153
              Q P+ L+H DEL+ L++LLQGAEIAAD++G
Sbjct: 123 NSNQKPIDLIHGDELDDLIDLLQGAEIAADSRG 155

>CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {ON}
           highly similar to uniprot|P53066 Saccharomyces
           cerevisiae YGL242c
          Length = 172

 Score =  196 bits (497), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 98/151 (64%), Positives = 120/151 (79%), Gaps = 2/151 (1%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           +EGAS  EQLLDASRRNN+DLL+++ ETL  D + I  LIN SKDPLGNTA+HLC KYGS
Sbjct: 3   SEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGS 62

Query: 62  WDVLDVLLDQE-GVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LDQE G+D++ QN +DGDT LH+ V Y  +EPE+G FIA NLIEVGADPRI+N
Sbjct: 63  WEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKN 121

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADN 151
              Q PL LVH D+ + L++LLQGA +AADN
Sbjct: 122 INNQLPLDLVHGDDKDELIDLLQGAALAADN 152

>SAKL0F00858g Chr6 complement(76158..76679) [522 bp, 173 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 173

 Score =  193 bits (491), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 127/152 (83%), Gaps = 1/152 (0%)

Query: 3   EGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSW 62
           +GASL+EQLLDASRRNNADLL  +LE+LD +   I  LIN + DPLGNT +HLC KYGSW
Sbjct: 5   QGASLQEQLLDASRRNNADLLETILESLDNNPDKIAKLINSACDPLGNTCLHLCCKYGSW 64

Query: 63  DVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNK 121
           +VLD +LDQ+G ++++ +N++DGDT LH+ V Y+ +EPE+GTFIA+NLIEVGADPRIRNK
Sbjct: 65  EVLDRILDQDGGIEIDPRNNVDGDTPLHVTVRYAIEEPEHGTFIAQNLIEVGADPRIRNK 124

Query: 122 RGQTPLQLVHSDELESLVNLLQGAEIAADNKG 153
            GQ P+ L+H D L+ L++LLQGAE+AADN+G
Sbjct: 125 AGQKPVDLIHGDGLDDLLDLLQGAELAADNEG 156

>KAFR0J00180 Chr10 complement(29811..30359) [549 bp, 182 aa] {ON}
           Anc_3.565 YGL242C
          Length = 182

 Score =  191 bits (486), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 93/151 (61%), Positives = 116/151 (76%), Gaps = 1/151 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           TEGAS  EQLLDASRRNN DLL  V   L  D + I  LIN SKDP GNTA+HL  KYGS
Sbjct: 3   TEGASFGEQLLDASRRNNVDLLETVFSDLANDHKKIADLINSSKDPFGNTALHLSCKYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LD EG ++++ +N+IDG+T LH  V YS  EPE+GTFIA NLI+VGADPR++N
Sbjct: 63  WEVLDKILDLEGDIEIDPKNNIDGETPLHCAVKYSQTEPEHGTFIASNLIQVGADPRLKN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADN 151
              Q P+ L+HS+EL+ L++LLQGAE+AAD+
Sbjct: 123 NNNQRPIDLIHSEELDDLIDLLQGAELAADH 153

>ZYRO0E09482g Chr5 (756328..756855) [528 bp, 175 aa] {ON} highly
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 175

 Score =  189 bits (481), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 121/149 (81%)

Query: 3   EGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSW 62
           EGAS  EQLLDASRRNN DLL  V E L GD + I  LIN+S+DPLG+TA+HLC +YGSW
Sbjct: 4   EGASFGEQLLDASRRNNIDLLKMVFEGLGGDPERISELINESRDPLGDTALHLCCRYGSW 63

Query: 63  DVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKR 122
           +VLD +LDQ+G++++ QN+ + DT LH+ V Y+HDEPE+GTFIA NL+EVGADPRI+N  
Sbjct: 64  EVLDEILDQDGIEIDPQNTKELDTPLHVTVRYAHDEPEHGTFIARNLVEVGADPRIKNMN 123

Query: 123 GQTPLQLVHSDELESLVNLLQGAEIAADN 151
           G  P+ L+H D+L+ L++LLQGAE+AADN
Sbjct: 124 GDKPVDLIHGDDLDELIDLLQGAELAADN 152

>Kwal_47.19262 s47 (1160155..1160670) [516 bp, 171 aa] {ON} YGL242C
           - Hypothetical ORF [contig 344] FULL
          Length = 171

 Score =  189 bits (479), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 99/172 (57%), Positives = 131/172 (76%), Gaps = 2/172 (1%)

Query: 1   MTEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYG 60
           M++GAS +EQLLDASRRNN DLL  V + L+ D++ I  LIN + DP+GN+++HLC K G
Sbjct: 1   MSQGASFREQLLDASRRNNVDLLETVFQELNNDEKKIAELINTAHDPMGNSSLHLCCKSG 60

Query: 61  SWDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIR 119
           SW+VLD++LDQEG ++++ +NS++GDT LH+ V Y+ +EPE+GTFIA NLIEVGADPRI 
Sbjct: 61  SWEVLDIILDQEGGIEIDCKNSVEGDTPLHVTVRYAIEEPEHGTFIARNLIEVGADPRII 120

Query: 120 NKRGQTPLQLVHSDELESLVNLLQGAEIAADNKGKXXXXXXXXXXXXGPEDD 171
           NK GQ PL LVH ++L+ LV+LLQGAE+AA+N G             GPEDD
Sbjct: 121 NKAGQKPLDLVHGNDLDDLVDLLQGAELAAENHG-VVNEDDAELIDDGPEDD 171

>Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AFR268C
          Length = 170

 Score =  187 bits (474), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 119/169 (70%), Gaps = 5/169 (2%)

Query: 3   EGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSW 62
           EGA+  EQLLDASRRNN DLL  +LE    D   +  LIND+KDP GNT +H+C KYGSW
Sbjct: 5   EGATYGEQLLDASRRNNVDLLEFILEQ---DSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61

Query: 63  DVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNK 121
           DVLD +LD +  ++++ QN ++GDT LH  V YS +EPE+GTFIA NLI+VGADPRI+N 
Sbjct: 62  DVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120

Query: 122 RGQTPLQLVHSDELESLVNLLQGAEIAADNKGKXXXXXXXXXXXXGPED 170
            G+ P++L+H+D+   L++LLQ AE+AADNKG              PED
Sbjct: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDDSPED 169

>TBLA0I03490 Chr9 (839793..840320) [528 bp, 175 aa] {ON} Anc_3.565
           YGL242C
          Length = 175

 Score =  184 bits (467), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 114/148 (77%), Gaps = 1/148 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
           T+GAS  EQLL+A+RRNN DLLN ++  L+ D   I  L+N+SKD  GNTA+HLC+K+GS
Sbjct: 4   TQGASYSEQLLEAARRNNIDLLNNIVTGLNNDPTKIAHLLNESKDAFGNTALHLCAKHGS 63

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           WDVLD LLDQEG ++V+ QN  DGDT LH  V  + DEPE GTFIA+NLI VGADPRIRN
Sbjct: 64  WDVLDKLLDQEGDIEVDPQNITDGDTPLHCAVRLAQDEPEEGTFIAKNLIAVGADPRIRN 123

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIA 148
           K+ Q P+ L+H + L +LV+ LQGAE+A
Sbjct: 124 KQNQKPVDLIHGNSLTALVDTLQGAELA 151

>KLTH0G00770g Chr7 complement(52958..53473) [516 bp, 171 aa] {ON}
           highly similar to uniprot|P53066 Saccharomyces
           cerevisiae YGL242C Hypothetical ORF
          Length = 171

 Score =  184 bits (467), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 123/154 (79%), Gaps = 1/154 (0%)

Query: 1   MTEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYG 60
           M++GASL+EQLLDASRRNN DLL  V + L  ++  I  LIN + DP+GN+ +HLC  YG
Sbjct: 1   MSDGASLREQLLDASRRNNVDLLETVFQELGNNEAQIADLINTAHDPMGNSGLHLCCMYG 60

Query: 61  SWDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIR 119
           SWDVLDV+LDQEG ++++ +N ++GDT LH  V Y+ +EPE+GTFIA NLIEVGADPRI 
Sbjct: 61  SWDVLDVILDQEGGIEIDSKNKVEGDTPLHCAVRYAIEEPEHGTFIARNLIEVGADPRIV 120

Query: 120 NKRGQTPLQLVHSDELESLVNLLQGAEIAADNKG 153
           N+ GQ P+ LVH DEL+ L++LLQGAE+AA+N+G
Sbjct: 121 NQAGQKPIDLVHGDELDDLIDLLQGAELAAENQG 154

>KNAG0D02950 Chr4 (532378..532902) [525 bp, 174 aa] {ON} Anc_3.565
           YGL242C
          Length = 174

 Score =  180 bits (456), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 118/153 (77%), Gaps = 1/153 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
            +GASL EQLLDASRRNN DLL  V + LD D   I  LIN ++DP+GNTA+HLC KYGS
Sbjct: 3   VKGASLSEQLLDASRRNNDDLLEQVFKQLDNDPGKIAELINTARDPMGNTALHLCCKYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LDQEG ++++ +N +DGDT LHL V Y+ DEPE+GTFIA NL+EVGAD RI+N
Sbjct: 63  WEVLDKILDQEGDIEIDPRNELDGDTPLHLAVRYAMDEPEHGTFIANNLVEVGADARIKN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADNKG 153
              Q P+ L+H DEL+ L +LLQGAE+A D+ G
Sbjct: 123 NNNQKPVDLIHGDELDDLFDLLQGAELARDHPG 155

>NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.565
           YGL242C
          Length = 186

 Score =  180 bits (456), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 1/150 (0%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
            EGASLKEQLLDASRRNN DLL      LD D + I  LIN +KDPLGNTA+HL SKYGS
Sbjct: 3   VEGASLKEQLLDASRRNNVDLLEQAFNDLDNDPKKIADLINTAKDPLGNTALHLASKYGS 62

Query: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+VLD +LD +G ++++ QN IDGDT LH  V Y+ +EPE+GTFIA+NLIEVGAD RI N
Sbjct: 63  WEVLDKILDLDGDIEIDPQNDIDGDTPLHEAVRYAKEEPEHGTFIAQNLIEVGADARIAN 122

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAAD 150
           K  Q P+ L+H DEL+ LV+LLQGAE+AAD
Sbjct: 123 KHNQKPVDLIHGDELDDLVDLLQGAELAAD 152

>AFR268C Chr6 complement(915788..916294) [507 bp, 168 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL242C
          Length = 168

 Score =  162 bits (411), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 113/154 (73%), Gaps = 5/154 (3%)

Query: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61
            +GASL EQLL+A+RRNN +LL AV+   D   + I+ LIN S+DPLGNT +HLC  +GS
Sbjct: 3   VDGASLGEQLLEAARRNNVELLEAVVR--DAGPE-IEDLINGSRDPLGNTCLHLCCTHGS 59

Query: 62  WDVLDVLLDQE-GVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           W+ LD++LD +  ++V+ QN+  GDT LH    Y+ +EPE+ TF+A NL++VGADPR+RN
Sbjct: 60  WEALDMILDLDCAIEVDPQNTA-GDTPLHAAARYAAEEPEHATFLASNLVQVGADPRVRN 118

Query: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADNKGK 154
           K G  P++LVH  ELE LV++LQG E+A D  G+
Sbjct: 119 KAGLRPVELVHGSELEPLVDVLQGGELAYDTHGE 152

>NDAI0I00510 Chr9 complement(104836..105474) [639 bp, 212 aa] {ON}
           Anc_6.319 YCR051W
          Length = 212

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 39  SLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDE 98
           +   +SKDP G T IH  + YG  D+L  L  + G D+N +++ DGDT LH C +Y+   
Sbjct: 25  TFTANSKDPNGYTPIHAAAAYGHIDLLRSLCSEFGGDINIRDN-DGDTPLHHCEDYA--- 80

Query: 99  PEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD-ELESLVNLLQ 143
              G  I E   E+G +  + N  G+TPL++V  D E   L+  L+
Sbjct: 81  --TGKVIVE---ELGGNFTLTNNEGKTPLEVVEEDGESTELIQYLK 121

>CAGL0C03003g Chr3 (297244..297864) [621 bp, 206 aa] {ON} similar to
           uniprot|P25631 Saccharomyces cerevisiae YCR051w
          Length = 206

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 61/127 (48%), Gaps = 15/127 (11%)

Query: 23  LNAVLETLDGDKQAIQSLIND-----SKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVN 77
           +N  +   DG    ++  + D     SKDP G T +H  + YG  D+L  L  + G D+N
Sbjct: 1   MNIWIAASDGRGDIVEKFLADGLSANSKDPNGYTPVHAAAAYGHLDLLRKLCQEHGGDIN 60

Query: 78  QQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD-ELE 136
            ++S DGDT LH C     ++      I E   E+G D  + N  G+T LQ+   D E  
Sbjct: 61  VRDS-DGDTPLHHC-----EDVRVAQLIVE---ELGGDYTLTNDEGKTALQVFEEDAEFP 111

Query: 137 SLVNLLQ 143
            L+  ++
Sbjct: 112 ELIQYMR 118

>Kpol_1028.58 s1028 complement(133357..133983) [627 bp, 208 aa] {ON}
           complement(133357..133983) [627 nt, 209 aa]
          Length = 208

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (49%), Gaps = 17/129 (13%)

Query: 23  LNAVLETLDGDKQAIQSLIN-------DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVD 75
           +N  +   DGD   ++  +N       +SKDP G T +H  + YG   +L+ L  + G D
Sbjct: 1   MNIWVAASDGDVAVVEKYLNSGNGLTANSKDPNGYTPVHAAAAYGHIGLLEKLCKEYGGD 60

Query: 76  VNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD-E 134
           +N ++S DGDT LH       ++     FI E   E+  D ++ N+ G+T L++   D E
Sbjct: 61  INVRDS-DGDTPLHHV-----EDANTARFIVE---ELNGDYKLTNEEGKTALEVFEEDSE 111

Query: 135 LESLVNLLQ 143
              L+  ++
Sbjct: 112 FPELIQYMR 120

>NCAS0D04430 Chr4 (843610..844302) [693 bp, 230 aa] {ON} Anc_6.319
          Length = 230

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 52/102 (50%), Gaps = 10/102 (9%)

Query: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG 102
           +SKDP G T IH  + YG  D+L +L      DVN ++S DGDT LH C     ++ E  
Sbjct: 43  NSKDPNGYTPIHAAAAYGHKDLLRLLCSTYNGDVNVRDS-DGDTPLHHC-----EDLETA 96

Query: 103 TFIAENLIEVGADPRIRNKRGQTPLQLVHSD-ELESLVNLLQ 143
           T I E   E+  D  I N  G+T LQ    D E   L+  ++
Sbjct: 97  TMIIE---ELNGDFTIANNEGKTALQTFEEDGEFPDLIQYMR 135

>ZYRO0D08690g Chr4 complement(747083..747709) [627 bp, 208 aa] {ON}
           highly similar to gnl|GLV|CAGL0C03003g Candida glabrata
           CAGL0C03003g and similar to YCR051W uniprot|P25631
           Saccharomyces cerevisiae YCR051W Hypothetical ORF
          Length = 208

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 63/129 (48%), Gaps = 17/129 (13%)

Query: 23  LNAVLETLDGDKQAIQSLINDS-------KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVD 75
           +N  +   DG    ++ L+ ++       KDP G T +H  + YG  ++L  L  + G +
Sbjct: 1   MNVWIAASDGRTSVVEKLLQENYQRDGNVKDPNGYTPVHAAAAYGHIELLRKLCQEYGGN 60

Query: 76  VNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD-E 134
           +N ++S DGDT LH C     ++      I E   E+G D  ++N+ G+T LQ    D E
Sbjct: 61  INVKDS-DGDTPLHHC-----EDAHTAKVILE---ELGGDISLQNEEGKTALQSAEEDGE 111

Query: 135 LESLVNLLQ 143
              L+  L+
Sbjct: 112 FPELIQYLR 120

>TBLA0F04020 Chr6 (993029..993688) [660 bp, 219 aa] {ON} Anc_6.319
           YCR051W
          Length = 219

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 10/105 (9%)

Query: 40  LINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEP 99
           LI +SKDP G T IH  + YG  D+L +L  +   D+N  ++ DGDT LH C     ++ 
Sbjct: 25  LIANSKDPNGYTPIHAAAAYGHVDLLRLLCQKYNGDINILDN-DGDTPLHHC-----EDV 78

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD-ELESLVNLLQ 143
           E    I E   E+G    ++N  G+T L++   D E   L+  L+
Sbjct: 79  ETAKVIIE---ELGGGYNLKNNEGKTALEVFEEDSEFPDLIMYLR 120

>NDAI0D02540 Chr4 (584626..585336) [711 bp, 236 aa] {ON} Anc_5.97
          Length = 236

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 51/92 (55%), Gaps = 7/92 (7%)

Query: 51  TAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLI 110
           T IH+ S  G+ ++L  L++   VD+N Q ++ G T +HL V+  H +      I + L+
Sbjct: 81  TPIHIASSVGNSNILKQLIEGRNVDLNLQ-TVQGTTPIHLAVSKKHLQ------ICKFLL 133

Query: 111 EVGADPRIRNKRGQTPLQLVHSDELESLVNLL 142
           E GA  RI++K+GQ PL    S     LV +L
Sbjct: 134 ENGASVRIKDKQGQLPLHRAASIGSMGLVEML 165

>Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON}
           similar to Ashbya gossypii AAR063C
          Length = 207

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 9/111 (8%)

Query: 24  NAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSID 83
           + + ET++   Q    L  +SKDP G TA+H  + YG  D+L +L+++   D+N +++ D
Sbjct: 9   DGLTETVEKLLQQQPGLTANSKDPNGYTAVHGAASYGHVDLLRLLVNKYHGDINVRDN-D 67

Query: 84  GDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDE 134
           GDT LH    ++ D       I     E+ AD +  N  G+TPL +   D+
Sbjct: 68  GDTPLH----HTEDVATAKVIIE----ELNADFQATNNEGKTPLDVFEEDQ 110

>KAFR0J02500 Chr10 (476605..477243) [639 bp, 212 aa] {ON} Anc_6.319
           YCR051W
          Length = 212

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 66/142 (46%), Gaps = 20/142 (14%)

Query: 23  LNAVLETLDGDKQAIQSLIND-------SKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVD 75
           +N  +   DG ++ ++  +N+       +KDP G T +H  + YG  D+L  L  +   D
Sbjct: 1   MNIWVAASDGRQELVEKFLNENPSLSANTKDPNGYTPVHAAAAYGHHDLLRKLCSEYNGD 60

Query: 76  VNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD-- 133
           VN +++ DGDT LH C + +         I E   E+  D  + N  G+T LQ+   D  
Sbjct: 61  VNIRDA-DGDTPLHHCEDVN-----TARLIIE---ELNGDFSLVNNEGKTALQVFEEDGE 111

Query: 134 --ELESLVNLLQGAEIAADNKG 153
             EL   + +  G  I  D+ G
Sbjct: 112 FPELIEYMRVKSGIPIEQDSFG 133

>TDEL0A07340 Chr1 (1284474..1285121) [648 bp, 215 aa] {ON} Anc_6.319
           YCR051W
          Length = 215

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 12/103 (11%)

Query: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG 102
           +SKDP G T++H  + YG  ++L  L  Q   D+N +++ DGDT LH C + +       
Sbjct: 28  NSKDPNGYTSVHAAAAYGHIELLKKLCKQYNGDINIRDN-DGDTPLHHCEDVN------- 79

Query: 103 TFIAENLIEV-GADPRIRNKRGQTPLQLVHSD-ELESLVNLLQ 143
              A+ ++EV G D  + N+ G+T LQ    D E   L+  ++
Sbjct: 80  --TAKIIVEVLGGDISLTNEEGKTALQSFEEDAEFPELIQYMR 120

>AAR063C Chr1 complement(453099..453761) [663 bp, 220 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR051W
          Length = 220

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 15/117 (12%)

Query: 23  LNAVLETLDGDKQAIQSLINDS------KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDV 76
           +N  +   DG    ++ L+  +      KDP G T +H  + YG  D+L +L+     DV
Sbjct: 1   MNVWVAASDGLTAQVEELLQQTGADANVKDPNGYTPMHAAAAYGHIDLLRLLIANYRGDV 60

Query: 77  NQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD 133
           N +++ DGDT LH    ++ D       +     E+GADP + N  G TPL +   D
Sbjct: 61  NVRDN-DGDTPLH----HAEDLQTVRVLVE----ELGADPSLLNADGNTPLAVYEDD 108

>KLTH0A06248g Chr1 (524183..524791) [609 bp, 202 aa] {ON} similar to
           uniprot|P25631 Saccharomyces cerevisiae YCR051W
           Hypothetical ORF
          Length = 202

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 23  LNAVLETLDGDKQAIQSLIND-----SKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVN 77
           +N  +   DG  + ++  +++     SKDP G T IH  + YG  D+L  L         
Sbjct: 1   MNIWIAASDGRAELVEKFLSEGFTAESKDPNGYTPIHAAASYGHIDLLRELCSAPYSGSV 60

Query: 78  QQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD-ELE 136
                DGDT LH C     ++      I E   E+G D ++ N  G+T L +   D E  
Sbjct: 61  NVRDNDGDTPLHHC-----EDANTARVILE---ELGGDAKLTNNEGKTALAVCEEDGEFT 112

Query: 137 SLVNLLQG 144
            L+  L+G
Sbjct: 113 DLIQYLRG 120

>KLLA0C09108g Chr3 complement(795433..796059) [627 bp, 208 aa] {ON}
           similar to uniprot|P25631 Saccharomyces cerevisiae
           YCR051W Hypothetical ORF
          Length = 208

 Score = 45.8 bits (107), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 65/130 (50%), Gaps = 17/130 (13%)

Query: 23  LNAVLETLDGDKQAIQSLIN-----DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVN 77
           +N  +   +G+ + ++  I      + KD  G T IH  + YG  D+L  L+ +   DVN
Sbjct: 1   MNIWIAASNGETELVEKFIKQGQTANDKDENGYTPIHAAAAYGHIDLLKKLVQEHNGDVN 60

Query: 78  QQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIE-VGADPRIRNKRGQTPLQLVHSDELE 136
            ++S D DT LH C + +          A +LIE +GAD  + N  G+T  Q V  +  +
Sbjct: 61  IKDS-DNDTPLHHCEDAT---------TARSLIEQLGADRELLNNEGKTCFQ-VWQETCD 109

Query: 137 SLVNLLQGAE 146
             ++LL+ AE
Sbjct: 110 DNLDLLRYAE 119

>KNAG0I02590 Chr9 complement(499721..500365) [645 bp, 214 aa] {ON}
           Anc_6.319 YCR051W
          Length = 214

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 53/115 (46%), Gaps = 16/115 (13%)

Query: 23  LNAVLETLDGDKQAIQSLINDSK-------DPLGNTAIHLCSKYGSWDVLDVLLDQEGVD 75
           +N  +   DG    ++S + DS        DP G T IH  + YG  D+L  L  +   D
Sbjct: 1   MNIWVAASDGRLDVVKSFLTDSTGLTANSADPNGYTPIHAAAAYGHIDMLRTLCREYDGD 60

Query: 76  VNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
           +N +++ DGDT LH   + +       TFI E   E+     + N  G+T LQ+ 
Sbjct: 61  INIRDA-DGDTPLHHIEDVA-----TATFIIE---ELNGAYNLTNNEGKTALQVF 106

>Smik_3.153 Chr3 (212077..212817) [741 bp, 246 aa] {ON} YCR051W
           (REAL)
          Length = 246

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 66/143 (46%), Gaps = 20/143 (13%)

Query: 14  ASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEG 73
           A+   N D +  +L   +G      S+   +KD  G T +H  + YG  D+L  +  +  
Sbjct: 32  AASDGNVDRVERILRESNG------SMTPQTKDINGYTPMHAAAAYGHTDLLKKMCSEYN 85

Query: 74  VDVNQQNSIDGDTALHLCVNYSHDEPEYGT--FIAENLIEVGADPRIRNKRGQTPL-QLV 130
            D+N  ++ DGDT LH      H E + GT   I E   E+G D  IRN  GQTP    V
Sbjct: 86  GDINVLDN-DGDTPLH------HVE-DVGTAKLIVE---ELGGDFTIRNAEGQTPYDSFV 134

Query: 131 HSDELESLVNLLQGAEIAADNKG 153
            + E   L+  ++     AD+ G
Sbjct: 135 ENGEDGELIEYMRIKSGVADSHG 157

>ZYRO0B15114g Chr2 complement(1233061..1233741) [681 bp, 226 aa]
           {ON} similar to uniprot|P50086 Saccharomyces cerevisiae
           YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
           proteasome homolog of the human oncoprotein gankyrin
           which interacts with the retinoblastoma tumor suppressor
           (Rb) and cyclin-dependent kinase 4/6
          Length = 226

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 49/103 (47%), Gaps = 8/103 (7%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLD-QEGVDVNQQNSIDGDTALHLCVNYSHDEP 99
           IN+ KD  G T  H+    G+ D++  L       D+N   +  G TALHL V+  H   
Sbjct: 63  INELKDESGWTPFHIACAVGNLDIVKQLYALHTKPDLNMPTN-QGITALHLAVSKKHAR- 120

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLL 142
                I E L+  GA  R+++KR Q PL    +     +V++L
Sbjct: 121 -----ICEFLLNNGASVRVKDKRSQLPLHRAAAIGSMGMVDML 158

>Skud_3.129 Chr3 (198354..199022) [669 bp, 222 aa] {ON} YCR051W
           (REAL)
          Length = 222

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 53/111 (47%), Gaps = 10/111 (9%)

Query: 44  SKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGT 103
           SKD  G T +H  + YG  D+L  +  +   D+N  ++ DGDT LH   + +        
Sbjct: 32  SKDINGYTPMHAAAAYGHTDLLKKMCSEYNGDINVLDN-DGDTPLHHVEDVA-----TAK 85

Query: 104 FIAENLIEVGADPRIRNKRGQTPLQL-VHSDELESLVNLLQGAEIAADNKG 153
            I E   E+G D  +RN  GQTP  L V + E   L+  ++     AD +G
Sbjct: 86  LIVE---ELGGDFTVRNAEGQTPYDLFVENGEDGELIEYMRIKSGVADAQG 133

>Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051W -
           Hypothetical ORF [contig 15] FULL
          Length = 202

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 60/134 (44%), Gaps = 19/134 (14%)

Query: 23  LNAVLETLDGDKQAIQSLIN-----DSKDPLGNTAIHLCSKYGSWDVLDVLL-DQEGVDV 76
           +N  +   DG    ++  ++     +SKDP G T IH  + Y   D+L  L  D    ++
Sbjct: 1   MNIWIAASDGKTDVVERFLSQGFQAESKDPNGYTPIHAAASYAHIDLLKKLCSDPYNGNI 60

Query: 77  NQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD--- 133
           N +++ DGDT LH C        E  T     L E+G D  + N  G+T L +   D   
Sbjct: 61  NVKDN-DGDTPLHHC--------EDATTARVILEELGGDATLTNNEGKTALAVCEEDAEN 111

Query: 134 -ELESLVNLLQGAE 146
            EL + +  + G E
Sbjct: 112 AELITYLRTVSGEE 125

>NCAS0F00590 Chr6 complement(117069..117776) [708 bp, 235 aa] {ON}
           Anc_5.97 YGR232W
          Length = 235

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 8/93 (8%)

Query: 51  TAIHLCSKYGSWDVLDVLLDQE-GVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENL 109
           T +H+ +  G+  +L  L D+E   D+N Q    G TALHL V   H        + + L
Sbjct: 80  TPVHIAASVGNLFILTQLYDREIKPDLNLQTK-QGTTALHLSVAKKHLS------VCKFL 132

Query: 110 IEVGADPRIRNKRGQTPLQLVHSDELESLVNLL 142
           I+ GA  R+++++GQ PL    S    +LV LL
Sbjct: 133 IDNGASVRLKDQKGQLPLHRAASIGSMTLVELL 165

>YCR051W Chr3 (214071..214739) [669 bp, 222 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm and
           nucleus; contains ankyrin (Ank) repeats; YCR051W is not
           an essential gene
          Length = 222

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 10/121 (8%)

Query: 34  KQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVN 93
           +++  ++   SKD  G T +H  + YG  D+L  + ++   D+N  ++ DGDT LH   +
Sbjct: 22  RESKGAMTPQSKDINGYTPMHAAAAYGHLDLLKKMCNEYNGDINVLDN-DGDTPLHHVED 80

Query: 94  YSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL-QLVHSDELESLVNLLQGAEIAADNK 152
            +         I E   E+G D  IRN  GQTP    V + E   L+  ++     AD  
Sbjct: 81  VA-----TARLIVE---ELGGDFTIRNVEGQTPYDSFVENGEDGELIEYMRIKSGVADVH 132

Query: 153 G 153
           G
Sbjct: 133 G 133

>SAKL0A01870g Chr1 complement(167727..168347) [621 bp, 206 aa] {ON}
           highly similar to gnl|GLV|CAGL0C03003g Candida glabrata
           CAGL0C03003g and similar to YCR051W uniprot|P25631
           Saccharomyces cerevisiae YCR051W Hypothetical ORF
          Length = 206

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 16/128 (12%)

Query: 23  LNAVLETLDGDKQAIQSLIND-----SKDPLGNTAIHLCSKYGSWDVLDVLLDQE-GVDV 76
           +N  +   DG    ++  +N+     S+DP G T IH  + Y   ++L  L  +    D+
Sbjct: 1   MNVWIAASDGRTDLVEQFLNNGLSANSRDPNGYTPIHAAASYAHTELLRKLCSEPYNGDI 60

Query: 77  NQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD-EL 135
           N +++ DGDT LH C     ++      I E   E+G D ++ N  G+T L+    D E 
Sbjct: 61  NVRDN-DGDTPLHHC-----EDVNAAKVIIE---ELGGDYKLTNDEGKTALEAFEEDGEF 111

Query: 136 ESLVNLLQ 143
             L+  ++
Sbjct: 112 PELIQYMR 119

>Suva_3.89 Chr3 (127217..127888) [672 bp, 223 aa] {ON} YCR051W
           (REAL)
          Length = 223

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 50/105 (47%), Gaps = 17/105 (16%)

Query: 31  DGDKQAIQSLINDS--------KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSI 82
           DG+ + ++S++ DS        KD  G T +H  + YG  D+L  L      D+N  ++ 
Sbjct: 11  DGNVERVESILRDSNGAMTPQSKDVNGYTPMHAAAAYGHADLLKKLCSVYNGDINVLDN- 69

Query: 83  DGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
           DGDT LH   + +         I E   E+G +  IRN  GQTP 
Sbjct: 70  DGDTPLHHVEDVA-----TARLIVE---ELGGNVTIRNAEGQTPY 106

>Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W
           (REAL)
          Length = 1077

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           +D  G T + +    G +DV+  +L++ G D+N Q++  G+TALH      H E      
Sbjct: 315 RDSGGRTRLQIACDKGKFDVVKKMLEEGGYDINDQDNA-GNTALHEAALQGHIE------ 367

Query: 105 IAENLIEVGADPRIRNKR--GQTPL 127
           I E LIE GAD  I++    G TPL
Sbjct: 368 IVELLIENGADVNIKSIEMFGDTPL 392

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 9/91 (9%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQN-SIDGDTALHLCVNYSHDEP 99
           IND +D  GNTA+H  +  G  +++++L++  G DVN ++  + GDT L       H + 
Sbjct: 346 IND-QDNAGNTALHEAALQGHIEIVELLIEN-GADVNIKSIEMFGDTPLIDASANGHLD- 402

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
                + + L++  ADP IRN +G T  + V
Sbjct: 403 -----VVKYLLKNDADPTIRNAKGLTAFESV 428

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 52/120 (43%), Gaps = 22/120 (18%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           KE+L  AS+  +   +   +E  +G K  ++S     K          C   G  D+  +
Sbjct: 523 KEKLFKASKEGHLPYVGTYVE--NGGKIDLRSFFESVK----------C---GHEDITSI 567

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
            L   G  VNQ +     ++L + V   H     GT   + L+E GADP  R+++G T L
Sbjct: 568 FL-AFGFPVNQTSRESKTSSLMVAVGRGH----IGT--VKLLLEAGADPTKRDRKGHTAL 620

>YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subunit
           of the Set3 complex, which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity; potential Cdc28p substrate
          Length = 1083

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           +D  G T + +    G +DV+  ++++ G D+N Q++  G+TALH      H E      
Sbjct: 326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNA-GNTALHEAALQGHIE------ 378

Query: 105 IAENLIEVGADPRIRNKR--GQTPL 127
           I E LIE GAD  I++    G TPL
Sbjct: 379 IVELLIENGADVNIKSIEMFGDTPL 403

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 9/91 (9%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQN-SIDGDTALHLCVNYSHDEP 99
           IND +D  GNTA+H  +  G  +++++L++  G DVN ++  + GDT L       H + 
Sbjct: 357 IND-QDNAGNTALHEAALQGHIEIVELLIEN-GADVNIKSIEMFGDTPLIDASANGHLD- 413

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
                + + L++ GADP IRN +G T  + V
Sbjct: 414 -----VVKYLLKNGADPTIRNAKGLTAFESV 439

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 22/120 (18%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           KE+L  AS+  +   +   +E  +G K  ++S     K          C   G  D+  +
Sbjct: 534 KEKLFKASKEGHLPYVGTYVE--NGGKIDLRSFFESVK----------C---GHEDITSI 578

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
            L   G  VNQ +  +  +AL + V   H     GT   + L+E GADP  R+K+G+T L
Sbjct: 579 FL-AFGFPVNQTSRDNKTSALMVAVGRGH----LGT--VKLLLEAGADPTKRDKKGRTAL 631

>TDEL0G01200 Chr7 complement(246082..246765) [684 bp, 227 aa] {ON}
           Anc_5.97 YGR232W
          Length = 227

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 49/103 (47%), Gaps = 8/103 (7%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQE-GVDVNQQNSIDGDTALHLCVNYSHDEP 99
           ++D  D  G T  H+    G  D++  L D+    D+N Q +  G TALHL V+  H   
Sbjct: 63  LDDYPDESGWTPFHIACAVGDIDIVGELYDRMVKPDLNLQTN-QGVTALHLAVSKRHIN- 120

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLL 142
                + E L+  GA  RI++K+ Q PL    +     LV LL
Sbjct: 121 -----VCEFLLRHGASVRIKDKKLQLPLHRAAASGSPVLVELL 158

>Skud_16.170 Chr16 complement(312641..316315) [3675 bp, 1224 aa]
           {ON} YPL110C (REAL)
          Length = 1224

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 53/95 (55%), Gaps = 7/95 (7%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAEN 108
            ++ +HL +++ ++ +L VLL  +  D++ Q++   +T ++L    +  E       A  
Sbjct: 504 SSSLLHLATEWNNYPLLHVLLSSKRFDISYQDNELHETPIYLACRLNFFEA------AVC 557

Query: 109 LIEVGADPRIRNK-RGQTPLQLVHSDELESLVNLL 142
           L+  GADP IR K  G TP+ +  ++  +++V+LL
Sbjct: 558 LLYNGADPEIREKIFGWTPVFVAAAEGFKNIVSLL 592

>YGR232W Chr7 (953960..954646) [687 bp, 228 aa] {ON}
           NAS6Proteasome-interacting protein involved in the
           assembly of the base subcomplex of the 19S proteasomal
           regulatory particle (RP); ortholog of human oncoprotein
           gankyrin, which interacts with the Rb tumor suppressor
           and CDK4/6
          Length = 228

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQE-GVDVNQQNSIDGDTALHLCVNYSHDEP 99
           ++D  D  G T  H+    G+ +V+  L D+    D+N+  +  G T LHL V     E 
Sbjct: 64  LDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITN-QGVTCLHLAVGKKWFE- 121

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLLQGAEIAADN 151
                +++ LIE GA  RI++K  Q PL    S     L+ LL G   +A N
Sbjct: 122 -----VSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVN 168

>Suva_16.200 Chr16 complement(350324..353983) [3660 bp, 1219 aa]
           {ON} YPL110C (REAL)
          Length = 1219

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 66/131 (50%), Gaps = 12/131 (9%)

Query: 27  LETLDGDKQAIQSLINDSKDP----LGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSI 82
           L  L    +A + L++ S DP      ++ +HL +++ ++ +L VLL  +  D+N Q++ 
Sbjct: 479 LSVLGAHPRATEVLLH-SMDPNMKLKSSSLLHLATEWNNYPLLHVLLSSKKFDINYQDNE 537

Query: 83  DGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNK-RGQTPLQLVHSDELESLVNL 141
             +T L+L    +  E       A  L+  GADP I+ K  G T + +  ++  +++++L
Sbjct: 538 LHETPLYLACRLNFFEA------AVCLLYNGADPEIKEKIFGWTAVFVAAAEGFKNIISL 591

Query: 142 LQGAEIAADNK 152
           L    +  D K
Sbjct: 592 LVANRVNFDIK 602

>Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W
           (REAL)
          Length = 1141

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 9/91 (9%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQN-SIDGDTALHLCVNYSHDEP 99
           IND +D  GNTA+H  +  G  +++++L++  G DVN ++  + GDT L       H + 
Sbjct: 414 IND-QDNAGNTALHEAALQGHIEIVELLIEN-GADVNIKSIEMFGDTPLIDASANGHLD- 470

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
                + + L++ GADP IRN +G T  + V
Sbjct: 471 -----VVKYLLKQGADPTIRNSKGLTAFESV 496

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           +D  G T + +    G +DV+  +++  G D+N Q++  G+TALH      H E      
Sbjct: 383 RDSGGRTRLQIACDKGKFDVVQKMIEDGGYDINDQDNA-GNTALHEAALQGHIE------ 435

Query: 105 IAENLIEVGADPRIRNKR--GQTPL 127
           I E LIE GAD  I++    G TPL
Sbjct: 436 IVELLIENGADVNIKSIEMFGDTPL 460

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 22/120 (18%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           KE+L  AS+  +   +   +E  +G K  ++S     K          C   G  D+  +
Sbjct: 591 KEKLFKASKEGHLPYVGTYVE--NGGKIDLKSFFESVK----------C---GHEDITSI 635

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
            L   G  VNQ +  +  +AL + V   H     GT   + L+E GADP  ++K+G T L
Sbjct: 636 FL-AFGFPVNQASRDNKTSALMVAVGRGH----IGT--VKLLLEAGADPTKKDKKGHTAL 688

>KLLA0F00660g Chr6 (54232..58356) [4125 bp, 1374 aa] {ON} similar to
           uniprot|Q02979 Saccharomyces cerevisiae YPL110C
           Hypothetical ORF
          Length = 1374

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 53  IHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEV 112
           +HL ++  S D++D LL   G D+N ++    +TAL+L    +  E       AE+L+  
Sbjct: 541 LHLATRLNSPDLIDALLSVPGFDINYRDLDHLETALYLACKLNLRE------AAEHLLNR 594

Query: 113 GADPRIRNK-RGQTPLQLVHSDELESLVNLLQ 143
           GAD  I  K  G TP+ +  ++    LV +L+
Sbjct: 595 GADMEIGEKLFGWTPIFVAATEGFTDLVKVLK 626

>CAGL0L06600g Chr12 (744800..745495) [696 bp, 231 aa] {ON} similar
           to uniprot|P50086 Saccharomyces cerevisiae YGR232w
          Length = 231

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 45/91 (49%), Gaps = 10/91 (10%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEG---VDVNQQNSIDGDTALHLCVNYSHD 97
           I+   D  G T  H+    G  D++D L +       +++ Q S  G TALHL V   H 
Sbjct: 65  IDTLTDEAGWTPFHISCSIGHLDIVDQLYNNNPDARPNLDLQTS-QGVTALHLAVAKKHL 123

Query: 98  EPEYGTFIAENLIEVGADPRIRNKRGQTPLQ 128
           E      + + LI++GA  RI++K+GQ  L 
Sbjct: 124 E------VCKYLIKLGASVRIKDKKGQIALH 148

>Smik_16.74 Chr16 complement(142064..142750) [687 bp, 228 aa] {ON}
           YGR232W (REAL)
          Length = 228

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (46%), Gaps = 8/105 (7%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQE-GVDVNQQNSIDGDTALHLCVNYSHDEP 99
           ++D  D  G T  H+    G+ DV+  L D+    D+N+  +  G T LHL V     E 
Sbjct: 64  LDDYSDDSGWTPFHIACSVGNLDVVKSLYDRPIKPDLNKVTN-QGVTCLHLAVGKKWFE- 121

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLLQG 144
                +++ LI  GA  RI++K  Q PL    S     L+ LL G
Sbjct: 122 -----VSQFLITNGASVRIKDKFNQIPLHRAASVGSLKLIELLCG 161

>KNAG0A01570 Chr1 complement(78024..78722) [699 bp, 232 aa] {ON}
           Anc_5.97 YGR232W
          Length = 232

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 60/133 (45%), Gaps = 14/133 (10%)

Query: 14  ASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEG 73
           A   N+ D++  +L  + G    + +L++DS      T  H+    GS  ++  L +++ 
Sbjct: 47  AVSFNHQDIVALLLAHMQGVD--LDTLLDDSN----WTPFHIACAVGSLTLVKKLYERDT 100

Query: 74  -VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHS 132
             D+N Q    G TALHL V   H E      +   L+E GA  RI++K  Q PL    S
Sbjct: 101 KPDLNLQTG-QGTTALHLAVAKGHYE------VVRFLVENGASTRIKDKNQQIPLHRAAS 153

Query: 133 DELESLVNLLQGA 145
                LV  L  A
Sbjct: 154 VGSMKLVEFLCTA 166

>Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W
           (REAL)
          Length = 1085

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 9/91 (9%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQN-SIDGDTALHLCVNYSHDEP 99
           IND +D  GNTA+H  +  G  +++++L+ + G DVN ++  + GDT L       H + 
Sbjct: 353 IND-QDNAGNTALHEAALQGHIEIVELLI-KNGADVNIKSIEMFGDTPLIDASANGHLD- 409

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
                + + L++ GADP IRN +G T  + V
Sbjct: 410 -----VVKYLLKNGADPTIRNAKGLTAFESV 435

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 59/140 (42%), Gaps = 26/140 (18%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           KE+L  AS+  +   +   +E  +G K  ++S                  KYG  D+  +
Sbjct: 530 KEKLFKASKEGHLPYVGTYVE--NGGKIDLKSFFE-------------SVKYGHEDITSI 574

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
            L   G  VNQ +     +AL + V   H     GT   + L+E GADP  R+K+G T L
Sbjct: 575 FL-AFGFPVNQTSRDSKTSALMMAVGRGH----LGT--VKLLLEAGADPTKRDKKGHTAL 627

Query: 128 QLVHSDELESLVNLLQGAEI 147
               +    SL+ +    EI
Sbjct: 628 YYAKN----SLMGITNSEEI 643

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           +D  G T + +    G +DV+  ++++   D+N Q++  G+TALH      H E      
Sbjct: 322 RDSGGRTRLQIACDKGKFDVVKNMIEEGSYDINDQDNA-GNTALHEAALQGHIE------ 374

Query: 105 IAENLIEVGADPRIRNKR--GQTPL 127
           I E LI+ GAD  I++    G TPL
Sbjct: 375 IVELLIKNGADVNIKSIEMFGDTPL 399

>CAGL0F06831g Chr6 (668173..671451) [3279 bp, 1092 aa] {ON} similar
           to uniprot|P40578 Saccharomyces cerevisiae YIR033w MGA2
           or uniprot|P35210 Saccharomyces cerevisiae YKL020c SPT23
          Length = 1092

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (45%), Gaps = 20/120 (16%)

Query: 46  DPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHL-CVNYSHDEPEYGTF 104
           D LG T +HL S  G + ++  L+ ++G  ++ ++S D  T LH  CV  S D       
Sbjct: 728 DNLGRTLLHLASLKGYFKLVSTLI-KKGARIDDKDSFDF-TPLHFACV--SGDVK----- 778

Query: 105 IAENLIEVGADPRIRNKRGQTPLQLV----------HSDELESLVNLLQGAEIAADNKGK 154
           I   L++ GAD   + K G  PL+L           HSD +  +V +    E A    G+
Sbjct: 779 IIRILLDCGADKNRKTKHGLLPLELFEINHGYGEKEHSDHMTEVVKMFTEDESAESGMGR 838

>SAKL0E08382g Chr5 complement(676318..679575) [3258 bp, 1085 aa]
           {ON} similar to uniprot|P40480 Saccharomyces cerevisiae
           YIL112W HOS4 Subunit of the Set3 complex which is a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity potential Cdc28p
           substrate
          Length = 1085

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 55/128 (42%), Gaps = 23/128 (17%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           +E+L  AS+      + A LE  +G +   +S +                KYG  D+  +
Sbjct: 540 REKLFKASKTGKLPYVGAFLE--NGGRVDFRSFLE-------------AVKYGHEDIASL 584

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
            L   G  VN   S DG TAL + V   H     GT     L+E GADP  R+K G++ L
Sbjct: 585 FL-AFGAQVNMA-SKDGTTALMVAVGRGH----IGT--VRLLLEAGADPDARDKDGKSVL 636

Query: 128 QLVHSDEL 135
               + EL
Sbjct: 637 SYAKNSEL 644

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           +D  G T + +    G +D+  +L+ +EG +VN Q++  G++ LH      H +      
Sbjct: 354 RDAGGRTKLQIACDKGKYDLAKMLIVEEGYNVNDQDNA-GNSPLHEAALNGHLD------ 406

Query: 105 IAENLIEVGAD 115
           I + L+E GAD
Sbjct: 407 IVKLLLEHGAD 417

>KLLA0E15709g Chr5 complement(1406502..1407194) [693 bp, 230 aa]
           {ON} similar to uniprot|P50086 Saccharomyces cerevisiae
           YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
           proteasome homolog of the human oncoprotein gankyrin
           which interacts with the retinoblastoma tumor suppressor
           (Rb) and cyclin-dependent kinase 4/6
          Length = 230

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 12/100 (12%)

Query: 46  DPLGNTAIHLCSKYGSWDVLDVLLD---QEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG 102
           D  G + +H+ S  GS  +L+ LL+   +  +D+   N I   TALHL  +  H      
Sbjct: 70  DESGWSPVHIASSIGSVTILEKLLNHTVEPNLDLQANNGI---TALHLACSKKHLN---- 122

Query: 103 TFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLL 142
             + + L+E GA  RI++  GQ PL    +     +V++L
Sbjct: 123 --VVQLLVERGASVRIKDGLGQLPLHRAAASGSVGIVSIL 160

>Kpol_1050.62 s1050 (137219..137911) [693 bp, 230 aa] {ON}
           (137219..137911) [693 nt, 231 aa]
          Length = 230

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAEN 108
           G T  H+    G+ +++ +L +++        +  G TALHL V+  H++      + + 
Sbjct: 75  GWTPFHIACSVGNLNIVKMLYERDVAPDLGLPTAQGVTALHLAVSKKHND------VVKF 128

Query: 109 LIEVGADPRIRNKRGQTPLQLVHSDELESLVNLL 142
           L++ GA  R+++K+ Q PL    S    +LV LL
Sbjct: 129 LLDNGASVRVKDKKLQLPLHRAVSVGSMALVELL 162

>TBLA0A07030 Chr1 (1721376..1722752) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 13/79 (16%)

Query: 83  DGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHS-------DEL 135
           +G+T LH  V+ +H        +   LIE GAD  I   RG+TPL    S          
Sbjct: 60  EGNTPLHWLVSVAH------VTLVRRLIEAGADSCIGCARGETPLMRAVSCTNNYDAGTF 113

Query: 136 ESLVNLLQGAEIAADNKGK 154
           ESL+++L+ + I  D  G+
Sbjct: 114 ESLLDILEPSIICVDTLGR 132

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 37.7 bits (86), Expect = 0.010,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 15/106 (14%)

Query: 32  GDKQAIQSLINDSKDPLGN--------TAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSID 83
           GD  A++ ++N  +  + N        T +H  S      V+D L+ + G DVN +    
Sbjct: 76  GDLAAVKEIVNSGQVDINNDYDKTEQVTGLHWASINNRLGVVDFLVSR-GADVNIKAGSL 134

Query: 84  GDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQL 129
               LH    Y +       +I   L+E GADPR+ + +G   L L
Sbjct: 135 HAPPLHWAARYGY------VYIVHYLLEHGADPRVTDDQGFNLLHL 174

>Skud_7.566 Chr7 (928849..929535) [687 bp, 228 aa] {ON} YGR232W
           (REAL)
          Length = 228

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 8/106 (7%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQE-GVDVNQQNSIDGDTALHLCVNYSHDEP 99
           ++D  D  G T  H+    G   V+  L D+    D+N+  +  G T LHL V     E 
Sbjct: 64  LDDYPDHSGWTPFHIACSVGDLGVVKSLYDRPVKPDLNKVTN-QGITCLHLTVGKKWFE- 121

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLLQGA 145
                +++ LI  GA  RI++K  Q PL    S     L+ LL GA
Sbjct: 122 -----VSQFLINNGASVRIKDKFNQIPLHRAASVGSLKLIALLCGA 162

>KAFR0B04260 Chr2 (884243..884935) [693 bp, 230 aa] {ON} Anc_5.97
           YGR232W
          Length = 230

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 55/104 (52%), Gaps = 10/104 (9%)

Query: 26  VLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQE-GVDVNQQNSIDG 84
           +++ L  + +AI   +++ KD  G T  H+    G+  +++ L +++   D+N   S  G
Sbjct: 54  IIQLLLNNMKAID--LDNLKDDAGWTVFHIACSIGNLSIVEALYNRDIKPDLNLATS-QG 110

Query: 85  DTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQ 128
            T LHL V   +++      + + LI+ GA  RI++K+GQ  L 
Sbjct: 111 VTPLHLAVAKKYND------VVKFLIDNGASVRIKDKKGQIALH 148

>Kwal_23.4914 s23 (921368..924499) [3132 bp, 1043 aa] {ON} YIL112W -
           Hypothetical ORF [contig 6] FULL
          Length = 1043

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 66/151 (43%), Gaps = 28/151 (18%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           +E+LL AS+      + A LE  +G +   +S +                KYG  D+  +
Sbjct: 501 REKLLRASKEGKLSYVGAYLE--NGGRVDFKSFLE-------------AVKYGHEDITSL 545

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
            L   G   N   S +G T L + V   H      T   + L+E GADP +++K+G++ L
Sbjct: 546 FL-AFGAQPNM-TSREGQTPLMVSVGRGH------TGTVKLLLEAGADPLVKDKQGRSVL 597

Query: 128 QLVHSDEL----ESLVNLLQGA-EIAADNKG 153
                 EL    +  ++L+Q A  + + N G
Sbjct: 598 NYAKRSELGLVSKQEIDLIQDAISVKSQNTG 628

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 34  KQAIQSLIN-DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVN-QQNSIDGDTALHLC 91
           K+ IQ   N D +D  GN+++H  +  G  D++++LL+  G  VN Q +    DT L   
Sbjct: 339 KRLIQEGYNVDDQDNAGNSSLHEAALNGHLDIVELLLES-GASVNVQSHEPIRDTPLIDA 397

Query: 92  VNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD 133
               H +      + + L+   ADP I N +G T ++ +  D
Sbjct: 398 AANGHLD------VVKVLLRHRADPTITNSKGLTAIESIEED 433

>Smik_16.126 Chr16 complement(224488..228138) [3651 bp, 1216 aa]
           {ON} YPL110C (REAL)
          Length = 1216

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%), Gaps = 7/95 (7%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAEN 108
            ++ +HL +++ ++ +L+VLL  +  D+N Q++   +T L+L    +  E          
Sbjct: 504 SSSLLHLATEWNNYSLLNVLLSSKKFDINYQDNELHETPLYLACRLNFFEATVC------ 557

Query: 109 LIEVGADPRIRNK-RGQTPLQLVHSDELESLVNLL 142
           L+  GAD  IR K  G T + +  ++  E +V+LL
Sbjct: 558 LLYNGADLEIREKLFGWTAVFVAAAEGFEDIVSLL 592

>KNAG0A01560 Chr1 (74485..77964) [3480 bp, 1159 aa] {ON} Anc_5.96
           YGR233C
          Length = 1159

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 10/117 (8%)

Query: 11  LLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLD 70
           LL A R NN      +L   +  ++ IQ   N  +D  G  A+HL +KYG    L  LL 
Sbjct: 470 LLTACRYNNYGATKIILRLCN--ERGIQ--FNSVQDSHGLGALHLVAKYGGDPSLIDLLI 525

Query: 71  QEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
           + G D N+ +S+D    +   +       E    +   L++ GA+  +++  G++PL
Sbjct: 526 EYGADPNELDSLDNLPPIVYAIK------EGRPLLVNKLLKSGANINMKDDEGKSPL 576

>ZYRO0D02332g Chr4 (180577..183222) [2646 bp, 881 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112W HOS4
           Subunit of the Set3 complex which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity potential Cdc28p substrate
          Length = 881

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 9/86 (10%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVN-QQNSIDGDTALHLCVNYSHDEP 99
           +ND +D  GNTA+H  +  G  D++ +L++  G DVN Q   +  DTAL       H   
Sbjct: 307 VND-QDNAGNTALHEAALNGHLDIVKLLVNH-GADVNVQSYEMFKDTALIDASANGH--- 361

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQT 125
                + + L+E GADP + N +G T
Sbjct: 362 ---LPVVQFLLERGADPLVCNAKGLT 384

>TPHA0D03790 Chr4 (797282..797923) [642 bp, 213 aa] {ON} Anc_6.319
           YCR051W
          Length = 213

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 17/129 (13%)

Query: 23  LNAVLETLDGDKQAIQSLIN-------DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVD 75
           +N  +   DG    ++  +N       +SKD  G T +H  + YG  D+L  L ++   D
Sbjct: 1   MNIWIAASDGRIDLVEKFLNSNTGVTVNSKDENGYTPVHAAAAYGHNDLLRKLCNEYNGD 60

Query: 76  VNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSD-E 134
           +N ++  DGDT LH       ++      I E   E+  D ++ N   +T L+    D E
Sbjct: 61  INIRD-FDGDTPLHHV-----EDVNTAKVIIE---ELDGDFKLTNNEDKTALETFEEDSE 111

Query: 135 LESLVNLLQ 143
              L+  ++
Sbjct: 112 FPELITYMR 120

>YAR042W Chr1 (192619..196185) [3567 bp, 1188 aa] {ON}  SWH1Protein
           similar to mammalian oxysterol-binding protein; contains
           ankyrin repeats; localizes to the Golgi and the
           nucleus-vacuole junction
          Length = 1188

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 64  VLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG 123
           +L    + E +D+N  +   GDT LH  V       +    +   L+E GADP  R+++G
Sbjct: 177 ILSSPRNAELLDINGMDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKG 230

Query: 124 QTPLQLV 130
           + P++LV
Sbjct: 231 KLPIELV 237

>SAKL0H08580g Chr8 complement(737581..741684) [4104 bp, 1367 aa]
           {ON} similar to uniprot|Q02979 Saccharomyces cerevisiae
           YPL110C Hypothetical ORF
          Length = 1367

 Score = 35.8 bits (81), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 57/119 (47%), Gaps = 7/119 (5%)

Query: 25  AVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDG 84
           AV+ T     + + S IN +K    +  +HL ++  S +++D LL   G +++ Q+    
Sbjct: 513 AVIGTHPMTVKVLNSFINPNKALHSSHLLHLATRLNSPELIDALLSVNGFEIDYQDEETR 572

Query: 85  DTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNK-RGQTPLQLVHSDELESLVNLL 142
           +TAL++      +  E  TF    L+E GA   +  K  G TP+    ++    +V LL
Sbjct: 573 ETALYIASKL--NLVEATTF----LLEKGASTELGEKFFGWTPMFAAATEGYADIVRLL 625

>TDEL0C04040 Chr3 complement(707532..710555) [3024 bp, 1007 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1007

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 68/155 (43%), Gaps = 31/155 (20%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           KE+L  AS+      + A LE  +G K  ++S                  K+G  D++ +
Sbjct: 502 KEKLFKASKEGKLSYVGAYLE--NGGKIDLKSFFE-------------AVKFGHEDIVSL 546

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQT-- 125
            L   G  VN   S +G TAL   V   H     GT   + L+E GADP  ++K G T  
Sbjct: 547 FL-AFGAPVNAV-SKNGTTALICAVGRGH----VGT--VKLLLEAGADPSKKDKNGHTAS 598

Query: 126 ------PLQLVHSDELESLVNLLQGAEIAADNKGK 154
                 P+ +V+++E+E L   ++ +     +K K
Sbjct: 599 HYAENSPMGVVNTEEIELLEQAIKKSSSHVTSKEK 633

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 9/96 (9%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQN-SIDGDTALHLCVNYSHDEP 99
           +ND +D  GNTA+H  +  G  D++ +L++  G DVN Q+  +  DT L       H + 
Sbjct: 346 VND-QDNAGNTALHEAALNGHLDIVKLLIEN-GADVNMQSFEMFKDTPLIDASANGHLD- 402

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDEL 135
                + + L+  GADP I N +G T  + +   +L
Sbjct: 403 -----VVKYLLSHGADPTICNAKGLTAFESIEDSDL 433

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 7/71 (9%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           +D  G T + +    G+++    L+++EG DVN Q++  G+TALH      H +      
Sbjct: 315 RDAGGRTRLQISCDKGNYEQAKKLIEEEGYDVNDQDNA-GNTALHEAALNGHLD------ 367

Query: 105 IAENLIEVGAD 115
           I + LIE GAD
Sbjct: 368 IVKLLIENGAD 378

>Suva_7.524 Chr7 (908440..909126) [687 bp, 228 aa] {ON} YGR232W
           (REAL)
          Length = 228

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (46%), Gaps = 8/103 (7%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQE-GVDVNQQNSIDGDTALHLCVNYSHDEP 99
           ++D  D  G T  H+    G  +V+  L D+    D+N+  +  G T LHL V     E 
Sbjct: 64  LDDYPDESGWTPFHIACSVGDLEVVKSLYDRPIKPDLNKVTN-QGITCLHLAVGKKWYE- 121

Query: 100 EYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLL 142
                +++ LI+ GA  RI++K  Q PL    S     L+ LL
Sbjct: 122 -----VSKFLIDNGASVRIKDKLNQIPLHRAASVGSLRLIELL 159

>KLLA0F03619g Chr6 (342770..345652) [2883 bp, 960 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112W HOS4
           Subunit of the Set3 complex which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity potential Cdc28p substrate
          Length = 960

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 42/91 (46%), Gaps = 12/91 (13%)

Query: 59  YGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRI 118
           YG  DV+ + L   G  VN  N  +G T L L V   H        + + L+E GADP+ 
Sbjct: 473 YGHDDVVSLFL-AFGAQVNMSNK-EGQTPLMLSVGRGH------VNVVKLLLEAGADPQK 524

Query: 119 RNKRGQTPLQLVHSDEL----ESLVNLLQGA 145
            +KR +T L   +   L       VNLL+ A
Sbjct: 525 TDKRKKTALHYANHSSLGLTDPDEVNLLKAA 555

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 7/76 (9%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           +D  G T + +    G +D+   L++++G DVN Q++  G+T LH      H      + 
Sbjct: 255 RDAGGRTKLQIACDKGKYDLAKKLIEEDGYDVNDQDNA-GNTPLHEAALNGH------SA 307

Query: 105 IAENLIEVGADPRIRN 120
           I E L+  GA+  I++
Sbjct: 308 IVELLVRNGANVNIQS 323

>ZYRO0A10296g Chr1 complement(834376..838395) [4020 bp, 1339 aa]
           {ON} similar to uniprot|Q02979 Saccharomyces cerevisiae
           YPL110C Hypothetical ORF
          Length = 1339

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 22/111 (19%)

Query: 53  IHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF------IA 106
           +HL ++  S  +++ LL  EG D+N             C   SH+ P Y          A
Sbjct: 548 LHLATRLNSGSLVESLLSAEGFDLN------------FCDEESHETPLYLASKLNLYDAA 595

Query: 107 ENLIEVGADPRIRNK-RGQTPLQLVHSDELESLVNLLQ--GAE-IAADNKG 153
             L++ GA+  +R K  G TP+ +  ++  E +V LL+  GAE +  D+ G
Sbjct: 596 ACLLKHGANTELREKLFGWTPIFVAATEGYERIVQLLRDHGAEYVVFDDSG 646

>NCAS0B06410 Chr2 complement(1209149..1212313) [3165 bp, 1054 aa]
           {ON} Anc_2.257
          Length = 1054

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 48/118 (40%), Gaps = 30/118 (25%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSH-------- 96
           +D  G   + +    G +DV   L+++EG DVN Q++  G++ALH      H        
Sbjct: 300 RDSGGRNRLQIACDKGKYDVAKRLIEEEGYDVNDQDNA-GNSALHEAALNGHISIVKLLI 358

Query: 97  ------DEPEYGTF---------------IAENLIEVGADPRIRNKRGQTPLQLVHSD 133
                 +   Y  F               + + L+E GADP I N +G T  + +  D
Sbjct: 359 DNGANVNIQSYEMFQDTPLVDASANGHLDVVQLLLENGADPTITNAKGITAYESIEED 416

>SAKL0G15532g Chr7 (1336097..1336798) [702 bp, 233 aa] {ON} similar
           to uniprot|P50086 Saccharomyces cerevisiae YGR232W NAS6
           Regulatory non-ATPase subunit of the 26S proteasome
           homolog of the human oncoprotein gankyrin which
           interacts with the retinoblastoma tumor suppressor (Rb)
           and cyclin-dependent kinase 4/6
          Length = 233

 Score = 34.3 bits (77), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 9/99 (9%)

Query: 46  DPLGNTAIHLCSKYGSWDVLDVLLDQEGV-DVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           D  G + +H+ S  G+  ++  L+D   + DVN   S  G TALHL  +  H +      
Sbjct: 72  DESGWSPLHVASSVGNLAIVKTLMDSTNMPDVNLVTS-SGTTALHLACSKMHYK------ 124

Query: 105 IAENLIEVG-ADPRIRNKRGQTPLQLVHSDELESLVNLL 142
           IAE L+ V  A  RI+++  Q  L    S     LV LL
Sbjct: 125 IAEYLVIVKRASTRIKDRHYQLALHRAASVGSVPLVKLL 163

>TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3.175
           YAR042W
          Length = 1268

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 64  VLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG 123
           +L    + E +D+N  +   GDT LH  V       +    +   L+E GADP  R+++G
Sbjct: 205 ILSAPRNAELLDINGMDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRQG 258

Query: 124 QTPLQLV 130
           + P+ LV
Sbjct: 259 KLPIDLV 265

>Ecym_7094 Chr7 (181244..185287) [4044 bp, 1347 aa] {ON} similar to
           Ashbya gossypii AGR223W
          Length = 1347

 Score = 34.7 bits (78), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 53  IHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEV 112
           +HL ++  S  ++D LL   G D+N Q++   +T L++       E       A+ LI+ 
Sbjct: 523 LHLATRLNSPALIDSLLSVNGFDINHQDAETSETPLYVACKLDLYEA------AKALIKR 576

Query: 113 GADPRIRNK-RGQTPLQLVHSDELESLVNLL 142
           GA+  I  K  G TP+ +  ++    +V LL
Sbjct: 577 GANMEIGEKLFGWTPIFIAVTEGYARIVKLL 607

>Smik_1.107 Chr1 (171768..175307) [3540 bp, 1179 aa] {ON} YAR042W
           (REAL)
          Length = 1179

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 64  VLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG 123
           +L    + E +D+N  +   GDT LH  V       +    +   L+E GADP  R+++G
Sbjct: 176 ILSSPRNAELLDINGMDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKG 229

Query: 124 QTPLQLV 130
           + P+ LV
Sbjct: 230 KLPIDLV 236

>NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa]
           {ON} Anc_2.639
          Length = 408

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 7/81 (8%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAEN 108
           GNT +HL    G      +LL      +N++    G T +H    Y H +          
Sbjct: 75  GNTCVHLALINGHEQTTHLLLQHFPRFINEKGE-HGRTPVHFACMYDHFQ------CLSL 127

Query: 109 LIEVGADPRIRNKRGQTPLQL 129
           LI VGA+  I+++ G+TPL +
Sbjct: 128 LIGVGANLTIKDEDGETPLHI 148

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 5/62 (8%)

Query: 35  QAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQ-NSIDGDTALHLCVN 93
           Q     IN+ K   G T +H    Y  +  L +L+   GV  N      DG+T LH+C+ 
Sbjct: 96  QHFPRFINE-KGEHGRTPVHFACMYDHFQCLSLLI---GVGANLTIKDEDGETPLHICLE 151

Query: 94  YS 95
           YS
Sbjct: 152 YS 153

>Skud_1.91 Chr1 (162916..166413) [3498 bp, 1165 aa] {ON} YAR042W
           (REAL)
          Length = 1165

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 64  VLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG 123
           +L    + E +D+N  +   GDT LH  V       +    +   L+E GADP  R+++G
Sbjct: 176 ILSSPRNAELLDINGMDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKG 229

Query: 124 QTPLQLV 130
           + P+ LV
Sbjct: 230 KLPIDLV 236

>Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W
           (REAL)
          Length = 1159

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 72  EGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
           E +D+N  +   GDT LH  V       +    +   L+E GADP  R+++G+ P+ LV
Sbjct: 184 ELLDINGMDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKGKLPIDLV 236

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 34.3 bits (77), Expect = 0.14,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 8/89 (8%)

Query: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG 102
           DS DP G TA+H  +  G  + ++ LL  +  DV   ++  G T LH      H      
Sbjct: 186 DSPDPTGKTALHWAAYQGDPNTVEALLKFDA-DVRVVDT-GGFTPLHWATVKGHPH---- 239

Query: 103 TFIAENLIEVGADPRIRNKRGQTPLQLVH 131
             + + LIE G+D  ++N  G+  L +  
Sbjct: 240 --VLKALIEHGSDVFLKNNDGKNALMIAQ 266

>YPL110C Chr16 complement(341068..344739) [3672 bp, 1223 aa] {ON}
           GDE1Glycerophosphocholine (GroPCho) phosphodiesterase;
           hydrolyzes GroPCho to choline and glycerolphosphate, for
           use as a phosphate source and as a precursor for
           phosphocholine synthesis; may interact with ribosomes
          Length = 1223

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 7/95 (7%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAEN 108
            ++ +HL +++ ++ +L VLL  +  D+N Q++   +T L+L    +  E       A  
Sbjct: 504 SSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEA------AVC 557

Query: 109 LIEVGADPRIRNK-RGQTPLQLVHSDELESLVNLL 142
           L+  GAD  IR K  G T + +  ++    +V LL
Sbjct: 558 LLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLL 592

>TDEL0A05440 Chr1 (953042..956908) [3867 bp, 1288 aa] {ON} Anc_8.599
           YPL110C
          Length = 1288

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 9/120 (7%)

Query: 25  AVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDG 84
           AVL +       + S +N SK       +HL ++  S  ++  LL   G +VN ++    
Sbjct: 504 AVLGSHPLTASTLLSYMNSSKPMSSPQLLHLATRLNSPPLIKALLSATGFNVNYRDEETL 563

Query: 85  DTALHLCVNYS-HDEPEYGTFIAENLIEVGADPRIRNK-RGQTPLQLVHSDELESLVNLL 142
           +T L+L    + +D        A  L+E GAD  I  K  G TP+    ++    +V LL
Sbjct: 564 ETPLYLASKLNLYDA-------ASCLLESGADTEIPEKLFGWTPIFAAATEGFNKMVQLL 616

>Suva_16.68 Chr16 (108464..109063) [600 bp, 199 aa] {ON} YPL239W
           (REAL)
          Length = 199

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 61/128 (47%), Gaps = 6/128 (4%)

Query: 14  ASRRNNADLLNAVLETLDGDKQA--IQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQ 71
           A+   + + +  +LET+  +  A  +++ IN+  +  GNTA+H  S  G  DV+ +L DQ
Sbjct: 57  AAANGHVETVQYILETVSRENSAEELKAFINEVNET-GNTALHWASLNGKLDVVRLLCDQ 115

Query: 72  EGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVH 131
              D   +N   G  A+    N   +E E   F+ +  +E   D   + + GQ  +Q+  
Sbjct: 116 YEADPFIRNKF-GHDAIFEAENSGKEEVE-TYFLKKYDVEPEDDEDAQCE-GQAAVQITK 172

Query: 132 SDELESLV 139
             E+E + 
Sbjct: 173 GTEIEQVT 180

>KNAG0E01880 Chr5 (389045..392023) [2979 bp, 992 aa] {ON} Anc_2.257
           YIL112W
          Length = 992

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVN-QQNSIDGDTALHLCVNYSHDEPEY 101
           D +D  GNT +H  +  G  D++ +L++  G +VN Q  ++ GDT L       H +   
Sbjct: 275 DDQDNAGNTPLHEAALNGHLDIVKLLVET-GANVNIQSFAMFGDTPLIDASANGHLD--- 330

Query: 102 GTFIAENLIEVGADPRIRNKRGQTPLQLV 130
              + + L+  G+DP I N +G T  + +
Sbjct: 331 ---VVQYLVAHGSDPTITNAKGLTAYEAI 356

>ZYRO0E00924g Chr5 complement(62334..63560) [1227 bp, 408 aa] {ON}
           similar to uniprot|Q04749 Saccharomyces cerevisiae
           YMR068W AVO2 Component of a complex containing the Tor2p
           kinase and other proteins which may have a role in
           regulation of cell growth
          Length = 408

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 62/137 (45%), Gaps = 21/137 (15%)

Query: 25  AVLETLDGDKQAIQSLIN------DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQ 78
           A L  ++G +Q    L+       D +   G T +H+  ++  +   ++L+   GV  N 
Sbjct: 79  AHLSLMNGHEQTTHLLLQYFPQLIDWRGHEGKTPVHIACQHDYFQCFNLLM---GVGANL 135

Query: 79  QNSID-GDTALHLCVNYSHDEPEYGTF-IAENLIEVG--ADPRIRNKRGQTPLQLVHSDE 134
               D GDT LH+C+       EYG+    + LI  G   D  ++NK+G  P  +  + E
Sbjct: 136 TIKDDYGDTPLHVCL-------EYGSINCMKMLILQGGIVDDHVKNKKGWKPSDVASTYE 188

Query: 135 LESL-VNLLQGAEIAAD 150
              L   +L+ A++  +
Sbjct: 189 TTKLYTKVLKEAQMPGN 205

>TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {ON}
           Anc_8.599 YPL110C
          Length = 1246

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPE 100
           I+ + D  G TA++L SK  ++++  VLL Q G        +   T L +    ++ E  
Sbjct: 532 IDVTNDESGETALYLASKLNNFEIAKVLL-QNGASTEVPEKLFSWTPLFIAAVENNLE-- 588

Query: 101 YGTFIAENLIEVGADPRIRNKRGQTPLQ 128
               IA+ LIE GA   + ++ G TPL+
Sbjct: 589 ----IAKLLIEYGAHVYVFDESGWTPLE 612

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 7/84 (8%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           KD   +T I+LC K    +VL  L      +++  N   G+TAL+L    ++ E      
Sbjct: 501 KDSCDDTIIYLCIKANLLEVLRALFSMNCYNIDVTNDESGETALYLASKLNNFE------ 554

Query: 105 IAENLIEVGADPRIRNK-RGQTPL 127
           IA+ L++ GA   +  K    TPL
Sbjct: 555 IAKVLLQNGASTEVPEKLFSWTPL 578

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 33.5 bits (75), Expect = 0.22,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 16/107 (14%)

Query: 31  DGDKQAIQSLINDSKDPLGNTAI------HLCSKYGSWDVLDVLLDQEGVDVNQQNSIDG 84
           DG+ + ++ ++      + N  I      H       + V + L+   G + NQ    + 
Sbjct: 57  DGNLKVVKEMVESGAIDINNDCIDEIPGLHWACIKNRFSVAEFLV-LRGANPNQTAGSES 115

Query: 85  DTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVH 131
            TALH    Y H       +I + L++ GADP + +K+G   L ++H
Sbjct: 116 ATALHWAARYGH------VYIVDLLLKHGADPTLIDKQG---LNIIH 153

>YMR068W Chr13 (406304..407584) [1281 bp, 426 aa] {ON}
           AVO2Component of a complex containing the Tor2p kinase
           and other proteins, which may have a role in regulation
           of cell growth
          Length = 426

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHL-CVNYSHDEPEYGTFIAE 107
           GNT +HL    G    L +LL Q    +N +   +G   +H+ C+N      +Y   ++ 
Sbjct: 75  GNTCVHLALMKGHEQTLHLLLQQFPRFINHRGE-NGRAPIHIACMN------DYYQCLSL 127

Query: 108 NLIEVGADPRIRNKRGQTPLQL-VHSDELESLVNLLQGAEIAAD 150
            LI VGAD  + +  G TPL + +    +  +  LL   E++ D
Sbjct: 128 -LIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLD 170

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAEN 108
           G   IH+      +  L +L+   G D+   ++ +GDT LH+C+       EYG+     
Sbjct: 109 GRAPIHIACMNDYYQCLSLLIGV-GADLWVMDT-NGDTPLHVCL-------EYGSISCMK 159

Query: 109 LI----EVGADPRIRNKRGQTPLQLVHSDEL 135
           ++    EV  D  +R+K    P+ +  + E+
Sbjct: 160 MLLNEGEVSLDDNVRDKGNWKPIDVAQTFEV 190

>CAGL0H00935g Chr8 (91979..92560) [582 bp, 193 aa] {ON} highly
           similar to uniprot|P46683 Saccharomyces cerevisiae
           YPL239w YAR1 ankyrin repeat-containing protein
          Length = 193

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 22/127 (17%)

Query: 11  LLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLD 70
           +LDA R  + + L  +  TL   K     + +D+    G+TA+H+ +  G  +V+  +++
Sbjct: 17  ILDA-RAGDLESLQEIFTTLIHPKLLATCVSSDN----GSTALHMAAANGHLEVVKYIME 71

Query: 71  Q---------EGVDVNQQNSIDGDTALHLC-VNYSHDEPEYGTFIAENLIEVGADPRIRN 120
           Q          G  VN QN   G+TALH   +N   D  +Y         E  ADP ++N
Sbjct: 72  QVKQSADAGAVGRYVNLQNKT-GNTALHWATLNGKLDVVQYLC------DECDADPFVKN 124

Query: 121 KRGQTPL 127
           + G  P+
Sbjct: 125 EFGHDPI 131

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 43/103 (41%), Gaps = 9/103 (8%)

Query: 21  DLLNAVLETLDGDKQAIQS----LINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDV 76
           +L    LETL GD + + +    ++  S            SKYGS     ++  Q     
Sbjct: 721 ELAYKFLETLPGDNEEVNTEKERVVIASGKTFNKQQQPRASKYGS-----LMNSQVPETF 775

Query: 77  NQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIR 119
           N   S  G T LH  V+    +P YG  + +++  V + P ++
Sbjct: 776 NASPSFGGQTPLHKTVSNQTFQPSYGVPLPQSVSPVVSSPAVQ 818

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
           Ashbya gossypii ACR006C
          Length = 1079

 Score = 33.1 bits (74), Expect = 0.30,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 18/111 (16%)

Query: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG 102
           D +DP+GN+ +H+  K G    +  +L Q  ++VN+ N I G T L L   Y+       
Sbjct: 617 DHEDPMGNSLLHIM-KGG----IQSILSQPNINVNKSN-IKGMTPLMLYAKYNR------ 664

Query: 103 TFIAENLIEVGADPRIRNKRGQTPLQLVHSDELES--LVNLLQGAEIAADN 151
               EN+ ++  D R+   + Q P  L   D +++  ++NL+ G  IA ++
Sbjct: 665 ---IENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLI-GTHIAKNS 711

>Skud_13.224 Chr13 (380698..381966) [1269 bp, 422 aa] {ON} YMR068W
           (REAL)
          Length = 422

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHL-CVNYSHDEPEYGTFIAE 107
           GNT +HL    G    L +LL Q    +N +   +G   +H+ C+N      +Y   ++ 
Sbjct: 75  GNTCVHLALMRGHEQTLHLLLQQFPPFINHRGE-NGRAPIHIACMN------DYYQCLSL 127

Query: 108 NLIEVGADPRIRNKRGQTPLQL-VHSDELESLVNLLQGAEIAAD 150
            LI VGAD  + +  G TPL + +    +  +  L+   EI+ D
Sbjct: 128 -LIGVGADLWVMDTNGDTPLHVCLEYGSINCMKMLVNEGEISLD 170

>KAFR0A00170 Chr1 complement(27115..30279) [3165 bp, 1054 aa] {ON}
           Anc_2.662 YIR033W
          Length = 1054

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 46  DPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHL-CVNYSHDEPEYGTF 104
           D +G T +HL S  G +D+   L+ Q G  ++ ++S  G T LH  C+N S+        
Sbjct: 688 DSVGRTLLHLASLKGYYDLTSTLI-QSGARIDDKDSF-GFTPLHFACINGSYQ------- 738

Query: 105 IAENLIEVGADPRIRNKRGQTPLQLV 130
           +   L+   ++P +++    +P  L 
Sbjct: 739 VIRLLLNCQSNPNVKSSNHLSPKDLF 764

>CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112w
          Length = 1110

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 46/118 (38%), Gaps = 30/118 (25%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSH-------- 96
           +D  G T + +    G +DV   L+++E  DVN Q++  G++ALH      H        
Sbjct: 357 RDSGGRTRLQIACDKGKYDVAKRLIEEEDYDVNDQDNA-GNSALHEAALNGHLSIVKLLI 415

Query: 97  ------DEPEYGTF---------------IAENLIEVGADPRIRNKRGQTPLQLVHSD 133
                 +   Y  F               I   L+  GADP I N +G T  + +  D
Sbjct: 416 SHGANVNIQSYEMFKDTPLVDASANGHLDIVRYLLRHGADPTIPNAKGLTAYESIEED 473

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 8/70 (11%)

Query: 58  KYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPR 117
           K+G  D+  + L   G  +N+ N  +G T L + V  +H     GT     L+E GA+P 
Sbjct: 581 KFGHEDIASLFL-AFGAKINKFNK-EGMTPLMIAVGRNH----LGTVKL--LLEAGANPT 632

Query: 118 IRNKRGQTPL 127
           +++ +GQT +
Sbjct: 633 LKDNKGQTAI 642

>Smik_13.247 Chr13 (390443..391735) [1293 bp, 430 aa] {ON} YMR068W
           (REAL)
          Length = 430

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHL-CVNYSHDEPEYGTFIAE 107
           GNT +HL    G    L +LL Q    +N +   +G   +H+ C+N      +Y   ++ 
Sbjct: 75  GNTCVHLALMKGHEQTLHLLLQQFPRFINHRGE-NGRAPIHIACMN------DYYQCLSL 127

Query: 108 NLIEVGADPRIRNKRGQTPLQL-VHSDELESLVNLLQGAEIAAD 150
            LI VGAD  + +  G TPL + +    +  +  LL   E++ D
Sbjct: 128 -LIGVGADLWVVDANGDTPLHVCLEYGSISCMKMLLNEGEVSLD 170

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 43/98 (43%), Gaps = 21/98 (21%)

Query: 49  GNTAIHLCSKYGSWDVLDVLL----DQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF 104
           G   IH+      +  L +L+    D   VD N      GDT LH+C+       EYG+ 
Sbjct: 109 GRAPIHIACMNDYYQCLSLLIGVGADLWVVDAN------GDTPLHVCL-------EYGSI 155

Query: 105 IAENLI----EVGADPRIRNKRGQTPLQLVHSDELESL 138
               ++    EV  D  +R+K    P+++  + E+ ++
Sbjct: 156 SCMKMLLNEGEVSLDDNVRDKGNWKPIEVAQTFEVANI 193

>NDAI0B03700 Chr2 complement(925092..928517) [3426 bp, 1141 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1141

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 30/110 (27%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALH----------LCVNY 94
           +D  G T + +    G ++    L+++EG DVN Q++  G++ALH          + +  
Sbjct: 351 RDSGGRTKLAIACDKGKFETAKRLIEEEGYDVNDQDNA-GNSALHEAALNGHLDIVKLLV 409

Query: 95  SHDE----PEYGTF---------------IAENLIEVGADPRIRNKRGQT 125
            HD       Y  F               + E L+E GA+P + N +G+T
Sbjct: 410 EHDANVNIQSYEMFQDTPLFDASANGYLDVVEYLLEHGANPTLTNAKGRT 459

>NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {ON}
           Anc_3.175
          Length = 1208

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 6/60 (10%)

Query: 72  EGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVH 131
           E +D+N  +   GDT LH  V       +    +   L+E GADP  R+ +G+ P+ LV 
Sbjct: 193 ELLDINGMDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDSKGKLPIDLVR 246

>Kwal_14.982 s14 complement(141369..142619) [1251 bp, 416 aa] {ON}
           YMR068W - Hypothetical ORF [contig 244] FULL
          Length = 416

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSI 82
           +D  GNTA+H+C  YGS + + +L+ +E  D+  Q S+
Sbjct: 138 RDEFGNTALHICLIYGSENCMRMLVREE--DMEDQESL 173

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 8/74 (10%)

Query: 27  LETLDGDKQAIQSLIN------DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQN 80
           L  L+G +Q    L+       + K   G T + +  +Y  +  L +LL   G D++ ++
Sbjct: 81  LALLNGHEQTAHLLLQHFPYCLNIKGHYGRTPVQMTCQYDHYQCLSLLLGL-GADLSVRD 139

Query: 81  SIDGDTALHLCVNY 94
              G+TALH+C+ Y
Sbjct: 140 EF-GNTALHICLIY 152

>TBLA0A00780 Chr1 complement(168204..170384) [2181 bp, 726 aa] {ON}
           Anc_2.639 YMR068W
          Length = 726

 Score = 32.7 bits (73), Expect = 0.42,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 55/123 (44%), Gaps = 18/123 (14%)

Query: 27  LETLDGDKQAIQSLIN------DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQN 80
           L  ++G +Q    LI       + K   G T  H+   +  +  L +L+   G D++  N
Sbjct: 81  LALINGHEQTTHLLIQHFPQFINYKGDRGQTPTHIACMHDYYQCLSLLVGV-GADLSIVN 139

Query: 81  SIDGDTALHLCVNYSHDEPEYGTF-IAENLIEVG--ADPRIRNKRGQTPLQLVHSDELES 137
             +GDT LH+C+       EYG+    + LI+ G   D  IRN+    P  +  + EL  
Sbjct: 140 D-EGDTPLHVCL-------EYGSVNCMKMLIQEGNMTDDTIRNRNNWRPSDVAKTYELAR 191

Query: 138 LVN 140
           L N
Sbjct: 192 LYN 194

 Score = 28.5 bits (62), Expect = 9.1,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 46/110 (41%), Gaps = 30/110 (27%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQ-QNSIDGDTALHLC---------------- 91
           G +++H  S +G + V  VLL Q G D ++   +  G+T +HL                 
Sbjct: 40  GWSSLHYASFHGRYLVC-VLLIQLGHDKHEVMKTFKGNTCVHLALINGHEQTTHLLIQHF 98

Query: 92  ---VNYSHDEPEYGTFIA---------ENLIEVGADPRIRNKRGQTPLQL 129
              +NY  D  +  T IA           L+ VGAD  I N  G TPL +
Sbjct: 99  PQFINYKGDRGQTPTHIACMHDYYQCLSLLVGVGADLSIVNDEGDTPLHV 148

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML002W and
           YML003W; YML002W and YML003W represent one ORF in this
           genome
          Length = 1071

 Score = 32.7 bits (73), Expect = 0.42,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 17/105 (16%)

Query: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG 102
           D +DPLGNT +H+       D + + L   G +VN+ N+  G T L +   Y+       
Sbjct: 615 DHEDPLGNTLLHIIK-----DGIQLALSTPGANVNKCNT-RGMTPLMVYAKYNR------ 662

Query: 103 TFIAENLIEVGADPRIRNKRGQTPLQLVHSDELES--LVNLLQGA 145
               EN+ E+  D R+   + Q P  L   D +++  ++NL+  A
Sbjct: 663 ---IENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTA 704

>KNAG0M02510 Chr13 complement(465793..467028) [1236 bp, 411 aa] {ON}
           Anc_2.639 YMR068W
          Length = 411

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 49  GNTAIHLCSKYGSWDVLDVLL-DQEGVDVNQQNSID 83
           G T +H+C +YGS + L +LL ++  VDVN  N ++
Sbjct: 142 GETPLHICLEYGSTECLKLLLQERPKVDVNAVNFLE 177

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 30/110 (27%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQ-NSIDGDTALHLCVNYSHDEP------EY 101
           G +++H  S YG + ++ V L Q G D ++   +  G+T +HL +   H++        +
Sbjct: 40  GWSSLHYASFYGRY-LICVYLVQLGHDHHELIRTFKGNTCVHLALMNGHEQTTHLLLQHF 98

Query: 102 GTFI----------------------AENLIEVGADPRIRNKRGQTPLQL 129
             FI                      A  LI VGAD  +++ +G+TPL +
Sbjct: 99  PRFIDAKGENGSAPIHVACMHDYFRCASLLISVGADLSLQDGQGETPLHI 148

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 32.3 bits (72), Expect = 0.52,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 7/96 (7%)

Query: 34  KQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVN 93
           +  +  L +D  D    + +H  S      V+  L+ ++ VDVN Q      T LH    
Sbjct: 76  ENGVIDLKHDYDDVERVSGLHWASINNRLSVVRYLISKD-VDVNFQGGELNATPLHWAAR 134

Query: 94  YSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQL 129
           Y +       +I + L+E GADP + + +G   L L
Sbjct: 135 YGY------VYIVDYLLEHGADPSVTDAQGFNLLHL 164

>KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa]
           {ON} Anc_3.175 YAR042W
          Length = 1228

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 74  VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
           +D+N  +   GDT LH  V       +    +   L+E GADP  R+ +G+ PL L+
Sbjct: 211 LDINGMDPKTGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDAKGKLPLDLL 261

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 40  LIN-DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVD 75
           LIN + KD LGNT +H+ +     DV+  L+D  G++
Sbjct: 111 LININEKDNLGNTPLHMAAFQSRADVVSYLMDLPGIN 147

>KLTH0E13882g Chr5 (1222695..1226552) [3858 bp, 1285 aa] {ON}
           similar to Saccharomyces cerevisiae uniprot|Q02979
           YPL110C GDE1 Glycerophosphocholine (GroPCho)
           phosphodiesterase
          Length = 1285

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 7/76 (9%)

Query: 53  IHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEV 112
           +HL +K  S ++++VLL  +G DV+       +TAL+     +  E       A +L++ 
Sbjct: 500 LHLATKLNSPELIEVLLSIKGFDVDYTEPETHETALYTAAKLNLRES------AAHLLKS 553

Query: 113 GADPRIRN-KRGQTPL 127
           GA+  IR    G TP+
Sbjct: 554 GANTEIRECNFGWTPI 569

>ZYRO0A05258g Chr1 (424968..429614) [4647 bp, 1548 aa] {ON} some
           similarities with uniprot|Q12451 Saccharomyces
           cerevisiae YDL019C OSH2 Member of an oxysterol-binding
           protein family with seven members in S. cerevisiae
           family members have overlapping redundant functions in
           sterol metabolism and collectively perform a function
           essential for viability
          Length = 1548

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 72  EGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
           E +D+N  +   GDT LH  V       +    +   L+E GADP  R+++G+ P+ LV
Sbjct: 217 ELLDINGMDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFNRDRQGRLPVDLV 269

>KNAG0K01700 Chr11 (352052..356122) [4071 bp, 1356 aa] {ON} 
          Length = 1356

 Score = 32.0 bits (71), Expect = 0.71,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVN 93
           +++D  GNT +HL +      V++ LL+Q  +D    N  DG   + +C N
Sbjct: 95  NTRDEFGNTPLHLAAAQSRTKVIEFLLEQPDIDETVLND-DGRMPIDMCSN 144

>KAFR0A00280 Chr1 complement(53403..54566) [1164 bp, 387 aa] {ON}
           Anc_2.639 YMR068W
          Length = 387

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHL-CVNYSHDEPEYGTFIAE 107
           GNT +HL    G      +LL      +NQ+   +G T +H+ C+   HD   Y   ++ 
Sbjct: 76  GNTCVHLALMNGHEQTTHLLLQHFPSFINQRGE-NGKTPVHIACI---HD---YNQCLSL 128

Query: 108 NLIEVGADPRIRNKRGQTPLQLV 130
            L+ VGA+  + ++ G+TPL L 
Sbjct: 129 -LMGVGAELTLSDENGETPLHLC 150

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 49  GNTAIHLCSKYGSWDVLDVLL 69
           G T +HLC +YGS+  L +LL
Sbjct: 143 GETPLHLCLEYGSYHCLRMLL 163

>NDAI0F00830 Chr6 (198222..199769) [1548 bp, 515 aa] {ON} Anc_5.626
           YDR264C
          Length = 515

 Score = 32.0 bits (71), Expect = 0.77,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 11/69 (15%)

Query: 75  DVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTP----LQLV 130
           D+N Q+S  G+T LH       ++P    F    L++ GAD  IRN  GQ P    +Q  
Sbjct: 135 DINSQDS-RGNTVLHWSC--FQNDPLTVKF----LLKFGADANIRNNLGQLPVHFAIQRG 187

Query: 131 HSDELESLV 139
           +S+ L SL+
Sbjct: 188 NSEILNSLI 196

>Kpol_1039.26 s1039 (82489..86103) [3615 bp, 1204 aa] {ON}
           (82489..86103) [3615 nt, 1205 aa]
          Length = 1204

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 52/120 (43%), Gaps = 23/120 (19%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           KE+L  AS+  N   +   LE  +G +   +S +                K+G  D+  +
Sbjct: 572 KEKLFRASKDGNLTYVGLYLE--NGGRVDFKSFLE-------------AVKFGHEDITSI 616

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
            L   G  VN  +  DG TAL   V   H        I + L+E GADP+ ++K G++ +
Sbjct: 617 FL-AFGAQVNT-SLKDGTTALMAAVGRGH------INIVKLLLEAGADPKRKDKEGKSAI 668

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALH 89
           +D  G T + +    G +D +  L+++  +DVN Q++  G+++LH
Sbjct: 388 RDSGGRTKLQIACDKGKYDTVKKLIEEGEIDVNDQDNA-GNSSLH 431

>Smik_6.443 Chr6 complement(724235..724834) [600 bp, 199 aa] {ON}
           YPL239W (REAL)
          Length = 199

 Score = 31.2 bits (69), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 62/128 (48%), Gaps = 6/128 (4%)

Query: 14  ASRRNNADLLNAVLET--LDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQ 71
           A+   + + +  +LET  L+   + +++ IN++ +  GNTA+H  S  G  +V+ +L D+
Sbjct: 57  AAANGHIETVRYILETVALENSAKELKAFINEANET-GNTALHWASLNGKLEVVKLLCDE 115

Query: 72  EGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVH 131
              D   +N   G  A+    N   +E E   F+ +  +E   D   + + G+  +Q+  
Sbjct: 116 YEADPFIRNKF-GHDAIFEAENSGKEEVE-TYFLKKYDVEPEDDEDTQTE-GKAAVQVTK 172

Query: 132 SDELESLV 139
             E+E + 
Sbjct: 173 GTEIEQVT 180

>CAGL0F06655g Chr6 (654908..656134) [1227 bp, 408 aa] {ON} similar
           to uniprot|Q04749 Saccharomyces cerevisiae YMR068w
          Length = 408

 Score = 31.6 bits (70), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHL-CVNYSHDEPEYGTFIAE 107
           GNT +HL    G      +LL      +N+   + G T  H+ C+   HD  +  +    
Sbjct: 75  GNTCVHLALMNGHEQTTHLLLQHFPRFINKAGEL-GRTPTHIACI---HDYYQCLSL--- 127

Query: 108 NLIEVGADPRIRNKRGQTPLQLV----HSDELESLVNLLQ 143
            LI VGA+  +++ +G TPL L      ++ ++ LVN +Q
Sbjct: 128 -LIGVGANLMMKDDKGNTPLHLCLEFGSTNCMKMLVNEIQ 166

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQ 71
           KD  GNT +HLC ++GS + + +L+++
Sbjct: 138 KDDKGNTPLHLCLEFGSTNCMKMLVNE 164

>ADL244W Chr4 (273377..276646) [3270 bp, 1089 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL112W
          Length = 1089

 Score = 32.0 bits (71), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 53/139 (38%), Gaps = 31/139 (22%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           KE+L  AS+      + A LE  +G     +S +                K+G  D+  +
Sbjct: 525 KEKLFRASKEGRLAYVGAYLE--NGGHADFRSFME-------------SVKFGHEDIASL 569

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG---- 123
            L   G  VN     DG TAL   V   H          + L+E GADP  R+K G    
Sbjct: 570 FL-AFGAQVNAVGR-DGQTALMAAVGRGH------LNTVKLLLEAGADPTKRDKDGHSVL 621

Query: 124 ----QTPLQLVHSDELESL 138
                +PL LV   EL  L
Sbjct: 622 YYARHSPLGLVDDKELTKL 640

>Suva_7.525 Chr7 complement(909154..912621) [3468 bp, 1155 aa] {ON}
           YGR233C (REAL)
          Length = 1155

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 51/121 (42%), Gaps = 13/121 (10%)

Query: 14  ASRRNNADLLNAVLET-----LDGDKQAIQSLIND--SKDPLGNTAIHLCSKYGSWDVLD 66
           A + NN D    +LE       D +KQ+ Q L      K+  G   +H+ +K G    L 
Sbjct: 491 ACKFNNHDAAKLLLEIRSKQNADHNKQSSQHLCQPLFKKNSTGLCTLHIVAKIGGDAQLI 550

Query: 67  VLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTP 126
            LL Q G D N+ +  +  T +   V   H E      +   L++ GA   I +  G +P
Sbjct: 551 QLLIQYGADPNEIDGFNKWTPIFYAVRSGHSE------VIGELLKNGARLDIEDDNGHSP 604

Query: 127 L 127
           L
Sbjct: 605 L 605

>TBLA0G02500 Chr7 complement(648451..652230) [3780 bp, 1259 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1259

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 8/82 (9%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVN-QQNSIDGDTALHLCVNYSHDEPEYGT 103
           +D  GNTA+H  +  G  D++ +L++  G D+N Q   +  DT L    +  H +     
Sbjct: 541 QDNAGNTALHEAALNGYLDIVKLLIEY-GADINLQSYELFKDTPLIDASSNGHLD----- 594

Query: 104 FIAENLIEVGADPRIRNKRGQT 125
            + + L+  GADP I N +G T
Sbjct: 595 -VVKFLLNSGADPLIANAKGIT 615

>KAFR0J01540 Chr10 complement(277907..281113) [3207 bp, 1068 aa]
           {ON} Anc_2.257 YIL112W
          Length = 1068

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 58/141 (41%), Gaps = 27/141 (19%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           +E+LL AS+  N   +   LE  +G K   ++ +                K+G  DV  +
Sbjct: 513 REKLLAASKEGNLSYVGQYLE--NGGKADFKAFME-------------AVKFGHEDVTSI 557

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
            L   G  VN  N  D  T L   V   H     GT   + LIE GA+P  R+K G   L
Sbjct: 558 FL-AFGAPVNNHNR-DNVTPLLQSVGRDH----LGT--VKLLIEAGANPLARDKSGHDAL 609

Query: 128 QLVHSDELESLVNLLQGAEIA 148
               +    SL+ L+   EIA
Sbjct: 610 YYAQN----SLLGLVDEREIA 626

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALH 89
           K+  G+T +H     G +D++  +L+ + +D++ +++  G+T LH
Sbjct: 332 KNAFGSTKLHTACNKGKYDIVKQILEDDEIDIHDRDNA-GNTPLH 375

>Kwal_33.13259 s33 (143081..145075) [1995 bp, 664 aa] {ON} YLR182W
           (SWI6) - transcription factor [contig 119] FULL
          Length = 664

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 82  IDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
           I+GDT L++     +        I E L++ GADPRI N  G  P+
Sbjct: 356 INGDTCLNIASRLGN------VSIVEALLDYGADPRISNNSGLRPM 395

>Kwal_27.9752 s27 complement(49387..52977) [3591 bp, 1196 aa] {ON}
           YDL019C (OSH2) - Oxysterol Binding Protein [contig 43]
           FULL
          Length = 1196

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 72  EGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
           E +D+N  +   GDT LH  V       +    +   ++E G DP  R++RG+ P+ L+
Sbjct: 175 ELLDINGNDPQTGDTVLHEFVK------KRDVVMCRWILEHGGDPFKRDRRGKLPVDLL 227

>NDAI0A06430 Chr1 (1461045..1464983) [3939 bp, 1312 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1312

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 64  VLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG 123
           +L+   + + +D+N  +   GD+ LH  V   + E      +   L++ GADP  +N  G
Sbjct: 188 ILNTPRNVDVLDINYFDQKSGDSLLHTFVRKRNIE------MCSWLLKHGADPHRKNFDG 241

Query: 124 QTPLQLV 130
           +TPL L+
Sbjct: 242 KTPLDLL 248

>NCAS0B08660 Chr2 (1665156..1667411) [2256 bp, 751 aa] {ON} Anc_1.60
          Length = 751

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 69  LDQEGVDVNQQNS--IDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTP 126
           LD + +  N  N+  ++GDT L++     +        I + L+E GADP I NK G  P
Sbjct: 393 LDLKWILTNMLNAQDVNGDTCLNIAARLGN------VGIVDALLEYGADPYIANKSGLRP 446

Query: 127 LQL 129
           L  
Sbjct: 447 LDF 449

>KLTH0H03014g Chr8 (271566..272159) [594 bp, 197 aa] {ON} similar to
           uniprot|P46683 Saccharomyces cerevisiae YPL239W YAR1
          Length = 197

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 27  LETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDT 86
           L +L  D   ++  +N S++  GNTA+H  S  GS + +  L ++ G D   +N+ D D 
Sbjct: 69  LASLVTDGAELKKWVN-SQNETGNTALHWASLNGSLECVKFLCEELGADPFIRNNFDHDA 127

Query: 87  AL 88
             
Sbjct: 128 IF 129

>TPHA0F01220 Chr6 complement(275858..279094) [3237 bp, 1078 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1078

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 30/119 (25%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALH------------LCV 92
           +D  G + + +    G ++++  LL++  +DVN Q++  G+++LH            L V
Sbjct: 324 RDAGGRSKLQIACDKGKFEIVKRLLEEGEIDVNDQDNA-GNSSLHEAALNGYIDCVKLLV 382

Query: 93  NYSHDEP--EYGTF---------------IAENLIEVGADPRIRNKRGQTPLQLVHSDE 134
            Y  +     Y  F               + + L+E GADP + N +G    Q +  +E
Sbjct: 383 KYGANVNLISYEMFRDTPLIDAAANGHLDVVKFLLEKGADPTVVNAKGLNAYQSIEEEE 441

>NDAI0G03020 Chr7 complement(699746..704233) [4488 bp, 1495 aa] {ON}
           Anc_3.175
          Length = 1495

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 74  VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLV 130
           +D+N  +   GDT LH  V       +    +   L+E GADP  R+ +G+ P+ L+
Sbjct: 360 LDINGMDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDVKGKLPINLI 410

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYS 95
           KD  GNT +H+         +++LL+QE +DVN+ N   G T L + V Y+
Sbjct: 627 KDTKGNTLLHVMKTN-----IEILLEQENIDVNEVNK-KGLTPLMVYVKYN 671

>Suva_13.243 Chr13 (387561..388661,388691..388840) [1251 bp, 416 aa]
           {ON} YMR068W (REAL)
          Length = 416

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 49  GNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAEN 108
           GNT +HL    G    L +LL Q    +N +   +G   +H+    ++ +          
Sbjct: 75  GNTCVHLALMKGHEQTLHLLLQQFPQFINHRGE-NGRAPIHIACMKNYYQ------CLSL 127

Query: 109 LIEVGADPRIRNKRGQTPLQL-VHSDELESLVNLLQGAEIAADNKGK 154
           LI VGAD  + +  G TPL + +    L  +  L+   E++ D+  K
Sbjct: 128 LIGVGADLWVMDTNGDTPLHVCLEYGSLNCMKMLVNEGEVSLDDNVK 174

>SAKL0C07678g Chr3 complement(710170..714099) [3930 bp, 1309 aa]
           {ON} some similarities with uniprot|Q12451 Saccharomyces
           cerevisiae YDL019C OSH2 Member of an oxysterol-binding
           protein family with seven members in S. cerevisiae
           family members have overlapping redundant functions in
           sterol metabolism and collectively perform a function
           essential for viability
          Length = 1309

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 64  VLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG 123
           +L    + E +D+N  +   GDT LH  V       +    +   +++ G DP  R+KRG
Sbjct: 174 ILSSARNSELLDINGTDPETGDTVLHEFVK------KKDVTMCRWILDHGGDPFKRDKRG 227

Query: 124 QTPLQLV 130
           + P+ L+
Sbjct: 228 KLPVDLL 234

>KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} similar
           to uniprot|P09959 Saccharomyces cerevisiae YLR182W SWI6
           Transcription cofactor forms complexes with DNA-binding
           proteins Swi4p and Mbp1p to regulate transcription at
           the G1/S transition involved in meiotic gene expression
           localization regulated by phosphorylation potential
           Cdc28p substrate
          Length = 663

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 82  IDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
           I+GDT L++     +        I E L++ GADPRI N  G  P+
Sbjct: 355 INGDTCLNIASRLGN------VSIVEALLDYGADPRISNNSGLRPV 394

>Kpol_1002.18 s1002 (48873..49493) [621 bp, 206 aa] {ON}
           (48873..49493) [621 nt, 207 aa]
          Length = 206

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 31  DGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDT 86
           +GD++ ++  +N + +  GNTA+H  +  G  DV+ +L D+   D   +N    D+
Sbjct: 76  NGDEEKLKEFVNATNET-GNTALHWAALNGKLDVVQLLCDEYDADPFIRNQFGHDS 130

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
           aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 45  KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYS 95
           KD  GNT +H+         +++LL+QE +DVN+ N   G T L + V Y+
Sbjct: 627 KDTKGNTLLHVMKTN-----IEILLEQENIDVNEVNK-KGLTPLMVYVKYN 671

>Skud_16.40 Chr16 (72992..73591) [600 bp, 199 aa] {ON} YPL239W
           (REAL)
          Length = 199

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 21  DLLNAVLETLDGDK--QAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQ 78
           + +  +LET+  +   + +++ IN++ +  GNTA+H  S  G  DV+ +L D+   D   
Sbjct: 64  ETVKYILETVSRENSVEELKAFINEANET-GNTALHWSSLNGKLDVVKLLCDEYEADPFI 122

Query: 79  QNSIDGDTAL 88
           +N    D   
Sbjct: 123 RNKFGHDAIF 132

>KLLA0C04147g Chr3 complement(377185..380907) [3723 bp, 1240 aa]
           {ON} similar to uniprot|Q12451 Saccharomyces cerevisiae
           YDL019C OSH2 Member of an oxysterol-binding protein
           family with seven members in S. cerevisiae family
           members have overlapping redundant functions in sterol
           metabolism and collectively perform a function essential
           for viability,
          Length = 1240

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 70  DQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQL 129
           +QE +D+N      GDT LH  V       +    +   +++ G DP  R+ RG+ P+ L
Sbjct: 184 NQELLDINGMEPETGDTVLHEFVK------KRDILLCRWILDHGGDPFKRDSRGKLPIDL 237

Query: 130 V 130
           +
Sbjct: 238 L 238

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 30.4 bits (67), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
            L + G +VNQ    +  TALH    Y H       +I + L++ GA+P + + +G   L
Sbjct: 85  FLIRRGANVNQTAGPERATALHWAARYGH------VYIVDLLLKHGANPTLIDGQG---L 135

Query: 128 QLVH 131
            ++H
Sbjct: 136 NILH 139

>AFR600C Chr6 complement(1517783..1520230) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL056W
           (MBP1)
          Length = 815

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 105 IAENLIEVGADPRIRNKRGQTPL---QLVHSDELE----SLVNLLQGAEIAADNKGK 154
           I E L++ GA PR  N+ G+TPL    LVH+   +     +  LLQ      D++ +
Sbjct: 379 IVEALLQAGASPRALNQAGETPLMRASLVHNSYTKRTYPRIFQLLQDTVFDVDSRSQ 435

>NCAS0C01820 Chr3 complement(336290..339691) [3402 bp, 1133 aa] {ON}
           Anc_8.599
          Length = 1133

 Score = 30.4 bits (67), Expect = 2.8,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 7/83 (8%)

Query: 61  SWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPR-IR 119
           S  +L ++++    +V++     G+TALH+   Y+  E      I   L+  GA+   + 
Sbjct: 462 SESLLKIIMNDTAFEVDRPERRSGETALHIACKYNSPE------IVACLLAHGANSEVVE 515

Query: 120 NKRGQTPLQLVHSDELESLVNLL 142
           NK G TPL +  +     ++ +L
Sbjct: 516 NKLGWTPLFIAAAKGYNEVLQIL 538

>AER225W Chr5 (1051497..1055396) [3900 bp, 1299 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL019C (OSH2) and
           YAR042W (SWH1)
          Length = 1299

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 64  VLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG 123
           +L    + E +D+N  +   GDT LH  V       +    +   +I+ G DP  R+KRG
Sbjct: 185 ILSNARNAELLDINGTDPETGDTVLHEFVK------KRDIVMCRWIIDHGGDPFKRDKRG 238

Query: 124 QTPL 127
           + P+
Sbjct: 239 KLPI 242

>YPL239W Chr16 (99484..100086) [603 bp, 200 aa] {ON}
           YAR1Cytoplasmic ankyrin-repeat containing protein of
           unknown function, proposed to link the processes of 40S
           ribosomal subunit biogenesis and adaptation to osmotic
           and oxidative stress; expression repressed by heat shock
          Length = 200

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 5/128 (3%)

Query: 14  ASRRNNADLLNAVLETLDGDKQA--IQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQ 71
           A+   + + +  +LET+     A  +++ +N+  +  GNTA+H  S  G  DV+ +L D+
Sbjct: 57  AAANGHIETVRYILETVSRANSAEDLKAFVNEV-NKTGNTALHWASLNGKLDVVKLLCDE 115

Query: 72  EGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVH 131
              D   +N   G  A+    N   +E E   F+ +  +E   D       G+  +Q+  
Sbjct: 116 YEADPFIRNKF-GHDAIFEAENSGKEEVE-TYFLKKYDVEPEDDEEDTQTEGKNSVQITK 173

Query: 132 SDELESLV 139
             E+E + 
Sbjct: 174 GTEIEQVT 181

>KAFR0G03170 Chr7 complement(658032..660374) [2343 bp, 780 aa] {ON}
           Anc_4.232 YDL056W
          Length = 780

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 76  VNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDEL 135
           +N Q+S +GDTALH+    + D+  + T     LI+ GA   I NK  QTP ++++  + 
Sbjct: 488 LNSQDS-NGDTALHIAAK-NGDKSFFNT-----LIKNGALSTIPNKENQTPDEIMNKQQQ 540

Query: 136 ESLVNLLQG 144
           + L+ LL+G
Sbjct: 541 KHLL-LLEG 548

>TPHA0P00580 Chr16 (117136..120909) [3774 bp, 1257 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1257

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 6/63 (9%)

Query: 70  DQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQL 129
           ++E +++N  +   G+  LHL + +  D P     I + L++ GADP I+N+ G+T  ++
Sbjct: 186 NKELININDVDPTTGENILHLHILHG-DIP-----IVKWLLDHGADPFIKNQEGKTAHEV 239

Query: 130 VHS 132
           + +
Sbjct: 240 LQT 242

>TPHA0H01910 Chr8 complement(448970..449575) [606 bp, 201 aa] {ON}
           Anc_6.265 YPL239W
          Length = 201

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTAL 88
           D K+  GNTA+H  S  G  +V+ +L D+   D   +N  D D   
Sbjct: 87  DEKNENGNTALHWASLNGHLEVVKLLCDEYDADPFIKNKFDHDAIF 132

>TBLA0B04300 Chr2 complement(994891..998943) [4053 bp, 1350 aa] {ON}
           Anc_8.599 YPL110C
          Length = 1350

 Score = 29.6 bits (65), Expect = 4.5,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 57  SKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADP 116
           ++ G +++L++LL    +DVN  +    +T+L+L    +H        +A+ L+E  A+ 
Sbjct: 623 TRLGKYELLEILLKCNNLDVNITDKETNETSLYLACKLNHQN------MAQTLLEYKANT 676

Query: 117 RIRNKR-GQTPLQLVHSDELESLVNLL 142
            +  K    TP+ +   +    +V LL
Sbjct: 677 ELFEKTFNWTPIFIASVEGYSDIVQLL 703

>TBLA0G00840 Chr7 (200837..205522) [4686 bp, 1561 aa] {ON} Anc_3.175
           YAR042W
          Length = 1561

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 64  VLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG 123
           + D   ++E +D+N  +   GDT LH  +       +    + + LIE G+DP  R++ G
Sbjct: 227 IFDNPRNKELLDINGIDPETGDTVLHEFIK------KRDVHMCKWLIEHGSDPFKRDRSG 280

Query: 124 QTPLQLV 130
           + P  L+
Sbjct: 281 KLPSDLL 287

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 29.3 bits (64), Expect = 5.2,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 12/100 (12%)

Query: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG 102
           DS++ +  + +H  S     +++  L+ Q G DVN +      T LH      +      
Sbjct: 96  DSREKV--SGLHWASVNNRLNIVKYLISQ-GADVNMKGGDLEATPLHWASKSGY------ 146

Query: 103 TFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLL 142
            +I   L+E  ADP I +K+G     L+H+    S + L+
Sbjct: 147 VYIVHCLLENNADPTIYDKQG---YNLLHTATFSSNIMLI 183

>Ecym_5249 Chr5 complement(514146..518282) [4137 bp, 1378 aa] {ON}
           similar to Ashbya gossypii AER225W
          Length = 1378

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 70  DQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
           + E +D+N  +   GDT LH  V       +    +   +++ G DP  R+KRG+ P+
Sbjct: 194 NSELLDINGNDPETGDTVLHEFVK------KRDVMMCRWILDHGGDPFKRDKRGRLPV 245

>NCAS0H03300 Chr8 (633593..634714) [1122 bp, 373 aa] {ON} Anc_2.639
           YMR068W
          Length = 373

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 3/74 (4%)

Query: 22  LLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNS 81
           LLN   +T     Q     IND K   G + +H+   +     L++L+   G D+N  + 
Sbjct: 81  LLNGHEQTTHLLLQYFPQFIND-KGERGKSPLHIACMFDYDRCLNLLIGL-GADINVIDD 138

Query: 82  IDGDTALHLCVNYS 95
            +GD  +HLC+ YS
Sbjct: 139 -NGDGVMHLCLQYS 151

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 29.3 bits (64), Expect = 6.3,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 72  EGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQL 129
           +G DVN +      T LH    Y +       +I + L+E GADP + + +G   L L
Sbjct: 115 KGADVNFKGGNLKATPLHWAARYGY------VYIVDFLLESGADPTLTDHQGFNLLHL 166

>CAGL0M04477g Chr13 (491638..493329) [1692 bp, 563 aa] {ON} some
           similarities with uniprot|Q02983 Saccharomyces
           cerevisiae YLR141w RRN5
          Length = 563

 Score = 29.3 bits (64), Expect = 6.4,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 107 ENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLLQ 143
           E++IE+ A PR ++ R   P ++   D L++++ L Q
Sbjct: 306 EDIIEIQAHPRKKHHRDYYPHEITREDVLQAVITLKQ 342

>Suva_4.229 Chr4 complement(408561..412439) [3879 bp, 1292 aa] {ON}
           YDL019C (REAL)
          Length = 1292

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 80  NSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDEL 135
           N ID +T   L   YS ++      + + L+E GA+  I++ +G++PL LV + +L
Sbjct: 200 NGIDPETGKTLLYEYSKNK---DIEMCQWLLEHGAEATIKDAKGRSPLDLVKNVKL 252

>KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {ON}
           Anc_4.33 YHL024W
          Length = 743

 Score = 28.9 bits (63), Expect = 7.0,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 15  SRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNT 51
           +R N  +  N  + TLDG  +A  S ++DS D +GN+
Sbjct: 583 TRNNIGNHTNQGMNTLDGATEATTSTLSDSPDRIGNS 619

>Kpol_1037.5 s1037 complement(8144..11782) [3639 bp, 1212 aa] {ON}
           complement(8144..11782) [3639 nt, 1213 aa]
          Length = 1212

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 63  DVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKR 122
           ++L+   + E +D+N  +   GDT LH  V       +    +   L+E GADP  R+  
Sbjct: 193 NILNNPRNAELLDINGTDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDSN 246

Query: 123 GQTPLQLV 130
           G  P++++
Sbjct: 247 GVLPVEIL 254

>KLTH0G09724g Chr7 (818249..821470) [3222 bp, 1073 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112W HOS4
           Subunit of the Set3 complex which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity potential Cdc28p substrate
          Length = 1073

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 61/144 (42%), Gaps = 31/144 (21%)

Query: 8   KEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDV 67
           +E+LL ASR      + A LE  +G +   +S                  + G  D+  +
Sbjct: 523 REKLLRASREGKLSYVGAYLE--NGGRVDFKSFTE-------------AVRSGHEDITSL 567

Query: 68  LLDQEGVDVNQQNSI--DGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQT 125
            L        Q N +  DG T L + +   H     GT  A+ L+E GA+P  ++K+G++
Sbjct: 568 FL----AFGAQPNLVLRDGQTPLMMSLGRGH----IGT--AKLLLEAGANPLAKDKKGKS 617

Query: 126 PLQLVHSDEL----ESLVNLLQGA 145
            L    + EL    E  V L++ A
Sbjct: 618 VLSYAKNSELGLVSEDEVQLIENA 641

>CAGL0J07040g Chr10 (677513..681250) [3738 bp, 1245 aa] {ON} similar
           to uniprot|Q02979 Saccharomyces cerevisiae YPL110c
          Length = 1245

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 23/107 (21%)

Query: 51  TAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLI 110
           T + L  +   +D+++ +L    +D+N Q+    +TAL+  V             A NL 
Sbjct: 520 TLLFLAIQTNEFDLINTILSSSRIDINFQDEQTKETALYQAV-------------AANLF 566

Query: 111 EV-------GADPRIRNK-RGQTPLQLVHSDELESLVNLL--QGAEI 147
           E        GA   I+ K  G TPL +  ++    +V LL   GA I
Sbjct: 567 EATACLLINGASTEIKEKLFGWTPLFIGAAEGYSDIVRLLVNNGANI 613

>CAGL0K01749g Chr11 complement(155385..159134) [3750 bp, 1249 aa]
           {ON} similar to uniprot|Q12451 Saccharomyces cerevisiae
           YDL019c
          Length = 1249

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 64  VLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRG 123
           +  +  ++E +D+N  +   GDT LH  V     +      + + L++ GADP  RN + 
Sbjct: 190 IWKIQRNEELLDINGLDPTSGDTVLHEFVKKKDVQ------MCKWLVDHGADPLRRNAKA 243

Query: 124 QTPLQLV 130
             P+ L+
Sbjct: 244 LLPIDLL 250

>KAFR0C00940 Chr3 (189934..193296) [3363 bp, 1120 aa] {ON} Anc_3.175
           YAR042W
          Length = 1120

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 11/66 (16%)

Query: 68  LLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPL 127
           LLD  G+D        GDT LH  V       +    +   L+E G+DP  R+ +G+ P+
Sbjct: 183 LLDINGIDPKS-----GDTVLHEFVK------KRDVIMCNWLLEHGSDPFKRDAKGRLPV 231

Query: 128 QLVHSD 133
            ++ ++
Sbjct: 232 DIIKNN 237

>Kwal_33.14017 s33 (485065..493098) [8034 bp, 2677 aa] {ON} YKR054C
           (DYN1) - heavy chain of cytoplasmic dynein [contig 106]
           FULL
          Length = 2677

 Score = 28.9 bits (63), Expect = 7.6,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 29/44 (65%)

Query: 10  QLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAI 53
           + LD ++ N+A+LLN++  T++    ++QSLI++ K     TA+
Sbjct: 208 EFLDGAQLNDAELLNSLHGTVNHWVYSVQSLIDNPKRVEDGTAL 251

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 28.9 bits (63), Expect = 8.4,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 42  NDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSH 96
           N +  P G TA+H  ++YG+  ++D+LL + G D   ++   G   +H  V  S+
Sbjct: 111 NQAAGPGGATALHWAARYGNIYIVDLLL-KHGADPTLKDE-QGLNIMHFSVYSSN 163

>TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {ON}
           Anc_6.265 YPL239W
          Length = 200

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 56/126 (44%), Gaps = 26/126 (20%)

Query: 11  LLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSWDVLDVLL- 69
           +LDA R  + + L  +  TL   K     LI  S+    +TA+H+    G  DV+  LL 
Sbjct: 17  ILDA-RAGDLESLKEIFTTLIHPKL----LITCSESETKSTALHMACANGHTDVVKYLLT 71

Query: 70  -------DQEGVD-VNQQNSIDGDTALHLC-VNYSHDEPEYGTFIAENLI--EVGADPRI 118
                   +E  D VN+QN   G+TALH   +N        G      L+  E  A+P I
Sbjct: 72  LVKENATSEELKDYVNKQNET-GNTALHWASLN--------GKLDVVKLMCGEYEANPFI 122

Query: 119 RNKRGQ 124
           RNK  Q
Sbjct: 123 RNKFDQ 128

>TBLA0I00580 Chr9 complement(102907..104451) [1545 bp, 514 aa] {ON}
           Anc_3.6 YOL144W
          Length = 514

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 23/34 (67%)

Query: 1   MTEGASLKEQLLDASRRNNADLLNAVLETLDGDK 34
           + EG +++E++L   ++ N D+LN VL+  + DK
Sbjct: 238 IEEGDNIEEEVLKVEKQKNTDVLNQVLQGFNFDK 271

>Kwal_27.12751 s27 complement(1361084..1364365) [3282 bp, 1093 aa]
           {ON} YGR233C (PHO81) - Pho85 kinase inhibitor [contig
           260] FULL
          Length = 1093

 Score = 28.9 bits (63), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 6/109 (5%)

Query: 41  INDSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPE 100
           ++  +D  G   +H+ +K G    +  LL + G D N  +  +G T +   V   H    
Sbjct: 500 LSSVRDSHGLCPLHIVAKNGGDAKMIELLIKHGADPNGVDGFNGWTPVFYAVQEGHRN-- 557

Query: 101 YGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLLQGAEIAA 149
                 E L++ GA   I ++   +P      +   S+VNLL G E+ A
Sbjct: 558 ----TVEELLKNGARLDITDEDNLSPYFYAPWEGHLSVVNLLHGHELQA 602

>Skud_4.230 Chr4 complement(410772..414656) [3885 bp, 1294 aa] {ON}
           YDL019C (REAL)
          Length = 1294

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 80  NSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNKRGQTPLQLVHSDEL 135
           N ID +T + L   YS  +      + + L++ GA+  +++ +G++PL LV   +L
Sbjct: 200 NGIDPETGMTLLYEYSQKK---DIEMCQWLLKHGAEATVKDGKGRSPLDLVKDTKL 252

>NCAS0E02550 Chr5 (506706..511037) [4332 bp, 1443 aa] {ON} Anc_7.401
            YBL079W
          Length = 1443

 Score = 28.5 bits (62), Expect = 9.8,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 3    EGASLKEQLLDASR---RNNADLLNAVLETLDGDKQAIQSLINDSKDPLG 49
            E A++++ +L   R   R   ++ + +++ L+G+  A+ SL ND  DPLG
Sbjct: 1215 EVAAVQDDILSLVRSDARIEQNIKDELVKQLNGEILALSSLFNDFADPLG 1264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,855,948
Number of extensions: 772105
Number of successful extensions: 2102
Number of sequences better than 10.0: 211
Number of HSP's gapped: 2020
Number of HSP's successfully gapped: 252
Length of query: 171
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 69
Effective length of database: 41,785,467
Effective search space: 2883197223
Effective search space used: 2883197223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)