Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00660g5.699ON52452426320.0
SAKL0E14850g5.699ON4705046407e-77
KLTH0E01122g5.699ON4724904969e-56
Kwal_55.197165.699ON4674964906e-55
Ecym_40215.699ON4594934196e-45
AFR283W5.699ON4524924072e-43
ZYRO0G06666g5.699ON5035213189e-31
TDEL0B022205.699ON4894853063e-29
Smik_9.235.699ON5274172985e-28
Skud_9.225.699ON5374372843e-26
YIL146C (ATG32)5.699ON5294102736e-25
Suva_9.435.699ON5134282585e-23
CAGL0H06545g5.699ON4922071831e-13
NCAS0G002605.699ON5101441545e-10
TBLA0E020905.699ON7491621483e-09
KNAG0L021005.699ON4444001223e-06
KAFR0D022505.699ON5561401197e-06
Skud_4.518.458ON76495742.0
YPL248C (GAL4)6.279ON88190732.6
Suva_7.6na 1ON37260714.1
CAGL0C01199g8.423ON92266714.5
Skud_8.204.33ON69646689.7
Skud_10.1161.268ON105885689.8
NOTE: 2 genes in the same pillar as KLLA0A00660g were not hit in these BLAST results
LIST: Kpol_2001.73 TPHA0D04580

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00660g
         (524 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...  1018   0.0  
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   251   7e-77
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   195   9e-56
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   193   6e-55
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   166   6e-45
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   161   2e-43
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   127   9e-31
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   122   3e-29
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   119   5e-28
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   114   3e-26
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   109   6e-25
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   103   5e-23
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...    75   1e-13
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    64   5e-10
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    62   3e-09
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....    52   3e-06
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    50   7e-06
Skud_4.51 Chr4 (87402..89696) [2295 bp, 764 aa] {ON} YDL206W (REAL)    33   2.0  
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    33   2.6  
Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)     32   4.1  
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    32   4.5  
Skud_8.20 Chr8 (44743..46833) [2091 bp, 696 aa] {ON} YHL024W (REAL)    31   9.7  
Skud_10.116 Chr10 (210166..213342) [3177 bp, 1058 aa] {ON} YJL09...    31   9.8  

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/524 (94%), Positives = 495/524 (94%)

Query: 1   MSGSKGVWGAPPGNNNRQLYSLDXXXXXXXXXXXXXQRHSILDPHDSVMDLLNGQQSCAF 60
           MSGSKGVWGAPPGNNNRQLYSLD             QRHSILDPHDSVMDLLNGQQSCAF
Sbjct: 1   MSGSKGVWGAPPGNNNRQLYSLDAGSSGSGVSASSAQRHSILDPHDSVMDLLNGQQSCAF 60

Query: 61  DSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSWQAIDRDEYSFLNAGNHNNYHNT 120
           DSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSWQAIDRDEYSFLNAGNHNNYHNT
Sbjct: 61  DSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSWQAIDRDEYSFLNAGNHNNYHNT 120

Query: 121 SNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHNQFLAYPLSSTGFGDQGNSETT 180
           SNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHNQFLAYPLSSTGFGDQGNSETT
Sbjct: 121 SNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHNQFLAYPLSSTGFGDQGNSETT 180

Query: 181 VHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVNLGHSWAGSFFVMPKLSLSESMKRF 240
           VHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVNLGHSWAGSFFVMPKLSLSESMKRF
Sbjct: 181 VHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVNLGHSWAGSFFVMPKLSLSESMKRF 240

Query: 241 KILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILN 300
           KILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILN
Sbjct: 241 KILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILN 300

Query: 301 RMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHS 360
           RMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHS
Sbjct: 301 RMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHS 360

Query: 361 LYVEVDSDYETDIXXXXXXXXXXXXXXXXHLAKRWWFWPISIALGVGIGCCVTFYFSKFE 420
           LYVEVDSDYETDI                HLAKRWWFWPISIALGVGIGCCVTFYFSKFE
Sbjct: 361 LYVEVDSDYETDIPKKTKPRKGAKKKPAPHLAKRWWFWPISIALGVGIGCCVTFYFSKFE 420

Query: 421 TSSYNSSVGVIQTADKEIDAIVDAIEGNSPSILEESSPQSISDFLGQVCKLVKDTAIQIN 480
           TSSYNSSVGVIQTADKEIDAIVDAIEGNSPSILEESSPQSISDFLGQVCKLVKDTAIQIN
Sbjct: 421 TSSYNSSVGVIQTADKEIDAIVDAIEGNSPSILEESSPQSISDFLGQVCKLVKDTAIQIN 480

Query: 481 ELLKQFLSAHLMTSAWIQSIGKEFMQPDSQSTISKVTALDLVMF 524
           ELLKQFLSAHLMTSAWIQSIGKEFMQPDSQSTISKVTALDLVMF
Sbjct: 481 ELLKQFLSAHLMTSAWIQSIGKEFMQPDSQSTISKVTALDLVMF 524

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  251 bits (640), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 171/504 (33%), Positives = 257/504 (50%), Gaps = 76/504 (15%)

Query: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKS---NNIDHNDINTHTHSKG 93
           Q+ SILDPH SV+ LL  +  C  +  + Q    I  + KS     +  +       ++ 
Sbjct: 27  QKRSILDPHFSVLQLLE-RNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQS 85

Query: 94  LTDSWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLS 153
           ++DSWQ+I   +YS LN+      H+TS+   +Q  G + SSDTSEEE++   +PSP   
Sbjct: 86  ISDSWQSIKMVDYSILNS-----LHDTSS---SQAVGILSSSDTSEEELDHLNSPSP--- 134

Query: 154 ASQQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVK-STKTGQFSKAELGAGTG---- 208
           +SQQ                          F +G P+   T+ G  + +      G    
Sbjct: 135 SSQQ-------------------------VFPNGPPISFQTQAGVLTASATLPNPGVLEE 169

Query: 209 -EDETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFD 267
            ++ET+ V+L  S   + FVMP+LSLS+   RF+IL++  G  A  F+N + + ++ MFD
Sbjct: 170 DDNETVTVSLAAS--SNSFVMPQLSLSQRSHRFEILVV--GKPARKFWNNVPKMYQKMFD 225

Query: 268 VGKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKV 327
           +G     S  +   YTA MIIF D+K+V+ IL+ +  K     +IPICQ+GQKQ +   +
Sbjct: 226 IGDFESISAPKVSHYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLL 285

Query: 328 KTFANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETD-IXXXXXXXXXXXXX 386
           + F  + KI+LM  P V+S+H EIH LLR+LH L  E+DS YETD               
Sbjct: 286 EPFVKAKKIRLMFQPTVMSNHQEIHKLLRYLHRLSTEIDSGYETDETHLKVRKRKKTHKK 345

Query: 387 XXXHLAKRWWFWPISIALGVGIGCCVTFYFS------KFETSSYNSSVGVIQTADKEIDA 440
                + RW  W +S+ +GVGIGCC++F  S      +   +S +  V V     +E+  
Sbjct: 346 KSKGTSNRWVIWGLSLTVGVGIGCCISFILSSYSSSVQIPHASRDDVVLV-----EEVPT 400

Query: 441 IVDAIEGNSPSILEESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSI 500
           + D  EGN P              +GQV  L++ T  Q N +LKQF+   + + +WIQ +
Sbjct: 401 LPDKAEGNGP--------------IGQVITLLRKTVKQFNLVLKQFIYEQVGSLSWIQRV 446

Query: 501 GKEFMQPDSQSTISKVTALDLVMF 524
           GKE +  DS  T+ +V ALDLV+ 
Sbjct: 447 GKELISEDSDGTVGRVAALDLVLL 470

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  195 bits (496), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 144/490 (29%), Positives = 237/490 (48%), Gaps = 57/490 (11%)

Query: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTD 96
           QR+SILDPH SV+ LL+     +  S L   +  I +           +N       +++
Sbjct: 36  QRNSILDPHLSVLQLLDRADPPSELSSLKHGE--IAKPATPRRSGFESVNC-----SISE 88

Query: 97  SWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNLSAS 155
           SWQ+I   + S +N          + GD   Q  G+LSS DTSE+E +   +PSPN    
Sbjct: 89  SWQSIKHTDCSMVN----------TQGDATHQHAGILSSSDTSEDEPDAQLSPSPN---- 134

Query: 156 QQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMV 215
                  A+P S+T    +               ++++   ++  +E+     E++   V
Sbjct: 135 -----NFAFPNSATSIFPEAPHN-----------LEASSLREYQNSEIANPREENDNETV 178

Query: 216 NLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEAS 275
            +    + + FVMPKLSL +  ++F ILI+  G  A  FY  + R +  MF+V  +   S
Sbjct: 179 TMSLMNSSNSFVMPKLSLIQQSQKFCILIV--GKPAQRFYRDIPRAYHKMFEVRDVGHLS 236

Query: 276 KEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNK 335
             E  KY+A M+IF + K+   +L ++     +  +I +CQ+GQ+Q ++  +  ++ SN+
Sbjct: 237 PREMNKYSAVMVIFGEPKEGKELLEKVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNE 294

Query: 336 IKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIXXXXXXXXXXXXXXXXH--LAK 393
           I+L+ +  V+SDH ++H LLR+L++L  EVDS YET++                      
Sbjct: 295 IRLVYHLTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGSRKIRKRRKSSKKRSPQITVN 354

Query: 394 RWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGNSPSIL 453
           RW  W IS+ +GVG+G C++   S   ++   +       +  E+  + D    NSP   
Sbjct: 355 RWVIWSISLTVGVGLGYCISCLLSSTSSTLSVTL-----RSGDEVTIMEDI--HNSP--- 404

Query: 454 EESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPDSQSTI 513
              SP    ++L  +   VK    Q+N   KQ+LS   +   W+Q IGKE++   S  T+
Sbjct: 405 -HESP--FDNYLRHLLLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTL 461

Query: 514 SKVTALDLVM 523
             VTALDLV+
Sbjct: 462 PGVTALDLVL 471

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  193 bits (490), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 145/496 (29%), Positives = 245/496 (49%), Gaps = 65/496 (13%)

Query: 38  RHSILDPHDSVMDLLNGQQSCA----FDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKG 93
           R+SILDPH SV+ LL   +  +    F    I +  L+ R            ++    + 
Sbjct: 28  RNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRS-----------SSEPMGRS 76

Query: 94  LTDSWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNL 152
           ++DSWQ+I   +YS LN            G+ + Q  G+LSS DTSE+E +   +PSPN 
Sbjct: 77  ISDSWQSIRHTDYSILNLI----------GETSHQPAGILSSSDTSEDEPDHFLSPSPN- 125

Query: 153 SASQQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELG--AGTGED 210
                             +     ++T   + S      S  T Q S  E    A   ++
Sbjct: 126 -----------------EYAFANGAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDN 168

Query: 211 ETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGK 270
           ET+ ++L +S   + FVMPKLSL++ +++F ILI+  G  A  FY  + R ++ MF+V  
Sbjct: 169 ETVTLSLINS--SNSFVMPKLSLAQPLRKFSILIV--GKPAQRFYRDIPRAYQKMFEVCD 224

Query: 271 LNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTF 330
                  +  +++A M+IF+D K   ++L  +  +  +  +I +CQ+GQ+Q ++  +  F
Sbjct: 225 AESFKTRDVDQFSAIMVIFTDPKNGQSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRF 282

Query: 331 ANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIXXXXXXXXXXXXXXXXH 390
           + ++ ++L+ +  V+SDH ++H LLR+L++L  E+DS+Y+T++                 
Sbjct: 283 SKTHHLRLIYHLTVMSDHQDVHRLLRYLYTLSNEIDSEYDTEVGPRKVRKRRKSYKKRET 342

Query: 391 LA--KRWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGN 448
            A   RW  W IS+ +GVGIG C++   S   T S   +   + ++D EI  I +A    
Sbjct: 343 PAAVNRWVIWSISLTVGVGIGYCISCLLSS--TMSVRGNTLTLHSSD-EIALIEEAPISP 399

Query: 449 SPSILEESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPD 508
             ++LE        ++  Q+    K    Q+++  KQ L  H +   W+Q IGK++M   
Sbjct: 400 HETVLE--------NYFRQLVLAFKKAVKQVSQSFKQCLHGHSLPVLWMQRIGKDWMSEA 451

Query: 509 SQSTISKVTALDLVMF 524
           S +T+  VTALDLV+ 
Sbjct: 452 SDTTLPGVTALDLVLI 467

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  166 bits (419), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 137/493 (27%), Positives = 224/493 (45%), Gaps = 63/493 (12%)

Query: 38  RHSILDPHDSVMDLLNGQQSCAFDS--RLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLT 95
           + SILDPH SV+++L G++    +    L     +  ++ +   + H+ I         +
Sbjct: 24  QRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSI---------S 74

Query: 96  DSWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSAS 155
           +SWQ+I   +Y FL+  N  +    S        G + SSDTSEEE +I+ +P P  SAS
Sbjct: 75  ESWQSIKSTDYLFLSRANDTSLQQQS------AVGILSSSDTSEEEQDIHPSPPPPNSAS 128

Query: 156 QQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMV 215
              +  +           Q  S T  H  S+ +                    + ET+ V
Sbjct: 129 SAFDSRI------INIAGQAFSATLSHLRSEDE------------------DDDGETVTV 164

Query: 216 NLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEAS 275
           +L ++      VMPKLSLS+ +   K+LI+  G  A  F+  + + ++ MF++  L+   
Sbjct: 165 SLPNTMTS--LVMPKLSLSDRIIESKVLIV--GQPARKFWFSIPKSYQKMFEICSLSVLR 220

Query: 276 -KEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSN 334
            K+   KY+  M+IF D      +L+R+  K     +IPICQKGQKQ ++  +K + + N
Sbjct: 221 DKDVDEKYSTIMVIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGN 280

Query: 335 KIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIXXXXXXXXXXXXXXXXHLA-- 392
           +IKL   P+V+S+H+E H LL+HLH L    DS YET++                     
Sbjct: 281 RIKLFCNPIVMSNHHEKHRLLKHLHQLSSGSDSGYETEVTVEPVKKLPRKAKKRPSKPST 340

Query: 393 -KRWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGNSPS 451
            + W  W  SI +G+GIGCCV+   S        +    +      +D I       S  
Sbjct: 341 FRDWVVWTASITIGIGIGCCVSLMVS--------TRYAFLVPRQLAVDDI------TSSP 386

Query: 452 ILEESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPDSQS 511
           +  E + +S  +       L K +  ++   L+ F S  L +  WI ++G E    DS  
Sbjct: 387 LSPEGTDKSSHNLFLHAYSLCKTSLKKLASSLRPFFSDRLESCTWIHTLGIELSYDDSLI 446

Query: 512 TISKVTALDLVMF 524
           ++ ++  LD +M 
Sbjct: 447 SMGRIMPLDFIML 459

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  161 bits (407), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 124/492 (25%), Positives = 213/492 (43%), Gaps = 70/492 (14%)

Query: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTD 96
           Q   ILDPH SV+++L+ Q               ++ +G    +    +    H   +++
Sbjct: 27  QHKGILDPHLSVLEMLDRQDG--------DGAGQVE-EGAVMTVGKRRVERSLH-HSISE 76

Query: 97  SWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQ 156
           SWQAI R +YSFL+ G H        G  +   G + SSDTSEEE E+     P+   + 
Sbjct: 77  SWQAIKRSDYSFLS-GTHEV------GAMHSSVGILSSSDTSEEEAEMR----PSAHGTV 125

Query: 157 QHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVN 216
                LA P+                              Q    E  +   ED+   V 
Sbjct: 126 HLGSSLASPMR-----------------------------QLLVEEDNSCAEEDDCQTVT 156

Query: 217 LGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASK 276
           +    + +  VMPKLSLS+ +   ++L++  G  A  F+  + + ++ +FDV  L   ++
Sbjct: 157 ISMPSSSTSLVMPKLSLSQRLGEPQLLLV--GQPARKFWLTIPKCYQKLFDVKNLGMVTR 214

Query: 277 -EEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNK 335
            +   +Y A M++F D  +   +L+ + +K    T+IP+CQKGQK ++   +K +     
Sbjct: 215 WDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKC 274

Query: 336 IKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIXXXXXXXXXXXXXXXXHLA--K 393
           I++   P+++S+H+E H LL+HLH+L  E +S YET++                     +
Sbjct: 275 IRVYCSPIIMSNHHEKHRLLKHLHNLCNESESGYETELTVKSKKQHRRPRKKDAGPVALR 334

Query: 394 RWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGNSP-SI 452
            W  W  S  +G+GIGCC++   +   T  + SS  +  TA          I    P S+
Sbjct: 335 HWAIWTASFTIGIGIGCCISLMATTRFT--FFSSAPLPLTA---------VIPAQIPSSV 383

Query: 453 LEESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPDSQST 512
             +  P  +      +C   K T  Q+   L+ F      +  W+   G +    D  ++
Sbjct: 384 ASDKPPHRLVPHFYMLC---KTTIRQLGTSLRLFFFEKFESRTWVHIFGMDLHSDDPLAS 440

Query: 513 ISKVTALDLVMF 524
           + ++  LD +M 
Sbjct: 441 LGRLMPLDFIML 452

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  127 bits (318), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 131/521 (25%), Positives = 216/521 (41%), Gaps = 72/521 (13%)

Query: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKG-LT 95
           +R SILDPH SV++LL           L         KG+ ++I  N   T     G ++
Sbjct: 22  ERRSILDPHLSVLELLRRPSDTRPHEAL---------KGEVSDIVGNCAGTTGTGNGSIS 72

Query: 96  DSWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSAS 155
            SWQ I R++              T+ G  +       SSDTSE+E +   +PS      
Sbjct: 73  QSWQTIHRNDSCLSVVPERCPSQATAAGILS-------SSDTSEDEPDAVNSPS------ 119

Query: 156 QQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPV--KSTKTGQFSKAELGAGTG----E 209
             H Q  A P           S       + G P+          +  + G+ TG    E
Sbjct: 120 AVHQQLHATPPQK-----HTKSLEDYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEE 174

Query: 210 DETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVG 269
           D+   +    + + + F+MPKLSLS+  ++F+IL+L  G     FY+ + + ++ MF++ 
Sbjct: 175 DDNDTITKSLNSSSNSFIMPKLSLSQKTQKFRILVL--GRPGLKFYHSIPKKYQHMFELP 232

Query: 270 KLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKT 329
           + ++ +  E  +YT  +++F + K++ ++LNR+ +   +  +IP+CQ GQ+Q V   +++
Sbjct: 233 RSHDPA--EFKQYTGILVVFQELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLES 290

Query: 330 FANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIXXXXXXXXXXXXXXXX 389
              +  + L+  PVV+++  ++ G+ R L  L   V  + + D                 
Sbjct: 291 LLKNRLVSLLYPPVVVNNQPDLLGMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQR 350

Query: 390 HLAK-----------------------RWWFWPISIALGVGIGCCVTFYFSKFETSSYNS 426
              K                       RW  W +S+ LGVG+G C++   S    S   +
Sbjct: 351 KKKKFIETSAERNGRPHKKRHNNEKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTN 410

Query: 427 SVGVIQTADKEIDAIV-DAIEGNSPSILEESSPQSISDFLGQVCKLVKDTAIQINELLKQ 485
            +G +       D  V D  E      L E    S   F G    L K    Q N  +KQ
Sbjct: 411 PLGPVDPESVSKDLFVFDRQELK----LGEMDMDSDHPF-GHALFLFKQALKQWNLAVKQ 465

Query: 486 FLSAHLMTSAWIQSIGKE--FMQPDSQSTISKVTALDLVMF 524
           FL  HL   + ++ IG       P S    ++V AL  VM 
Sbjct: 466 FLGRHL---SCMERIGPANCLEWPTSDEHTNRVLALGYVML 503

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  122 bits (306), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 126/485 (25%), Positives = 209/485 (43%), Gaps = 83/485 (17%)

Query: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTD 96
           ++ S+LDPH SV++LL          R ++  D              D+   T+S  ++ 
Sbjct: 27  EKKSLLDPHLSVLELLERTGDTQRVGRGVEKAD--------------DMANTTNS--ISS 70

Query: 97  SWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQ 156
           SWQAI R++          +    + G  +       SSDTSEEE  I+ A SPN++   
Sbjct: 71  SWQAIHRNDAMITGVPERCSSQAAAVGILS-------SSDTSEEE--IDPASSPNVAHFT 121

Query: 157 QHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVN 216
           Q +Q    P               +    D +P   T+T             +DET+  +
Sbjct: 122 QFHQSQQPPRLPFKL-----DVPVILPARDQEPSGQTQTPD------NDDERDDETLTKS 170

Query: 217 LGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASK 276
           L +S   + FVMPKLSLS+   + +ILIL  G     FY  + + ++  F++ +L + S 
Sbjct: 171 LSNS--SNSFVMPKLSLSQKSHKLRILIL--GRPGLKFYQSIPKRYQHFFELSRLQDPS- 225

Query: 277 EEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKI 336
            E  ++T  +I+F + K++ ++LNR+ +      +IP+CQ GQ Q V   +++   S  I
Sbjct: 226 -EFRQFTGILIVFQELKEMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLI 284

Query: 337 KLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIXXXXXXXXXXXXXXXXHLAK--- 393
            L+  PVVIS+H +++ + R L  L   + SD   D                 H  K   
Sbjct: 285 SLLYPPVVISNHSDLNNMYRFLLDLSKTI-SDNSEDDEDEEERELLDKKIKKSHQRKKKR 343

Query: 394 ---------------------RWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQ 432
                                +W  W IS+ +GVG+G C++++          +S G+I 
Sbjct: 344 AGSYDKTDKPRKRRSKETKINKWIVWGISLTVGVGVGYCMSYF----------ASSGLIS 393

Query: 433 TADKEIDAIVDAIEGNSPSILEESS------PQSISDFLGQVCKLVKDTAIQINELLKQF 486
            + K I +I      ++  + ++SS         + +       L+K T  Q N  +KQF
Sbjct: 394 MSAKSIASINGCRPNDNVVVFDDSSLGMGEYDHDLENPFAHALYLLKQTLKQWNWAMKQF 453

Query: 487 LSAHL 491
           L  HL
Sbjct: 454 LMKHL 458

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  119 bits (298), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 108/417 (25%), Positives = 191/417 (45%), Gaps = 75/417 (17%)

Query: 41  ILDPHDSVMDLL--NGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSW 98
           +LDPH SV++LL   G         L+ +   ID  G      H ++N       ++ SW
Sbjct: 41  LLDPHLSVLELLGKTGHSPSPMGQSLVTS---IDISG------HQNVN-----DSISGSW 86

Query: 99  QAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNLSASQQ 157
           QAI       L+ G        S+   N   G +LSS DTSEEE E+  AP+ ++     
Sbjct: 87  QAIQP-----LDLGASFIPERCSSQTTN---GSILSSSDTSEEEQELLQAPAADI----- 133

Query: 158 HNQFLAYPLSSTGFGDQG-NSETTVHQFSD-----GDPVKSTKTGQFSKAELGA---GTG 208
                   ++    G +G N  ++ H F         P+ S +   + + ++     G  
Sbjct: 134 --------INIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAY 185

Query: 209 EDETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDV 268
           E++++ +    + + + FVMPKLSLS+    F++LIL  G + ++FY  + + ++ +F++
Sbjct: 186 EEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLIL--GRTGSNFYQSIPKEYQSLFEL 243

Query: 269 GKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVK 328
            K ++++     +YT  +IIF + +++ ++LNR+ +      +IPICQ GQ   V   +K
Sbjct: 244 PKYHDSATFP--QYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLK 301

Query: 329 TFANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEV----------------DSDYETD 372
           +F  +  IKL+  PVV+++  ++  + + L  L +E                  S Y   
Sbjct: 302 SFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLEYAEDENEEGDDDETTKSRSYYRYK 361

Query: 373 IXXXXXXXXXXXXXXXXHLAKR----WWFWPISIALGVGIGCCVTFYFSKFETSSYN 425
                               +R    W+ W ISI +G+  GCCVT+    F T++Y+
Sbjct: 362 KANNSKRKSPKSNKKPKKKKQRFFTSWFTWGISITIGISFGCCVTY----FVTAAYD 414

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  114 bits (284), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 109/437 (24%), Positives = 189/437 (43%), Gaps = 97/437 (22%)

Query: 41  ILDPHDSVMDLL--NGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSW 98
           +LDPH SV++LL   G         L+ + D+           H+ +N       ++ SW
Sbjct: 41  LLDPHLSVLELLGKTGHSPSPMGHSLVTSIDISS---------HHYVN-----DSISGSW 86

Query: 99  QAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAP--------- 148
           QAI       L+ G       +S+   N   G +LSS DTSEEE E+  AP         
Sbjct: 87  QAIHP-----LDLGASFVPERSSSQTTN---GSILSSSDTSEEEQELLQAPAADIINIIK 138

Query: 149 ---------SPNLSASQQHNQFLAYPLSSTG---FGDQGNSETTVHQFSDGDPVKSTKTG 196
                    SP+    Q H + ++ PL + G   +G+Q + +                  
Sbjct: 139 QGQEGASVTSPSRPFRQLH-KVISLPLPAKGRTSYGEQDDDDNN---------------- 181

Query: 197 QFSKAELGAGTGEDETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYN 256
                +   G  E+++  +    + + + FVMPKLSLS+    F++LIL  G + ++FY 
Sbjct: 182 --VDDDYDDGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLIL--GRTGSNFYQ 237

Query: 257 RLSRYHRLMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQ 316
            + + H+ +F++ K ++++     +YT  +IIF + +++ ++LNR+ +      +IPICQ
Sbjct: 238 SIPKEHQSLFELPKYHDSTAFP--QYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQ 295

Query: 317 KGQKQSVTEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEV----------- 365
            GQ   V   +K+F  +  IKL+  PVV+++  ++  + + L  L +E            
Sbjct: 296 PGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYAEDGDNDDEDN 355

Query: 366 ---------DSDYETDIXXXXXXXXXXXXXXXXHLAK----RWWFWPISIALGVGIGCCV 412
                     S Y                       +    RW+ W +SI +G+  GCCV
Sbjct: 356 DDEIIHTNSRSYYRNKKANSSKKKSFKSNKKPKKKKQRSLTRWFTWGVSITIGISFGCCV 415

Query: 413 TFYFSKFETSSYNSSVG 429
           T+    F T++Y+   G
Sbjct: 416 TY----FATAAYDHQTG 428

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  109 bits (273), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 101/410 (24%), Positives = 179/410 (43%), Gaps = 71/410 (17%)

Query: 41  ILDPHDSVMDLLN--GQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSW 98
           +LDPH SV++LL+  G         L+ + D+      S N + ND         ++ SW
Sbjct: 41  LLDPHLSVLELLSKTGHSPSPMGQNLVTSIDI------SGNHNVND--------SISGSW 86

Query: 99  QAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNLSASQQ 157
           QAI       L+ G        S+   N   G +LSS DTSEEE E+  AP+ ++    +
Sbjct: 87  QAIQP-----LDLGASFIPERCSSQTTN---GSILSSSDTSEEEQELLQAPAADIINIIK 138

Query: 158 HNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELG--------AGTGE 209
             Q            +  N  +  H F     + S       K                E
Sbjct: 139 QGQ------------EGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGDEDEAFE 186

Query: 210 DETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVG 269
           ++++ +    + + + FVMPKLSL++    F++LIL  G + +SFY  + + ++ +F++ 
Sbjct: 187 EDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLIL--GRTGSSFYQSIPKEYQSLFELP 244

Query: 270 KLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKT 329
           K ++++     +YT  +IIF + +++ ++LNR+ +      +IPICQ GQ   V   +K+
Sbjct: 245 KYHDSATFP--QYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKS 302

Query: 330 FANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIXXXXXXXXXXXXXXXX 389
           F  +  +KL+  PVV+++  ++  + + L  L +E   D   +                 
Sbjct: 303 FLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYCRN 362

Query: 390 HLAKR----------------------WWFWPISIALGVGIGCCVTFYFS 417
             A+                       W+ W ISI +G+  GCCVT++ +
Sbjct: 363 KKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVT 412

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  103 bits (258), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 106/428 (24%), Positives = 186/428 (43%), Gaps = 86/428 (20%)

Query: 41  ILDPHDSVMDLL--NGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSW 98
           +LDPH SV++LL   G         L+ + D+      SN+  HN I+       ++ SW
Sbjct: 41  LLDPHLSVLELLGKTGSSPSPLGQSLVTSIDI------SNH--HNVID------NISGSW 86

Query: 99  QAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNLSASQQ 157
           Q I       L+ G        S+   N   G +LSS DTSEEE ++  AP+ ++     
Sbjct: 87  QTIQP-----LDLGASFIPERCSSQTTN---GSILSSSDTSEEEQDLLQAPAADI----- 133

Query: 158 HNQFLAYPLSSTGFGDQGNSETTV-HQFSDGDPVKSTKTGQFSKAELGA----------- 205
                   ++    G  G S T+  H F     V S       +   G            
Sbjct: 134 --------INIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDD 185

Query: 206 --GTGEDETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHR 263
             G  E++++ +    + + + FVMPKLSLS     F++LIL  G +  +FY    + ++
Sbjct: 186 DNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLIL--GRTGTNFYQSTPKEYQ 243

Query: 264 LMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSV 323
            +F++ K ++++     +YT  +I+F + +++ ++LNR+ +      +IPICQ GQ   V
Sbjct: 244 SLFELPKSHDSTIFP--QYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQV 301

Query: 324 TEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIXXXXXXXXXX 383
              +K+F  ++ IKL+  PVV ++  ++  + + L  L +E   D + +           
Sbjct: 302 KNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYVEDEKNEDEDEDNDDEII 361

Query: 384 XXXXXXHL--------------------------AKRWWFWPISIALGVGIGCCVTFYFS 417
                 +                           + RW+ W +SI +G+  GCCVT+   
Sbjct: 362 QPYSRSYYRSKKGGSSKKKSSKSNKKSKKKKQRSSTRWFTWGVSITIGISFGCCVTY--- 418

Query: 418 KFETSSYN 425
            F T++Y+
Sbjct: 419 -FVTAAYD 425

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 94/207 (45%), Gaps = 20/207 (9%)

Query: 226 FVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEALKYTAF 285
           FVMPKLSL+    + K L++  G  +  F+  + R +R  F + + ++ S  E   Y   
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVV-GRLSKRFHQDIPREYRQYFHISQSSDPS--EFQNYIGI 251

Query: 286 MIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKLMSYPVVI 345
           +I+F + K+   +LNR+ +      +IPICQ GQ+  V   +K+F  ++ I L   PV I
Sbjct: 252 VIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTI 311

Query: 346 SDHYEIHGLLRHLHSLYVEVDSDYETDIXXXXXXXX---------XXXXXXXXHLAK--- 393
           ++   +  L +H   L  ++++  E D+                         H  K   
Sbjct: 312 ANEKSMEKLFKHTVKLVNKLEN--EEDVLSLSTSDKSLSDETSGYRKNNRRKKHGGKPST 369

Query: 394 ---RWWFWPISIALGVGIGCCVTFYFS 417
              +W  W IS+ +GV IG   T+  +
Sbjct: 370 NYSKWITWGISLTIGVSIGYYATYMIT 396

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 79/144 (54%), Gaps = 10/144 (6%)

Query: 226 FVMP---KLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDV-GKLNEASKEEALK 281
           FVMP     S     ++F+ILI   G    SFY  + + ++ +F V  +LN  ++ E   
Sbjct: 168 FVMPTLSLSSSQSQQRKFQILIF--GRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDN 225

Query: 282 YTAFMIIFSDSKKVTTILNRMWK----KYGDFTLIPICQKGQKQSVTEKVKTFANSNKIK 337
           +TAF+IIF + K++ ++LNR+ +    K     +IPICQ GQK  V   +K F  +N + 
Sbjct: 226 FTAFLIIFEELKELVSLLNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVT 285

Query: 338 LMSYPVVISDHYEIHGLLRHLHSL 361
           L+S  ++I+D   +  + + + S+
Sbjct: 286 LLSPIIIINDERALLKMFKTMQSI 309

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 81/162 (50%), Gaps = 8/162 (4%)

Query: 215 VNLGHSWAGSF--FVMPKLSLSESMKRFKILILSDGDSAN-SFYNRLSRYHRLMFDVGKL 271
           +NL  S   S   F+MPKLS + + ++F+ILIL  G + N +FY  +   ++ +F++   
Sbjct: 323 LNLTKSMTSSSNSFIMPKLSWTNTFRKFRILIL--GSNQNLTFYQNIPTSYKYLFELPPN 380

Query: 272 NEASKEEALKYTAFMIIFSDSKKVTTILNRMWK-KYGDFTLIPICQKGQKQSVTEKVKTF 330
           N     +   Y    I+  D     +ILN++ K       +IPIC+KGQ   V   +K +
Sbjct: 381 NFDYNFK--HYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPY 438

Query: 331 ANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETD 372
             +  + L+  P+V ++   ++ L  HL+ L   V+ +   D
Sbjct: 439 IKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVELEITRD 480

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 393 KRWWFWPISIALGVGIGCCVTFYFSK-FETSSYNSSVGVIQTADKEIDAIVDAIEGNSPS 451
           K+  +W +S+++GVG+G C+++Y S  F   S + S G+     + +   V      SP+
Sbjct: 611 KKIIYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPTVSDTPIPSPT 670

Query: 452 ILE-ESSPQSISDFLGQVCK--------LVKDTAIQINELLKQF 486
               E +  +   ++G+  K        L+K T   +N   KQ 
Sbjct: 671 TYSMEENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQI 714

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 81/400 (20%), Positives = 150/400 (37%), Gaps = 81/400 (20%)

Query: 40  SILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSWQ 99
           S+LDPH SV++LL  ++SC       +     +  G S N     I        L++SW 
Sbjct: 7   SVLDPHLSVLELL--EKSC-------ERGGHAEAPGSSRNKGAGQIQ-------LSESWC 50

Query: 100 AIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHN 159
            ++RDE S +        +N           GVLSS  + EE E       +       +
Sbjct: 51  TVERDELSAMERSASQQTNN-----------GVLSSSDTSEEGEPEQGSPGDGEGGGVAD 99

Query: 160 QFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVNLGH 219
             +A P  S     Q  S T      DG                     +D++  V+   
Sbjct: 100 TRMARPAMSL----QSTSSTL-----DG--------------------VDDDSATVSKSL 130

Query: 220 SWAGSFFVMPKL-----------SLSESMKRFKILILSDGDSANSFYNRLSRY-HRLMFD 267
           + + + F+MPKL           S +   + FK+ +L  G           ++ HR    
Sbjct: 131 TSSSNSFIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELT 190

Query: 268 VGKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKV 327
            G  + A   +       +I+  + +++ ++LNR+     +  ++ +  + ++  V   +
Sbjct: 191 AGVHDLA---QCADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVL 247

Query: 328 KTFANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVE------VDSDYETDIXXXXXXXX 381
           + F     + L+  PV +S++  +  +   + +L  +      + +D +T          
Sbjct: 248 RNFTRQRLVSLLHPPVPLSNNEALDKMFHFVDNLARQQEPAGVIHNDPQTTQEQHPDHNE 307

Query: 382 XXXXXXXXHLA---KRWWFWPISIALGVGIG-CCVTFYFS 417
                         KRW  W +SI+LG+G G  CV++  S
Sbjct: 308 DDPHRGPSKPEGTFKRWLLWGVSISLGIGAGYYCVSYVVS 347

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 76/140 (54%), Gaps = 11/140 (7%)

Query: 226 FVMPKLSLSESMKR------FKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEA 279
           F+MP+LSL++  ++      F+ILI+  G  ++  +  +    + +F + K  + +  E 
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIV--GRLSSKLFKMIPHKFQNLFQLQKSYDIN--EY 279

Query: 280 LKYTAFMIIFSDSKKVTTILNRMWK-KYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKL 338
            K+TA +++  +++++ ++LNR+ + +     LI IC+K         +K++  ++ I L
Sbjct: 280 QKFTAILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITL 339

Query: 339 MSYPVVISDHYEIHGLLRHL 358
           +  P VIS+  E+  +L  L
Sbjct: 340 LYQPFVISNTEELDRMLVFL 359

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 394 RWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGNSPSIL 453
           +W  W IS+++GVGIG C+++    F +S ++S V         I A V     N   +L
Sbjct: 436 KWIIWGISLSIGVGIGYCISY----FGSSPWSSLVQYFNPESDSISATVPVPLSNESFVL 491

>Skud_4.51 Chr4 (87402..89696) [2295 bp, 764 aa] {ON} YDL206W (REAL)
          Length = 764

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 3/95 (3%)

Query: 66  QNQDLIDRKGKSNNIDHNDINTHTHSK-GLTDSWQAIDRDEYSFLNAGNHNNYHNTSNGD 124
           + ++L+D   +S ++  N+  TH  +K  L D  + + R   + L   ++  Y + SNG+
Sbjct: 324 EKENLLDNAARSLSLPSNE--THLFTKTSLDDEDRPLIRKRINSLQPKDYYKYLSPSNGE 381

Query: 125 FNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHN 159
              Q G V+S+  +E     N      L+  Q+ N
Sbjct: 382 NFNQLGAVISAPQNEPLSHYNEPMDSFLTVPQKQN 416

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 123 GDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHNQFLAYPLSSTGFGDQ-GNSETTV 181
            +FNQ  G +  +D+S      N++  PNL  +Q ++Q L+ P++S+   D   N+E T 
Sbjct: 768 ANFNQS-GNI--ADSSLSFTFTNSSNGPNLITTQTNSQALSQPIASSNVHDNFMNNEITA 824

Query: 182 HQFSDGD---PVKSTKTGQFSKAELGAGTG 208
            +  DG+   P+    T Q +    G  TG
Sbjct: 825 SKIDDGNNSKPLSPGWTDQTAYNAFGITTG 854

>Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 12/60 (20%)

Query: 392 AKRWWFWPISIALGVGIGCCVTFYF---SKFETSSYNSSVGVIQTADKEIDAIVDAIEGN 448
           +KRWW W + IA G+    CV       +K+ + SY +SV         +  ++DAI   
Sbjct: 273 SKRWWPWALCIAYGLTTPICVAIGLGIRTKYVSGSYTASV---------VSGVLDAISAG 323

>CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {ON}
           similar to uniprot|Q12151 Saccharomyces cerevisiae
           YDR213w UPC2
          Length = 922

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 13/66 (19%)

Query: 44  PHDSVMDLLNGQQSCAFDS---RLIQNQDL----------IDRKGKSNNIDHNDINTHTH 90
           P +   DLLN +    FD     ++QNQ            I R   SNNI    +NT+T 
Sbjct: 539 PENPGNDLLNTKSPSTFDGISMDMVQNQTTERKNENNNGSIGRNNSSNNISMTPLNTNTT 598

Query: 91  SKGLTD 96
           S G++D
Sbjct: 599 SSGISD 604

>Skud_8.20 Chr8 (44743..46833) [2091 bp, 696 aa] {ON} YHL024W (REAL)
          Length = 696

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 28/46 (60%)

Query: 97  SWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEV 142
           ++  + +D+  F N+  H NY+N+SNG+ +++ G ++  +   E V
Sbjct: 259 NYNLLHKDKGKFKNSRYHQNYNNSSNGEDSKRNGAIIEEEREHESV 304

>Skud_10.116 Chr10 (210166..213342) [3177 bp, 1058 aa] {ON} YJL098W
           (REAL)
          Length = 1058

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 5/85 (5%)

Query: 422 SSYNSSVGVIQTADKEIDAIVDAIEGNSPSILEESSPQSISD--FLGQVCKLVKDTAIQI 479
           +S N+ VG+I    ++ ++  DAI+ N  +I  ++ P +  D  +LG + KL  +   + 
Sbjct: 392 TSLNNGVGIIIELIRKNNSDYDAIQANYTTI--KTHPPTDRDPIYLGYLVKLFSERMPKF 449

Query: 480 NELLKQFLSAHLMTS-AWIQSIGKE 503
           NE+L +   A L TS   I+ +G E
Sbjct: 450 NEILTEKKIAPLRTSYGTIEPLGFE 474

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,730,401
Number of extensions: 2380803
Number of successful extensions: 10877
Number of sequences better than 10.0: 131
Number of HSP's gapped: 11199
Number of HSP's successfully gapped: 147
Length of query: 524
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 410
Effective length of database: 40,409,475
Effective search space: 16567884750
Effective search space used: 16567884750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)