Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00638g5.700ON1155115558760.0
SAKL0E14872g5.700ON1140114333730.0
Kwal_55.197075.700ON1143115631870.0
KNAG0L021105.700ON1200122130420.0
ZYRO0G06644g5.700ON1166115130110.0
Skud_9.215.700ON1221122429790.0
Suva_9.415.700ON1219124329330.0
TDEL0B022105.700ON1095114729260.0
Kpol_2001.745.700ON1113113129110.0
Smik_9.225.700ON1230123029110.0
CAGL0H06567g5.700ON1169117629100.0
YIL147C (SLN1)5.700ON1220124828890.0
AFR284W5.700ON1103113228450.0
Ecym_40205.700ON1125113928080.0
TPHA0D045905.700ON1127113427160.0
NDAI0F003105.700ON1259101725690.0
TPHA0E002505.700ON1068113123950.0
KAFR0D022405.700ON118771320280.0
KLTH0E01100g5.700ON117771920060.0
TBLA0I016805.700ON121472617270.0
Kpol_1043.685.700ON104272417050.0
TBLA0E021005.700ON114072115440.0
NCAS0G002505.700ON11833659951e-115
NDAI0D034304.385ON5971151353e-07
Ecym_74744.385ON4961011326e-07
ADL388W4.385ON4821021309e-07
NCAS0A064504.385ON6091021301e-06
KLLA0E09505g5.230ON635741282e-06
CAGL0F09097g4.385ON6301021273e-06
KAFR0B069904.385ON5451021254e-06
KNAG0M001804.385ON6151021254e-06
ZYRO0G00484g4.385ON6471021246e-06
KAFR0J007005.230ON6201591221e-05
KLTH0D17182g4.385ON4641021211e-05
SAKL0B12408g4.385ON4651021211e-05
TDEL0D003204.385ON5471021202e-05
Kpol_265.24.385ON5491021192e-05
KLLA0A10219g4.385ON4751021192e-05
Smik_8.2964.385ON6251531192e-05
TBLA0A107004.385ON5871021183e-05
YHR206W (SKN7)4.385ON6221021131e-04
Suva_15.4124.385ON6171021131e-04
Skud_8.2734.385ON6231021131e-04
TPHA0C001504.385ON5101011112e-04
ADR343C5.230ON749891122e-04
Kwal_47.167704.385ON4611021112e-04
YLR006C (SSK1)5.230ON712721103e-04
Suva_10.845.230ON695721103e-04
KLTH0B02684g5.230ON5951151093e-04
Kpol_1004.45.230ON714781103e-04
Smik_12.685.230ON712721094e-04
TDEL0E039805.230ON730721094e-04
Ecym_50775.230ON7951311094e-04
Skud_12.725.230ON702721094e-04
Kwal_33.152885.230ON5871031067e-04
KNAG0B051405.230ON6481351067e-04
TPHA0N008505.230ON670781069e-04
CAGL0D02882g5.230ON667711050.001
NCAS0D029005.230ON7621221030.002
SAKL0G12100g5.230ON738721020.003
NDAI0I020005.230ON890721010.003
TBLA0D031705.230ON76595990.005
ZYRO0A11154g5.230ON77671980.008
KLLA0E04533g7.222ON42182870.14
TBLA0B015507.222ON39481840.27
Kwal_47.181517.222ON414103830.39
SAKL0F08184g7.222ON41281800.81
TDEL0H022307.222ON430103745.0
NDAI0A070203.105ON34397735.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00638g
         (1155 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...  2268   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1303   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1232   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  1176   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1164   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  1152   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...  1134   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...  1131   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...  1125   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...  1125   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...  1125   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...  1117   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...  1100   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...  1086   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  1050   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   994   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   927   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   785   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   777   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   669   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   661   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   599   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   387   e-115
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     57   3e-07
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    55   6e-07
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    55   9e-07
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    55   1e-06
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    54   2e-06
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    54   3e-06
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    53   4e-06
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    53   4e-06
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    52   6e-06
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    52   1e-05
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    51   1e-05
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    51   1e-05
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    51   2e-05
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    50   2e-05
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    50   2e-05
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    50   2e-05
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    50   3e-05
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    48   1e-04
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    48   1e-04
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    48   1e-04
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    47   2e-04
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    48   2e-04
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    47   2e-04
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    47   3e-04
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    47   3e-04
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    47   3e-04
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    47   3e-04
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    47   4e-04
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    47   4e-04
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    47   4e-04
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    47   4e-04
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    45   7e-04
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    45   7e-04
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    45   9e-04
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    45   0.001
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    44   0.002
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    44   0.003
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    44   0.003
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    43   0.005
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    42   0.008
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    38   0.14 
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    37   0.27 
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    37   0.39 
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    35   0.81 
TDEL0H02230 Chr8 complement(375714..377006) [1293 bp, 430 aa] {O...    33   5.0  
NDAI0A07020 Chr1 complement(1601054..1602085) [1032 bp, 343 aa] ...    33   5.8  

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score = 2268 bits (5876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1109/1155 (96%), Positives = 1109/1155 (96%)

Query: 1    MLAGLKRRCSLKALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSV 60
            MLAGLKRRCSLKALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSV
Sbjct: 1    MLAGLKRRCSLKALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSV 60

Query: 61   RAERLQVAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSL 120
            RAERLQVAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSL
Sbjct: 61   RAERLQVAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSL 120

Query: 121  EKFLGSSGLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTG 180
            EKFLGSSGLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTG
Sbjct: 121  EKFLGSSGLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTG 180

Query: 181  IVTDPVYNWTNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSS 240
            IVTDPVYNWTNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSS
Sbjct: 181  IVTDPVYNWTNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSS 240

Query: 241  VSILSAVFDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNM 300
            VSILSAVFDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNM
Sbjct: 241  VSILSAVFDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNM 300

Query: 301  VQERNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPI 360
            VQERNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPI
Sbjct: 301  VQERNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPI 360

Query: 361  AHWAVQPIVRLQKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKS 420
            AHWAVQPIVRLQKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKS
Sbjct: 361  AHWAVQPIVRLQKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKS 420

Query: 421  VTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSY 480
            VTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSY
Sbjct: 421  VTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSY 480

Query: 481  TSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLE 540
            TSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLE
Sbjct: 481  TSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLE 540

Query: 541  AAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXX 600
            AAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSG  
Sbjct: 541  AAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGEL 600

Query: 601  XXXXXXXXXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIR 660
                      FSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIR
Sbjct: 601  LLHILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIR 660

Query: 661  TLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPG 720
            TLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPG
Sbjct: 661  TLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPG 720

Query: 721  SEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGND 780
            SEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGND
Sbjct: 721  SEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGND 780

Query: 781  NDESSIVLXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFRD 840
            NDESSIVL             MSIL       YDDAIFHSQFKKVLSSTDSDTEENTFRD
Sbjct: 781  NDESSIVLESKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRD 840

Query: 841  LKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMM 900
            LKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMM
Sbjct: 841  LKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMM 900

Query: 901  KGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRK 960
            KGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRK
Sbjct: 901  KGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRK 960

Query: 961  SVQTKKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASE 1020
            SVQTKKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASE
Sbjct: 961  SVQTKKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASE 1020

Query: 1021 VTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMD 1080
            VTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMD
Sbjct: 1021 VTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMD 1080

Query: 1081 VQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFXXXXXXXXXXXX 1140
            VQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGF            
Sbjct: 1081 VQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLKK 1140

Query: 1141 XXAQYCSKKEKQREE 1155
              AQYCSKKEKQREE
Sbjct: 1141 IIAQYCSKKEKQREE 1155

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1303 bits (3373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/1143 (59%), Positives = 839/1143 (73%), Gaps = 32/1143 (2%)

Query: 14   LRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKS 73
            LR +  PPF VG+RTQLI LVC + +LSL I+ VTTGVYFT NYKS+RA+RL VAAQLKS
Sbjct: 7    LRSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKS 66

Query: 74   SQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAA 133
            SQ+DQNLNYLYYQ YWLSTRDTLQD+L+ +RAGN++++NW+ AE  LEKFLGSS LFS A
Sbjct: 67   SQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVA 126

Query: 134  RVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYL 193
            R+YD++F TV+N+TNNGSG+ +PE+VL  LFPLS  +PL+SSL T+GI+TDPV N T Y+
Sbjct: 127  RIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYV 186

Query: 194  LSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSS 253
            +SMSLP+  +PSI+L  +EI+GYITV+ SAESLK V NDT ALDKS V+ILSA + + S 
Sbjct: 187  MSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSL 246

Query: 254  LTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPP 313
               YHFVFPPHG  +     +F I+NG+FI  AF++ K GSV +T+    +++AVGYSP 
Sbjct: 247  PVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPC 306

Query: 314  TFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQK 373
             FK V WVAV++QPE VFLSP+ RL  II GT   IAVFMCL+TFP+AHWAV+PIVRLQK
Sbjct: 307  LFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQK 366

Query: 374  ATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHN 433
            ATEIIT+ R L+ Y    N  +  + T+S  +  S  + +  +F +++T   P    N +
Sbjct: 367  ATEIITARRGLRSY----NQSAPASRTNSFRKRPSTSSSIGSVF-RTITD-RPHERDNGH 420

Query: 434  YNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVE 493
             N     RT S SV ++ ++      G L  +  T  T ++ND  SY S+ ++ STNL++
Sbjct: 421  SNFELHHRT-SNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLID 479

Query: 494  AYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAK 553
            A VPVY R F DELSELTDTFNTMTDELDRHYALLE+RVRARTKQLEAAKI+AE+ANEAK
Sbjct: 480  ARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAK 539

Query: 554  TVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSK 613
            TVFIANISHELRTPLNGILGMTAI+MAE DMQKVQNSLKLIFRSG            FSK
Sbjct: 540  TVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSK 599

Query: 614  NVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQ 673
            NVL+RTKLEER+F++MD+ALQ+KSIFGKLAKDQHV LSI L+PN IRT++LWGDSNRIIQ
Sbjct: 600  NVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQ 659

Query: 674  IVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEAND-------- 725
            IVMNLVSNALKF+PVDGKV VRIKLLGEYD K+S+  +Y +VF+ PG+E  D        
Sbjct: 660  IVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSL 719

Query: 726  -DFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDES 784
               E+        RL   S S       ++   S    + +G  + E++T T+ +    S
Sbjct: 720  STLEYTKVDAIQRRLA--SKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDTDKRSNS 777

Query: 785  SIVLXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDS-DTEENTFRDLKV 843
             I                  L       YDDAI H+Q +KV S  +  D+ ++  R L++
Sbjct: 778  EI-------------SDSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEI 824

Query: 844  PKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGT 903
             KTWVI++EVEDTG GI+P+L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGT
Sbjct: 825  SKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGT 884

Query: 904  MKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQ 963
            MKL+SKVGVGSKF FTVPL QT+E+ FD  E  FEDEFN HS+KNRKVKFK+N +    +
Sbjct: 885  MKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMNKNSGGSK 944

Query: 964  TKKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTR 1023
            ++ S ++      ++ +E+ A + +E SVG+VRVDRPFLQSTGTATSTRSI++V S    
Sbjct: 945  SRPSVNTSLNSGTDSTAEKMALSESEVSVGSVRVDRPFLQSTGTATSTRSITTVKSLERP 1004

Query: 1024 HRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQM 1083
             ++LVAEDNNVNQEV+KRML LEGL+D+D+ACDGQEA++KV+ + +  + Y +IFMDVQM
Sbjct: 1005 FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQM 1064

Query: 1084 PRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFXXXXXXXXXXXXXXA 1143
            PRVDGLL+TKMIR +L Y  PIVALTA+ADDSNIKVCL+SGM+GF              +
Sbjct: 1065 PRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLS 1124

Query: 1144 QYC 1146
            ++C
Sbjct: 1125 EFC 1127

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1232 bits (3187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/1156 (56%), Positives = 814/1156 (70%), Gaps = 49/1156 (4%)

Query: 14   LRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKS 73
             + R   P  V +RTQL  LVC + +LSL I+ V TGVYFT+++KS+RAERL VAAQLKS
Sbjct: 13   FQRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKS 72

Query: 74   SQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAA 133
            SQ+DQNLNYLYYQ YWLSTRD LQ+AL  + AGN+S +NW+ A  +L+KFLGSS LFS A
Sbjct: 73   SQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLA 132

Query: 134  RVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYL 193
            RVYD+SF  V+N +NNGSG+ IPEN+L +LFPLS    L SSL  TG++TDPV N + YL
Sbjct: 133  RVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYL 192

Query: 194  LSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSS 253
            +SMSLP+  NPSIIL+T ++ GYITV+ SAE LK+V NDT ALD SSV I+S V+D +  
Sbjct: 193  MSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYD-DHE 251

Query: 254  LTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPP 313
            L GYH VFPP+          + I+NG+F+ DA ++GK GS+  T     + IAVGYSP 
Sbjct: 252  LAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPC 311

Query: 314  TFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQK 373
               L  WVA++TQPE +FLSP+ RL KII GT  AIAV  C++TFP++HWAVQPIVRLQK
Sbjct: 312  NSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQK 371

Query: 374  ATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFN----KSVTKGTPSNY 429
            ATEIIT+GR L+      + +S+T  +H RT +  + + +    +     SV +     Y
Sbjct: 372  ATEIITAGRGLR------SDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKY 425

Query: 430  LNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFS--NDSSSYTSERYIK 487
            +  +    P   + S ++   N + I     D+        TP+S  N+S +  SERYI 
Sbjct: 426  IPDSSKEVPRGNS-SDAIHEVNQENIE----DIEMQKVNSPTPYSMMNESQAVKSERYIT 480

Query: 488  STNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAE 547
            STNL+EA VPVY+R F DELSELT+TFNTMTDELDRHYALLE+RVRART+QLEAAKI+AE
Sbjct: 481  STNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540

Query: 548  SANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXX 607
             ANEAKTVFIANISHELRTPLNGILGMTAIAMAE D  KV++SLKLIFRSG         
Sbjct: 541  GANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTE 600

Query: 608  XXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGD 667
               FSKNVLKRTKLEERDF ++DIALQ++SIFGKLAKDQHV L+I++ PN +R++VLWGD
Sbjct: 601  LLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGD 660

Query: 668  SNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDF 727
            SNRI+QIVMNLVSNALKFTPVDGKVDV+ +LLGEYD ++S++ +Y+EVFV+P +E+    
Sbjct: 661  SNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESR--- 717

Query: 728  EFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTK-TKEGSIQVESETSTEGNDND--ES 784
                TS+T  +   N+ S  V++ T   S   T + T E ++++   + +E  D++  ES
Sbjct: 718  ----TSSTEAKDEKNAES-CVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIES 772

Query: 785  SIVLXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEEN-TFRDLKV 843
            S                   +       YDDAIF ++ +K     DS  EEN   R L+ 
Sbjct: 773  S--------DEDDENEDTKSIGSGNTSSYDDAIFQTRLRK-----DSSNEENEEGRALES 819

Query: 844  PKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGT 903
            PK WVISMEV DTG GIDP+L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM GT
Sbjct: 820  PKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGT 879

Query: 904  MKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQ 963
            MKLDS+VGVGSKF FTVPL QTKE++F+  E  FEDEFN  S+KNRKVKF++  S K  +
Sbjct: 880  MKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKSNKRSK 939

Query: 964  TKKSKSSIDGHSDNNVS-ERKASNS----TENSVGNVRVDRPFLQSTGTATSTRSISSVA 1018
            ++   S  +G+  N+   E    NS    +E SVG+VRVDRPFLQSTGTA ST ++ + +
Sbjct: 940  SRSESSGTEGNGGNSPGVEGSGGNSPGTGSEVSVGSVRVDRPFLQSTGTALST-TLVTTS 998

Query: 1019 SEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIF 1078
            S   R ++LVAEDNNVNQEVIKRML LEGL D+++ACDGQ+A++KV+     G+ Y +IF
Sbjct: 999  SLADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIF 1058

Query: 1079 MDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFXXXXXXXXXX 1138
            MDVQMPRVDGL AT+MIR +L Y  PIVALTA+ADDSNIK CL++GM+GF          
Sbjct: 1059 MDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKI 1118

Query: 1139 XXXXAQYCSKKEKQRE 1154
                 +YC +   ++E
Sbjct: 1119 KAILKEYCPRPIDEKE 1134

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score = 1176 bits (3042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/1221 (52%), Positives = 801/1221 (65%), Gaps = 124/1221 (10%)

Query: 20   PPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQN 79
            PP+ VG+R QL +LV  + ++SL I+ VTTGVYFT+NYK++R++RL +AAQLKSSQ+DQN
Sbjct: 12   PPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 71

Query: 80   LNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTS 139
            LNYLYYQ YW+++RDTLQ  L N+ AGN S  NW  ++  LEKFLGSS LFS ARVYD+S
Sbjct: 72   LNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSS 131

Query: 140  FNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLP 199
            F TV+N+TNN +GD IPE+VL +L PLS   PL SSL T GIVT+PV N ++YL+SMSLP
Sbjct: 132  FTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLP 191

Query: 200  VSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHF 259
            +  NPSIIL  + + GY+TV+ SAE L +V NDT AL++S V+I+SAV+ + + L  Y F
Sbjct: 192  IFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYRF 251

Query: 260  VFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVN 319
            VFPP G++S     TFP+ N TF++ A   GK G++  T +     +AVGYSP T  L N
Sbjct: 252  VFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLAN 311

Query: 320  WVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIIT 379
            WVA+V Q E VF+SP  +L KIIAGTV  I VF  L+TFP+AHWAV+PIVRLQKATE+IT
Sbjct: 312  WVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELIT 371

Query: 380  SGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQV---MKLFNKSVTKGTPSNYLNHNYNV 436
              R L+  + T  S +N+ +    +  +   + V       N S  K  P +  + N N 
Sbjct: 372  ESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVSTNNINNNNSNEKAQPPSDQDTNTN- 430

Query: 437  FPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSS-----SYTSERYIKSTNL 491
               + + S +VS    +  P   G  +          SN S      S TS+ Y  + NL
Sbjct: 431  ---NSSSSIAVSNIREEHSPHADGVFS------GISLSNVSDRLERLSNTSKHYTTAVNL 481

Query: 492  VEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANE 551
            ++A VP YR  F+DELS+LT+TFNTMTD LD+HYALLEERVRARTKQLEAAKI+AE+ANE
Sbjct: 482  IQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANE 541

Query: 552  AKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXXXXF 611
            AKTVFIANISHELRTPLNGILGMTAI+M ETD+ K++NSLKLIFRSG            F
Sbjct: 542  AKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELLTF 601

Query: 612  SKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRI 671
            SKNVLKRTKLE+R+F + D+ALQIKSIFGK+AKDQHV+LSI L+PN IR++VL+GDSNRI
Sbjct: 602  SKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRI 661

Query: 672  IQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDF-EFN 730
            IQIVMNLVSNALKFTPVDGKVDVR+K+LG YD   SE  ++ +V+V PG+E  D     N
Sbjct: 662  IQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLN 721

Query: 731  LTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLXX 790
            + S    +  F S + S N  + D +   T  T   + + + +   E N++         
Sbjct: 722  VKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNES--------- 772

Query: 791  XXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVIS 850
                          +       YDDAIF+SQFKK  +  D D E     +L+ PKTWVIS
Sbjct: 773  --------------MISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVIS 818

Query: 851  MEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKV 910
             EVED+G GID  LQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MMKG M L+SKV
Sbjct: 819  FEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKV 878

Query: 911  GVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSS 970
            GVGSKF FT+PL QT+EI F   E  FEDEFN  S+KNRKVKF++    +S+ ++KS+SS
Sbjct: 879  GVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRM---ARSLNSRKSRSS 935

Query: 971  I------DGHS--------------DNNVSERKASNSTENSVGNV--------------- 995
            I        HS              D +VS+R   NS E +  N+               
Sbjct: 936  IVTAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHR 995

Query: 996  ----------------RVDRPFLQSTGTATSTRSISSVAS-----------------EVT 1022
                             +DRPFLQSTGTATSTRSI  ++S                 E T
Sbjct: 996  NRDKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQT 1055

Query: 1023 R--------HRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESY 1074
            +        +++LVAEDN+VNQEVIKRMLQLEG+ D+D+ACDGQ+A++KV+++   G  Y
Sbjct: 1056 KKTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRY 1115

Query: 1075 SMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFXXXXXX 1134
            ++IFMDVQMP+VDGL +TKMIR+DL    PIVALTA+ADDSNIK CL++GMDGF      
Sbjct: 1116 NLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIK 1175

Query: 1135 XXXXXXXXAQYCSKKEKQREE 1155
                     ++CS    +REE
Sbjct: 1176 RTKLKTILKEFCS---DEREE 1193

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/1151 (53%), Positives = 793/1151 (68%), Gaps = 59/1151 (5%)

Query: 17   RFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQV 76
            +F  P  +G+R QL  LV  + ++SL I+ V+TGVYFT NYK++R+ERL +AAQLKS+Q+
Sbjct: 10   KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69

Query: 77   DQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVY 136
            DQNLNY+YYQ YWLS+RDTLQ+AL N+ AGN +  NW  + + ++KFL SSGLFS A +Y
Sbjct: 70   DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129

Query: 137  DTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSM 196
            D +F  V+++TNNG+G++IPE+ L  L PLSG +PL SSL + GI+T+PV N T+YL+SM
Sbjct: 130  DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189

Query: 197  SLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTG 256
            SLP+  NPSIIL T+ + GYIT++ SA+SLK V +DT AL+KS+V+ILSAV+D N +L+ 
Sbjct: 190  SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249

Query: 257  YHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFK 316
            Y+FVF P G  S     T PIKNGTF++ A   GK G++ +T  +  + +AVGYSP +  
Sbjct: 250  YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309

Query: 317  LVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATE 376
             VNW+AVV Q E VF+ P  +L KII+GTV  I VF+CL+TFP+AHWAV+PIVRLQKATE
Sbjct: 310  FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369

Query: 377  IITSGRDLKHYSNTGNSDSNTAITHS------------RTRSTSNQNQVMKLFNKSVTKG 424
            +IT GR L+  S+ G   SN +   S            R+R T N N+          KG
Sbjct: 370  LITEGRGLRA-SSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNE----------KG 418

Query: 425  TPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSER 484
               +     +  F  + + + S++A                A++G+   S+ S   T+  
Sbjct: 419  HDLHGEQIQHGFFAMNGSINHSLAA--------------SIASSGNEALSDKSKGLTT-- 462

Query: 485  YIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKI 544
               S NL+EA VPVYRRFF DELSELTDTFNTMTD LD+HYALLE+RVRART+QLEAAKI
Sbjct: 463  ---SANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKI 519

Query: 545  QAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXX 604
             AE+ANEAKTVFIANISHELRTPLNGILGMTAI+M E D+ K+QNSLKLIFRSG      
Sbjct: 520  DAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHI 579

Query: 605  XXXXXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVL 664
                  FSKNVLKRTKLE+R+FSV D+ALQIKSIFGK+AKDQ V+LSI L PN IRT+VL
Sbjct: 580  LTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVL 639

Query: 665  WGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEAN 724
            +GDSNRIIQIVMNLVSNALKFTPVDGKV+V + LLGEYD++RSE+ ++++V+V+PG+E  
Sbjct: 640  FGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPK 699

Query: 725  DDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDES 784
             + E +                S+     D S++ + K        ++ET+   ND DE 
Sbjct: 700  GNDEKDKGGIE------EKERFSIENTPNDTSSNSSNK------HSDTETTPGLNDTDEK 747

Query: 785  SIVLXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVP 844
                                        Y+D +FHSQFKK     D D+ E    ++K  
Sbjct: 748  QASDDMDGGEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCD-DSSEELGVEVKDK 806

Query: 845  KTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTM 904
            K WVIS+ VEDTG GID SL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTM
Sbjct: 807  KKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM 866

Query: 905  KLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQT 964
             L SK+GVGS+F FTVPL QT+EI FD     FEDEFN  S+KNRKVKFKI  S KS ++
Sbjct: 867  DLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIAKSLKSKRS 926

Query: 965  KKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRH 1024
            K S  ++ G   ++  +  +     +S  +VR+DRPFLQSTGTA+S  ++ + +   T +
Sbjct: 927  KSSLMTV-GPKSSSSDKSLSQLKLTDSDRSVRLDRPFLQSTGTASSNTNLGTTS---TIN 982

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
            ++LVAEDN+VNQEVIKRML LEG+ ++++ CDGQEA +KV+++++NGE Y++IFMDVQMP
Sbjct: 983  KILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMP 1042

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFXXXXXXXXXXXXXXAQ 1144
            ++DGLL+TKMIR DL Y  PIVALTA+ADDSNI+ CL++GMDGF               +
Sbjct: 1043 KMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEE 1102

Query: 1145 YCSKKEKQREE 1155
            +C  K+ Q ++
Sbjct: 1103 FCPDKQPQEQD 1113

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score = 1152 bits (2979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/1224 (52%), Positives = 826/1224 (67%), Gaps = 98/1224 (8%)

Query: 15   RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74
            R  F PPF +G+R QL  LV  + ++SLTI+ VTTGVYFT+NYK++R++RL +AAQLKSS
Sbjct: 8    RSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 75   QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134
            QVDQ LNYLYYQ Y+L++RD LQ +L ++ AGN S DNW  +   ++KFL SS LF  AR
Sbjct: 68   QVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVAR 127

Query: 135  VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194
            VYD+SF TV+N+TNNG+GD IPE+VL  LFPLS   PL SSL TTGI+TDP+ N T+YL+
Sbjct: 128  VYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLM 187

Query: 195  SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254
            SMSLP+  NPSIIL  + + GYIT++ SAE LK+V NDT AL+KS+V+I+SA +++    
Sbjct: 188  SMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRA 247

Query: 255  TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314
            +GYHFVFPP+GT    ++  FPI+N TFI+  F NGK GS+ KTN    +N+A+GYSP +
Sbjct: 248  SGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCS 307

Query: 315  FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374
            F+LVNWVAVV+QPE VFLSP  +L KIIAGTV AI VF+ LLT P+ HWAV+PIVRLQKA
Sbjct: 308  FQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKA 367

Query: 375  TEIITSGRDL---------------KHYSNTGNSDS-----NTAITHSRTRSTSNQNQVM 414
            TE+IT GR L               + +S+   + S     NT    S T +  + +   
Sbjct: 368  TELITEGRGLRPSTPRTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSANGHGSSGH 427

Query: 415  KLFNKSVTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFS 474
                   T+ +  + +N  +    PS  ++   +  N   I    G L       ++  +
Sbjct: 428  GSGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMD-GSLNHDLLAPNSLRN 486

Query: 475  NDSSSYTSERYIKST--NLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERV 532
            ND+   +S  +I +T  NL EA +P Y+R F DELS+LT+TFNTMTD LD+HYALLE+RV
Sbjct: 487  NDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRV 546

Query: 533  RARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLK 592
            RARTKQLEAAKI+AE+ANEAKTVFIANISHELRTPLNGILGMTAI+M ETD+ K++N+LK
Sbjct: 547  RARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLK 606

Query: 593  LIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSI 652
            LIFRSG            FSKNVL+RTKLE RDF + D+ALQIKSIFGK+AKDQ V+LSI
Sbjct: 607  LIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSI 666

Query: 653  ALTPNFIRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDY 712
            +L PN IRT+VLWGDSNRIIQIVMNLVSNALKFTPVDG VDVR+KLLGEYD   SE   +
Sbjct: 667  SLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQF 726

Query: 713  QEVFVVPGSEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGS-IQVE 771
            +EV V  G+E  D  E    S     LP  +S G       + +T+  T  ++ S IQ E
Sbjct: 727  KEVHVKKGTEITDVVE----SIDKRDLP--TSLGRRKYVNLESTTASITSCRDNSAIQEE 780

Query: 772  -SETSTEGNDNDESSIVLXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTD 830
             ++ +T  N+N     +              +S +       YDDAIF+SQF K L S D
Sbjct: 781  ITKRNTAANEN-----IYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNKALDS-D 834

Query: 831  SDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGL 890
            SD   N  R ++ PKTWVIS+EVEDTG GI+PSLQESVF+PFVQGDQTLSRQYGGTGLGL
Sbjct: 835  SDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGL 894

Query: 891  SICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRK 950
            SICRQLA MM GTMKL+S+VGVGSKF FT+PL QTKEI F   E  FEDEFN  S+KNR+
Sbjct: 895  SICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRR 954

Query: 951  VKFKINSSRKSVQT------------------------------KKSKSSI---DGHSDN 977
            VKF +  S KS Q+                              +K+K+ I   +G ++N
Sbjct: 955  VKFSVAKSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENEN 1014

Query: 978  NVSERK--------------ASNSTENSV-----------GNVRVDRPFLQSTGTATSTR 1012
              ++++              A  S++ +V           G+V +DRPFLQSTGTATS+R
Sbjct: 1015 GKAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSR 1074

Query: 1013 SISSVAS---EVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILK 1069
            ++ +V     + T  ++LV EDN+VNQEVI+RML LEG+ ++++ACDGQEA++KV+E+  
Sbjct: 1075 NVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTS 1134

Query: 1070 NGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFX 1129
             GE+Y+MIFMDVQMP+VDGLL+TKMIR DL YK PIVALTA+ADDSNIK CLESGM+GF 
Sbjct: 1135 KGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFL 1194

Query: 1130 XXXXXXXXXXXXXAQYCSKKEKQR 1153
                         +++C+  + ++
Sbjct: 1195 SKPIKRPKLNTILSEFCAAYQGKK 1218

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score = 1134 bits (2933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/1243 (52%), Positives = 818/1243 (65%), Gaps = 134/1243 (10%)

Query: 15   RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74
            R  FTPPF + +R QL  LV  + ++SL I+ VTTGVYFT+NYK++R++RL +AAQLKSS
Sbjct: 8    RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 75   QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134
            Q+DQ LNYLYYQ Y+L++RD LQ++L  + AGN S DNW  +   ++KFL SS LF  A+
Sbjct: 68   QIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127

Query: 135  VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194
            VYD+SF TV+N+TNNG+GD IP+++  ELFPLS    L SSL TTGI+TDP+ N T+YL+
Sbjct: 128  VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187

Query: 195  SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254
            SMSLP+  NPSIIL  + + GYIT+I SAE LK+V NDT AL+KS+V+I+SAV+++ S  
Sbjct: 188  SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247

Query: 255  TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314
              YHFVFPP+GTSS  +K  FPIKN TFI+ AF+NGK GS+ KTN    +N+A+GYSP +
Sbjct: 248  YAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCS 307

Query: 315  FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374
            F+LVNWVAVV+QPE VFLSP+ +L KII GTV AI VF+ LLT P+AHWAVQPIVRLQKA
Sbjct: 308  FQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKA 367

Query: 375  TEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKG--TPSNYLNH 432
            TE+IT GR L+          +T  T SRT S          F +  + G   PS+ L  
Sbjct: 368  TELITEGRGLR---------PSTPRTVSRTSS----------FKRGFSSGFAVPSSLLQ- 407

Query: 433  NYNVFPPSRTDSPS---VSARNSQTI------------------------PRGPGDLTRS 465
             +N      T S S    S R S  +                         R P D   +
Sbjct: 408  -FNSGEAGSTTSASGHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNA 466

Query: 466  ATTGSTPFSNDSSSYTSERYIK-------------STNLVEAYVPVYRRFFQDELSELTD 512
              +     ++D  +  + R+               S NL EA +P YRR F DELS+LT+
Sbjct: 467  KISMDGSLNHDLLAPNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTE 526

Query: 513  TFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGIL 572
            TFNTMTD LD+HYALLE+RVRARTKQLEAAKI+AE+ANEAKTVFIANISHELRTPLNGIL
Sbjct: 527  TFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGIL 586

Query: 573  GMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERDFSVMDIA 632
            GMTAI+M ETD+ K++NSLKLIFRSG            FSKNVL+RTKLE+RDF + D+A
Sbjct: 587  GMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVA 646

Query: 633  LQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKV 692
            LQIKSIFGK+AKDQ V+LSI+L PNFIRT+VLWGDSNRIIQIVMNLVSNALKFTPVDG V
Sbjct: 647  LQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTV 706

Query: 693  DVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNLTSTTPMRLPFNSSSGSVNTAT 752
            +VR+KLLGEYD + SE   ++EV V  G+E  +D   N+      +      S    + T
Sbjct: 707  EVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDIG-NINKHDAKKSENFKKSMDSESTT 765

Query: 753  KDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLXXXXXXXXXXXXXMSILXXXXXXX 812
               +++  T T +  I   ++ +T  N+N     +              +S +       
Sbjct: 766  TSMTSNRDTSTIQEEI---TKRNTAANEN-----IYKKTRDREKSSNDDISSIVSTSTSS 817

Query: 813  YDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPF 872
            YDDAIF+SQF K L S D D   +  + ++ PKTW IS+EVEDTG GIDPSLQESVF PF
Sbjct: 818  YDDAIFNSQFNKALGS-DDDEGGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPF 876

Query: 873  VQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDG 932
            VQGDQTLSRQYGGTGLGLSICRQLA MM GTMKL+SKVGVGSKF FT+PL QTKEI F  
Sbjct: 877  VQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFAN 936

Query: 933  AEKQFEDEFNIHSRKNRKVKFKINSSRKSVQT-------------------KKSKSS--I 971
                FEDEFN  SR+NR+VKF +  S KS Q+                   +KS+S+   
Sbjct: 937  MNFPFEDEFNPESRQNRRVKFNVARSIKSRQSASSIATPTANRCGLTNEMLRKSRSNEEE 996

Query: 972  DGHSDNNVSE---------------------------------RKASNSTENS----VGN 994
            +G    N+ E                                 +K++ ST +S    VG+
Sbjct: 997  EGRKIINIEEGKEGGNELDEAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGS 1056

Query: 995  VRVDRPFLQSTGTATSTRSISSVASEVTRH---RVLVAEDNNVNQEVIKRMLQLEGLTDL 1051
            V +DRPFLQSTGTATS R+I +V++        ++LV EDN+VNQEVIKRML LEG+ ++
Sbjct: 1057 VNLDRPFLQSTGTATSNRNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENI 1116

Query: 1052 DMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAY 1111
            ++ACDGQ+A++KV+E+   GESY+MIFMDVQMP+VDGLL+TKMIR DL Y  PIVALTA+
Sbjct: 1117 ELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAF 1176

Query: 1112 ADDSNIKVCLESGMDGFXXXXXXXXXXXXXXAQYCSKKEKQRE 1154
            ADDSNIK CLESGM+GF               ++C+  + +++
Sbjct: 1177 ADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQGKKK 1219

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score = 1131 bits (2926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1147 (54%), Positives = 784/1147 (68%), Gaps = 74/1147 (6%)

Query: 15   RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74
            +E+F+PPF + +RTQL  LV  + ++SL I+ VTTGVYFT+NYKS+R+ERL VAAQLKSS
Sbjct: 8    KEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSS 67

Query: 75   QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134
            Q+DQNLNYLYYQ YWLS++ TLQ +L N+ +GN +  NW  +   L+KFL SS LFS AR
Sbjct: 68   QIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVAR 127

Query: 135  VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194
            VYD  F TV+N+TNNG+GD + ++VLA+L PLS    L +SL + G++TDPV N T+YL+
Sbjct: 128  VYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLM 187

Query: 195  SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254
            SMSLP+  NPSIIL  + + GY+T+I SA+SLK+V +D  AL+KSSV+I+SA++  +  L
Sbjct: 188  SMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGL 247

Query: 255  TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314
              Y FVF P+GT+      T+PI N +F++ A   GK GS  +T++   R  AVGYSP +
Sbjct: 248  GSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCS 307

Query: 315  FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374
            FK VNWVA+++Q E VF+ P+ RL KII G V  I  F+C+ TFP+AHWAVQPIVRLQKA
Sbjct: 308  FKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKA 367

Query: 375  TEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHNY 434
            TEIIT GR L+  +   +S S  +    R  S S+  +   L ++    G  S   + NY
Sbjct: 368  TEIITEGRGLRSGTPGSSSVSRNSSFIRRRFSGSSSVRSPSLADEKGAVGRASTEGSFNY 427

Query: 435  NVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVEA 494
            +   PS   +  +S+           D TR                   +Y+ S+NLVEA
Sbjct: 428  DQAVPSLNSNAEISS-----------DRTR-------------------KYMTSSNLVEA 457

Query: 495  YVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAKT 554
             VPVYR FF DE SELTDTFNTMT+ LD+HYALLE+RVRARTKQLEAAK++AE+ANEAKT
Sbjct: 458  RVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKT 517

Query: 555  VFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSKN 614
            VFIANISHELRTPLNGILGMTAI+M E D+ K+Q+SLKLIFRSG            FSKN
Sbjct: 518  VFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKN 577

Query: 615  VLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQI 674
            VL+RTKLE+RDFS+ D+A+QIKSIFGK+AKDQ VK SI L PN IR +VL+GDSNRIIQI
Sbjct: 578  VLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQI 637

Query: 675  VMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNLTST 734
            VMNLVSNALKFTPVDGKV VR++LLGEYD +RSE+ D++ V+V+ G+E  +         
Sbjct: 638  VMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRE--------- 688

Query: 735  TPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSI-------V 787
                               DG   P  K  E    +E E  +E ++ +E+S        +
Sbjct: 689  -------------------DGLIPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTNL 729

Query: 788  LXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTW 847
                             L       YDD IFH+QFKK    T S  +EN    L+ PK W
Sbjct: 730  DDKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKK---HTSSSGDENGHL-LEHPKNW 785

Query: 848  VISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLD 907
             IS+EVEDTG GIDPSL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTMKLD
Sbjct: 786  AISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLD 845

Query: 908  SKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKI---NSSRKSVQT 964
            SK+GVGSKF FT+PL QT+EI F+  E  FEDEFN  S+KNRKVKFK+     SRKS  +
Sbjct: 846  SKLGVGSKFTFTLPLTQTREIEFED-ENAFEDEFNPLSKKNRKVKFKVAKSIKSRKSKSS 904

Query: 965  KKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRH 1024
              + S   G SD +  + K S S E SVGNV +DRPFLQSTGTA+S+++++ V++    +
Sbjct: 905  LSNSSGKGGSSDKSSKQLKGSES-EFSVGNVSLDRPFLQSTGTASSSKNVTVVSNVNKSY 963

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
            R+LVAEDN+VNQEVIKRML LEG+  +D+A DGQ+A++KV+ + + GE Y +IFMDVQMP
Sbjct: 964  RILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMP 1023

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFXXXXXXXXXXXXXXAQ 1144
            +VDGLLATKMIR DL Y+ PIVALTA+ADDSNI+VCLE+GM+GF              AQ
Sbjct: 1024 KVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQ 1083

Query: 1145 YCSKKEK 1151
            YC    K
Sbjct: 1084 YCHDDSK 1090

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score = 1125 bits (2911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1131 (54%), Positives = 792/1131 (70%), Gaps = 59/1131 (5%)

Query: 12   KALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQL 71
            ++ R+ F PP+ + +R QL  LV  + ++SL I+ VTTGVYFT NYK +R+ RL +AA+L
Sbjct: 3    QSWRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKL 62

Query: 72   KSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFS 131
            KSSQ+DQ LNYL+YQ  +L++RDTLQ+AL+N+ AGN + +NW  +E+ ++KFL SS LF 
Sbjct: 63   KSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFY 122

Query: 132  AARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTN 191
             AR+YD +F  V+N+TNNG+GD IP  VL+ELFPLS  + L SSL   GI+TDPV N + 
Sbjct: 123  VARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSI 182

Query: 192  YLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSN 251
            YL+SMSLP+ TNPSIIL+++ + GYIT++ SA+ LK V  +  AL+ S+V+++SA+++  
Sbjct: 183  YLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQ 242

Query: 252  SSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYS 311
              + G+HFVF       FS+ + +PI+NGT+++ A   GK GS+ KT     R +A+GYS
Sbjct: 243  GKVDGFHFVFEVEN-DDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYS 301

Query: 312  PPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRL 371
            P +F L NWVA+VTQPE VFLSP+ +L KII+GTV AIAVF+CL+TFP++HWAV+PIVRL
Sbjct: 302  PCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRL 361

Query: 372  QKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLN 431
            QKATE+I+ GR LK  SN  N DS++   + R    S+    + +F      G  SN L 
Sbjct: 362  QKATELISQGRGLKPTSNFSNGDSSSTSDNWRESVESHVRASLGIFKSLRNNG--SNELQ 419

Query: 432  HNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNL 491
             N         D   ++ R+S+           ++T  +   S++ SS + +RY  S NL
Sbjct: 420  SN--------DDMNEINERSSKN----------NSTGDNIKSSDNDSSSSFQRYTTS-NL 460

Query: 492  VEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANE 551
            V+A VPVY RF QDELSELTDTFN MT+ LD+HY LLE+RVRARTKQLEAAKI+AE+ANE
Sbjct: 461  VQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANE 520

Query: 552  AKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXXXXF 611
            AKTVFIANISHELRTPLNGILGMTAI+M E D  K++ +LKLIFRSG            F
Sbjct: 521  AKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTF 580

Query: 612  SKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRI 671
            SKNVLKRT LE+RDF + +IALQIKSIFGK+A+DQHVKL I L PN IR++VLWGDSNRI
Sbjct: 581  SKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRI 640

Query: 672  IQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNL 731
            IQIVMNLVSNALKFTP+DGKVDVRIKLLGEYD +RS + DY+EV++  G+E       N 
Sbjct: 641  IQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIG---NG 697

Query: 732  TSTTPMRLPFN--SSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLX 789
              T  +R      S    +   T    +  +  +K   + +E E     +DN++++    
Sbjct: 698  KKTDMVRKKIQELSEKDCIEGDTASSGSHMSGSSKIDKL-IEDEEKNSFSDNEDTN---- 752

Query: 790  XXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFR-DLKVPKTWV 848
                        +  +       YDDA    QFKK   + D D +E T   +L  PKTWV
Sbjct: 753  --------NDIEILSMTTSSTRSYDDAALQRQFKK---TPDLDDKEETLGVELSEPKTWV 801

Query: 849  ISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDS 908
            IS+EVEDTG GI+P LQE+VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTMKL+S
Sbjct: 802  ISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLES 861

Query: 909  KVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKS- 967
             VGVGSKFIFTVPL+QT+EI FD  +++FEDEFN  S+KNR++KFKI  S KS  +    
Sbjct: 862  TVGVGSKFIFTVPLKQTREIHFD--DEKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDED 919

Query: 968  ----KSSIDGHSDNNVSERKASNSTE-NSVGNVRVDRPFLQSTGTATSTRSISSVASEVT 1022
                KSS D  S NN  E K  N T  ++   VR+DRPFLQSTGTATS++ I ++ ++  
Sbjct: 920  EEGIKSSRDIDSSNN--EHKDENGTSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKED 977

Query: 1023 RH-----RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMI 1077
             +     R+LVAEDN+VNQEVIKRML LE + ++D+ACDGQ+A++KV+ +  N E Y +I
Sbjct: 978  TNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDII 1037

Query: 1078 FMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGF 1128
            FMDVQMP+VDGL++TKMIR DL YK PIVALTA+A+D NIK CL++GMDGF
Sbjct: 1038 FMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGF 1088

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score = 1125 bits (2911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/1230 (52%), Positives = 812/1230 (66%), Gaps = 110/1230 (8%)

Query: 15   RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74
            +  FTPPF +G+R QL  LV  + ++SL I+ VTTGVYFT+NYK++R++RL +AAQLKSS
Sbjct: 8    KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 75   QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134
            Q+DQ LNYLYYQ Y+L++RD LQ +L +F AGN S DNW  +   ++KFL SS LF  A+
Sbjct: 68   QIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAK 127

Query: 135  VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194
            VYD+SF TV+N+TNNG+GD IPE+VL  LFPLS   PL SSL TTGI+TDPV N T+YL+
Sbjct: 128  VYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLM 187

Query: 195  SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254
            SMSLP+  NPSIIL  + + GYIT+I SAE LK+V NDT AL+KS+V+I+SA++++    
Sbjct: 188  SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKA 247

Query: 255  TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314
            +GYHF+FPP+GT+S  ++  F IKN TFI+ AF NGK GS+ +TN    +N+A+GYSP +
Sbjct: 248  SGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPCS 307

Query: 315  FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374
            F+LVNWVAVV+QPE VFLSP  +L KII GTV AI VF+ LLT P+AHWAVQPIVRLQKA
Sbjct: 308  FQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKA 367

Query: 375  TEIITSGRDLKHYS---------------------------NTGNSDSNTAITHSRTRST 407
            TE+IT GR L+  +                           NTG S S    T S +   
Sbjct: 368  TELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGESGS----TISASGHG 423

Query: 408  SNQNQVMKLFNKSVTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSAT 467
             + +     F+   T+ +  + +N       PS  D   +   N+       G L     
Sbjct: 424  GSGHGSGAAFS---TESSMKSAINLGNEKLLPSE-DEKKIPNNNTDAKVSMDGSLNHDLL 479

Query: 468  TGSTPFSNDSSSYTSERYIKST--NLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHY 525
              ++  +ND+   ++  +I +T  NL EA +P YRR F DELS+LT+TFNTMTD LD+HY
Sbjct: 480  APNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHY 539

Query: 526  ALLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQ 585
            ALLE+RVRARTKQLEAAKI+AE+ANEAKTVFIANISHELRTPLNGILGMTAI+M ETD+ 
Sbjct: 540  ALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVN 599

Query: 586  KVQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKD 645
            K++NSLKLIFRSG            FSKNVL+RTKLE+RDF + D+ALQIKSIFGK+AKD
Sbjct: 600  KIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKD 659

Query: 646  QHVKLSIALTPNFIRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSK 705
            Q V+LSI+L PN IRT+VLWGDSNRIIQIVMNLVSNALKFTPVDG VDVR+KLLGEYD  
Sbjct: 660  QRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKD 719

Query: 706  RSESVDYQEVFVVPGSEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKE 765
             SE   ++EV V  G+E  +  E     T    +P  SS+   +   +  +TS T+    
Sbjct: 720  LSEKKQFKEVHVKRGTEITEYSE----ETNKCDIPI-SSNHRKHVDLESTTTSITSNRDT 774

Query: 766  GSIQVE-SETSTEGNDNDESSIVLXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKK 824
              IQ E ++ +T  N+N     +              +S +       YDDAIF+SQF K
Sbjct: 775  SIIQEEITKRNTAANEN-----IYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNK 829

Query: 825  VLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYG 884
               S D D   N  + ++ PKTWVIS+EVEDTG GIDPSLQESVF PFVQGDQTLSRQYG
Sbjct: 830  APGS-DEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYG 888

Query: 885  GTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIH 944
            GTGLGLSICRQLA MM GTM+L+SKVGVGSKF FT+PL QTKEI F   +  FEDEFN  
Sbjct: 889  GTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPE 948

Query: 945  SRKNRKVKFKINSSRKSVQTKKSKSS---------------IDGHSDNNVSERKASNSTE 989
            SRKNR+VKF +  S KS Q+  S ++               I   ++N +   + SN   
Sbjct: 949  SRKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKR 1008

Query: 990  NSVGNV-RVD--------RPF----------------------------------LQSTG 1006
              V  + R++        +PF                                  LQSTG
Sbjct: 1009 EGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTG 1068

Query: 1007 TATSTRSISSVA---SEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEK 1063
            TATS+R++ ++       T  ++LV EDN+VNQEVIKRML LEG+ ++++ACDGQEA++K
Sbjct: 1069 TATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDK 1128

Query: 1064 VEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLES 1123
            V+E+   G +Y+MIFMDVQMP+VDGLL+TKMIR DL YK PIVALTA+ADDSNIK CLES
Sbjct: 1129 VKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLES 1188

Query: 1124 GMDGFXXXXXXXXXXXXXXAQYCSKKEKQR 1153
            GM+GF               ++C+  + ++
Sbjct: 1189 GMNGFLSKPIKRPKLKTILTEFCAAYQGKK 1218

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score = 1125 bits (2910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1176 (52%), Positives = 802/1176 (68%), Gaps = 87/1176 (7%)

Query: 15   RERF-TPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKS 73
            R RF  PPF +G+R QL  LV  +  LSL I+ VTTGVYFT+NYK++R++RL +AAQLKS
Sbjct: 10   RRRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKS 69

Query: 74   SQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAA 133
            SQ+DQNLNYLYYQ YWL++RDTLQ+AL ++ AGN + +NW  + + ++KFL SS LF  +
Sbjct: 70   SQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLS 129

Query: 134  RVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYL 193
            RVYD  F  V+N+TNNG+GD +PE++  +LFPLS   PL SSL+T G++TDPV N T+YL
Sbjct: 130  RVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYL 189

Query: 194  LSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSS 253
            +SMSLP+  NPSII +  ++ GYITV+ SAE L++V NDT AL+KS+V+I+SA + + + 
Sbjct: 190  MSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTK 249

Query: 254  LTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPP 313
            +  Y FVFPP+G S      TF + + +F+  AF+  K GS+ KT     +++A+GY P 
Sbjct: 250  IDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPC 309

Query: 314  TFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQK 373
            +F  VNWVAVV+Q E VFLSP+ +L KII+GTV  IAVF+ LLTFP+A WAV+PIVRLQK
Sbjct: 310  SFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQK 369

Query: 374  ATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHN 433
            ATE+I  GR L+       S S +  +  + +  ++ N + +L   S+++       NH 
Sbjct: 370  ATELIAEGRGLRPAGAGSGSRSGSRTSSMK-KDINDLNFISRL---SLSEK------NH- 418

Query: 434  YNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVE 493
                   R    S S  N  T      DL +++   + P  ND SS  S     STNL E
Sbjct: 419  -------RPAYDSASDSNYATDGSLSHDL-QTSQASNRPSDNDRSSSRSRFLTTSTNLNE 470

Query: 494  AYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAK 553
            A +P YRR F DELS+LT+TFN MTD LD+HYALLE+RVRARTKQLEAAKIQAE+ANEAK
Sbjct: 471  ARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAK 530

Query: 554  TVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSK 613
            TVFIANISHELRTPLNGILGMTAI+M ETD+ K++NSLKLIFRSG            FSK
Sbjct: 531  TVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSK 590

Query: 614  NVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQ 673
            NVLKRT LE+R+F + D+ALQIKSIFGK+AKDQHV+LSI+LTPN IRT+VLWGDSNRIIQ
Sbjct: 591  NVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQ 650

Query: 674  IVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNLTS 733
            IVMNLVSNALKFTPVDGKV+VRIKLLGEYD + +++ +++++  +  S+A+         
Sbjct: 651  IVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAH--------- 701

Query: 734  TTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLXXXXX 793
                + P +SS   V    K  STS  + +        +E  T   D+DE SI       
Sbjct: 702  ---QQHPVSSSPNGV--LVKHLSTSSDSNSNLSDSDKYNE-KTYDEDDDEHSIT------ 749

Query: 794  XXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEV 853
                    +S L       YD+A+F++QFKK     + D+ +    +L   KTWV ++EV
Sbjct: 750  NISDHSDDLSSLVSSSTSSYDNALFNTQFKKTPDLYE-DSNDGLGTELADQKTWVFAIEV 808

Query: 854  EDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVG 913
            EDTG GIDP L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKL+SKVGVG
Sbjct: 809  EDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVG 868

Query: 914  SKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSSID- 972
            SKF FTVPL+QT+ I FD  E  FEDEFN  S+KNR+VKFK   S +S+ +++S++S+D 
Sbjct: 869  SKFTFTVPLKQTRVIKFDEEEDLFEDEFNPESKKNRRVKFK--DSTRSLHSRRSRTSVDR 926

Query: 973  ------------GHSDN-NVSERKASNSTEN-------SVGN------------------ 994
                        GHS +  +SE K  +  ++        VG+                  
Sbjct: 927  ITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVGDENDSKASSSSSKSDNIKE 986

Query: 995  ----VRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTD 1050
                V +DRPFLQSTGTATS+R++ ++A    R ++LVAEDN+VNQEVIKRML LEG+ +
Sbjct: 987  KEEKVHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINN 1046

Query: 1051 LDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTA 1110
            +D+ACDGQ+A++KV+ +++  +SY MIFMD+QMP+VDGLL+TKMIR DL YKG IVALTA
Sbjct: 1047 IDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTA 1106

Query: 1111 YADDSNIKVCLESGMDGFXXXXXXXXXXXXXXAQYC 1146
            +ADDSNIK C+E+GM+GF               +YC
Sbjct: 1107 FADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYC 1142

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score = 1117 bits (2889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/1248 (51%), Positives = 799/1248 (64%), Gaps = 153/1248 (12%)

Query: 18   FTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVD 77
             TPPF +G+RTQL  LV  + + SL I+ VTTGVYFT+NYK++R++RL +AAQLKSSQ+D
Sbjct: 11   LTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70

Query: 78   QNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYD 137
            Q LNYLYYQ Y+L++RD LQ +L ++ AGN S DNW  +   ++KFL SS LF  A+VYD
Sbjct: 71   QTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYD 130

Query: 138  TSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMS 197
            +SFN V+N+TNNG+GD IPE+VL  LFPLS   PL SSL T GI+TDPV N T+YL+SMS
Sbjct: 131  SSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMS 190

Query: 198  LPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGY 257
            LP+  NPSIIL  + + GYIT+I SAE LK+V NDT AL+ S+++I+SAV++S    +GY
Sbjct: 191  LPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGY 250

Query: 258  HFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKL 317
            HFVFPP+G+ S   +  F IKN TFI+ AF NGK GS+ +TN++  RN A+GYSP +F L
Sbjct: 251  HFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNL 310

Query: 318  VNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEI 377
            VNWVA+V+QPE VFLSP  +L KII GTV AI VF+ LLT P+AHWAVQPIVRLQKATE+
Sbjct: 311  VNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATEL 370

Query: 378  ITSGRDLKHYS---------------------------NTGNSDSNTAITHSRTRSTS-- 408
            IT GR L+  +                           NT  + S T+++          
Sbjct: 371  ITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVSGHGGSGHGSG 430

Query: 409  ---NQNQVMKLFNKSVTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRS 465
               + N  MK    ++  G          N  P + TD+      +      GP  L  +
Sbjct: 431  AAFSANSSMK---SAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLGPHSLRHN 487

Query: 466  ATTGSTPFSNDSSSYTSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHY 525
             T        D SS  S     S NL EA +P YRR F DELS+LT+TFNTMTD LD+HY
Sbjct: 488  DT--------DRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHY 539

Query: 526  ALLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQ 585
            ALLEERVRARTKQLEAAKI+AE+ANEAKTVFIANISHELRTPLNGILGMTAI+M ETD+ 
Sbjct: 540  ALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVN 599

Query: 586  KVQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKD 645
            K++NSLKLIFRSG            FSKNVL+RTKLE+RDF + D+ALQIKSIFGK+AKD
Sbjct: 600  KIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKD 659

Query: 646  QHVKLSIALTPNFIRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSK 705
            Q V+LSI+L PN IRT+VLWGDSNRIIQIVMNLVSNALKFTPVDG VDVR+KLLGEYD +
Sbjct: 660  QRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKE 719

Query: 706  RSESVDYQEVFVVPGSEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKE 765
             SE   Y+EV++  G+E  ++ E                       T D    PT     
Sbjct: 720  LSEKKQYKEVYIKKGTEVTENLE-----------------------TTDKYDLPTLSNHR 756

Query: 766  GSIQVESETSTEGNDNDESSI--------------VLXXXXXXXXXXXXXMSILXXXXXX 811
             S+ +ES  ++ G++ D S+I              +              +S +      
Sbjct: 757  KSVDLESSATSLGSNRDTSTIQEEITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTS 816

Query: 812  XYDDAIFHSQFKKVLSSTDSDTEE--NTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVF 869
             YD+AIF+SQF K   +  SD EE  N  R ++ PKTWVIS+EVEDTG GIDPSLQESVF
Sbjct: 817  SYDNAIFNSQFNK---APGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVF 873

Query: 870  EPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIV 929
             PFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKL+SKVGVGSKF FT+PL QTKEI 
Sbjct: 874  HPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEIS 933

Query: 930  FDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSSIDGHSDNNVS--------- 980
            F   E  FEDEFN  SRKNR+VKF +    KS+++++S SS+   + N  S         
Sbjct: 934  FADMEFPFEDEFNPESRKNRRVKFSV---AKSIKSRQSTSSVATPATNRSSLTNDVLPEV 990

Query: 981  ERKASNSTENSVGNVRVDR------------------PFLQSTG---------------- 1006
              K  + T++ VGN  + R                  P +  TG                
Sbjct: 991  RSKGKHETKD-VGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSR 1049

Query: 1007 ----------------TATST--RSISSVASE---VTRHRVLVAEDNNVNQEVIKRMLQL 1045
                            T T+T  R+I +V  +    T  ++LV EDN+VNQEVIKRML L
Sbjct: 1050 HEGLGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNL 1109

Query: 1046 EGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPI 1105
            EG+ ++++ACDGQEA++KV+E+   GE+Y+MIFMDVQMP+VDGLL+TKMIR DL Y  PI
Sbjct: 1110 EGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPI 1169

Query: 1106 VALTAYADDSNIKVCLESGMDGFXXXXXXXXXXXXXXAQYCSKKEKQR 1153
            VALTA+ADDSNIK CLESGM+GF               ++C+  + ++
Sbjct: 1170 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKK 1217

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1132 (53%), Positives = 753/1132 (66%), Gaps = 68/1132 (6%)

Query: 11   LKALRERFT---PPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQV 67
            L  LR+R     PPF  GLRTQL ILVC I + SL I+  TTGVYFT+NY+++RA+RL V
Sbjct: 3    LGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHV 62

Query: 68   AAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSS 127
            AA+L SSQVDQ+L  LYYQ   LST+DT+Q+AL ++RAGN S +NW  A+  L  FL  S
Sbjct: 63   AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122

Query: 128  GLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVY 187
              F  A +YD  +  V++  NN +  ++ E  L  L PL   +   +  L   + T P Y
Sbjct: 123  KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-Y 181

Query: 188  NWTNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAV 247
            N T  L+SM+LPV    S I+    + G++T++ SA+ + AV NDT  L +S VSIL+ +
Sbjct: 182  NKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGI 238

Query: 248  FDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQE---- 303
             +   +L  Y FVFPP  T    ++  +PIKN +F+ DAF N     V  T+        
Sbjct: 239  PNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGAL 298

Query: 304  ----RNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFP 359
                + +AVGYS   F+ ++WVAVV+Q E VFLSP  +L KII GTV  +AVFMC++TF 
Sbjct: 299  GHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFI 358

Query: 360  IAHWAVQPIVRLQKATEIITSGRDLKHYSNTGNSDS-NTAITHSRTRSTSNQNQVMKLFN 418
            +A WAV+PIVRLQKATE I +GR L+ Y+++G S S NT+I  S +R  S+ +   +LF 
Sbjct: 359  LASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRG-SDHSLPRELFE 417

Query: 419  KSVTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSS 478
            K   K   S ++  N+     S   S S   R    I R          T +   S+   
Sbjct: 418  K---KHHVSPFVTENHAANSGS-CSSMSDHERYLHHIAR-----YHDGETSTNILSDHEK 468

Query: 479  SYTSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQ 538
              TS     +TN ++  VPVYRR F DELSELTDTFNTMTDELDR Y +LE+RVRARTKQ
Sbjct: 469  GSTS-----ATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQ 523

Query: 539  LEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSG 598
            LEAAKIQAE+ANEAKTVFIANI HELRTPLNGILGMTAIAMAE D +K+QNSLKLIFRSG
Sbjct: 524  LEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSG 583

Query: 599  XXXXXXXXXXXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNF 658
                        FSKNVLKRTKLEER FS++DIALQ+KSIFGKLAKDQHVKLSI L PN 
Sbjct: 584  ELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNA 643

Query: 659  IRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVV 718
            IRT+VLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKL+GEYDS RSE+ ++ EV+++
Sbjct: 644  IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYIL 703

Query: 719  PGSEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEG 778
            PG+E  +    N+ +              V    K     PT        + +SET    
Sbjct: 704  PGTEVTNSSVNNIPTV-------------VEEEEKACEEEPTADDTPERKKKDSETV--- 747

Query: 779  NDNDESSIVLXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEEN-- 836
            +D D  SI                          YDDA+ H+Q KK+ +  D +  +N  
Sbjct: 748  DDADAISI-------------------SSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNV 788

Query: 837  TFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQL 896
            T   L+ P++WVI +EV+DTG GI+PSL ESVF+PFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 789  TMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQL 848

Query: 897  AKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKIN 956
            A MMKGTMKL+SKVG GSKF FTVPLQQT  + F+  +  FEDEFNI S+KNRKVKF++N
Sbjct: 849  ATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLN 908

Query: 957  SSRKSVQTKKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISS 1016
             S KS + K + S+  G    +  E    + +E S G+VRVDRPFLQSTGTATSTRS+ +
Sbjct: 909  RSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPT 968

Query: 1017 VASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSM 1076
            ++S  +  R+LVAEDNNVNQEVIKRML LEG  ++D+ACDG++AY+KV  +++ GE Y +
Sbjct: 969  LSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDL 1028

Query: 1077 IFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGF 1128
            IFMDVQMPR+DGLL TK++R  L Y+ PIVALTA+ADDSNIK CLESGM+ F
Sbjct: 1029 IFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSF 1080

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1139 (53%), Positives = 770/1139 (67%), Gaps = 65/1139 (5%)

Query: 15   RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74
            +  F PP+  GL TQL ILVC I + SL I+ VTTGVYFTTNYKS+RA+RL VAAQL S+
Sbjct: 20   KHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSA 79

Query: 75   QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134
            Q++Q LN +YYQ YWLS+RD++Q+ALV+++ GN+S  N ++A++ L KFL SS       
Sbjct: 80   QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139

Query: 135  VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194
            +YD++FN V++ + N +G+ I +++L +L PLS   PL SS++  G++++PV+N +++ +
Sbjct: 140  LYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFM 199

Query: 195  SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254
            SMSLPVS   SI+   ++  GYIT++ SA+ + +V     AL+ S+VS+L+ V+D N+ L
Sbjct: 200  SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259

Query: 255  TGYHFVFPPHGTS-SFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPP 313
              Y  +FPP         ++ FPI N +F+ +AF N   GSV KTN   E N+AVGY+  
Sbjct: 260  NSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319

Query: 314  TFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQK 373
            +FKLVNWVAVV Q E VFLSP+ +L KII GTV  IA F+C++TF +A+WAV+PIVRLQK
Sbjct: 320  SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379

Query: 374  ATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHN 433
            ATE+I +GR L                    R +S  +      N+S +KG+PS  L   
Sbjct: 380  ATELIAAGRGL-----------------RSYRHSSRSSSRTTSINRSNSKGSPSPTLREG 422

Query: 434  YNVFPPSRTDSPSVSARNSQTIPRGPGDLTR--SATTGSTPFSNDSSSYTSER---YIKS 488
              +    R   PS        +   P  + R  S            SS+ SER   +  S
Sbjct: 423  DGL----RKTPPSPYTPMHSHVEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTS 478

Query: 489  TNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAES 548
             N +E  VPVYRR F DELSELTDTFN+MTDELDRHYALLE+RVRARTKQLEAAKIQAES
Sbjct: 479  ANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAES 538

Query: 549  ANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXX 608
            ANEAKT+FIANISHELRTPLNGILGMTAIAMAE DM+KVQNSLKLIFRSG          
Sbjct: 539  ANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTEL 598

Query: 609  XXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDS 668
              FSKN+LKR KLE+R+FS++D+ALQ+KSIFGKLAKDQ+VK SI L PN IR +VLWGDS
Sbjct: 599  LTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDS 658

Query: 669  NRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFE 728
            NRIIQIVMNLVSNALKFTPVDGKV +RIKLLGEYD + SE  +  EVF+  G+E +D+  
Sbjct: 659  NRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDE-- 716

Query: 729  FNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVL 788
                           +    +T T++   S + ++ + +I+   E + + +  D  S+V 
Sbjct: 717  ---------------TKNVFDTITEEKYVSCSGESTDDTIETGQEGAQKPDKADNISVV- 760

Query: 789  XXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEE-NTFRDLKVPKTW 847
                                    YDDAIFHS+FKK+ +  D D  + ++    +  K W
Sbjct: 761  ------------------SSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVW 802

Query: 848  VISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLD 907
            VIS+EVEDTG GIDPSLQESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MMKGTMKL 
Sbjct: 803  VISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLH 862

Query: 908  SKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKS 967
            S+VGVGSKFIFTVPL+QT  +     E  FEDEFN  S+ NR+VKFK+N   KS Q+  S
Sbjct: 863  SEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQSSLS 922

Query: 968  KSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRHRVL 1027
               I G  D+ ++     + +E SV +VRVDRPFLQSTGTATSTRSI +V S  +  +VL
Sbjct: 923  VPEISGVPDSPLNSM-GRSESELSVSSVRVDRPFLQSTGTATSTRSIPTVGSLESNFKVL 981

Query: 1028 VAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVD 1087
            VAEDNNVNQEVIKRMLQLEG+ D+++ACDG+EA EKV  +    + Y+++FMDVQMP++D
Sbjct: 982  VAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMD 1041

Query: 1088 GLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFXXXXXXXXXXXXXXAQYC 1146
            GL+AT+ IR +L Y  PIVALTA+ADDSNIKVCLESGMDGF               +YC
Sbjct: 1042 GLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYC 1100

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 1050 bits (2716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/1134 (51%), Positives = 775/1134 (68%), Gaps = 54/1134 (4%)

Query: 15   RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74
            ++ + PP+ + +R QL  LV  + ++SL I+ VT GVYFT NYK+++  RL +AAQLK+S
Sbjct: 6    KKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKAS 65

Query: 75   QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134
            Q+DQ LNYLYYQ Y+LS+ +TLQ++LV++ AGN S  NW  +   LEKFL SS LFS AR
Sbjct: 66   QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125

Query: 135  VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194
            +YDT+FN +IN+TNN SG+ +PE+V+ +LF LS    L SSL T GI TDPV N +N+L+
Sbjct: 126  LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185

Query: 195  SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254
            SMSLP+  NPSIIL+ + I GY++VI SAE LK+V NDT AL+ S V ++SA +   ++L
Sbjct: 186  SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNL 245

Query: 255  TGYHFVFP-PHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPP 313
              ++F+F   +  +     + + I N TF+ +   NGK G+V KTN       AVGYS  
Sbjct: 246  EYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSC 305

Query: 314  TFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQK 373
            +F LVNW+A+V QPE  F     +L +II+G V A+AVF+CLLTFP++HWAVQP++RLQK
Sbjct: 306  SFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQK 365

Query: 374  ATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHN 433
            ATE I  GR L+    T  S      + SR  S   +N +      S+  G  +N L+ +
Sbjct: 366  ATERIAEGRGLRPPQPTVGS------SVSRNSSIKWRNSLENHVRSSL--GFNANKLSDS 417

Query: 434  YNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVE 493
             ++   +  ++ S S   + +   G  + + S + G  P  +D  S +S++Y  S NL+E
Sbjct: 418  GSITANNFKNNTSSSNSITSSHIYGNNNSSHS-SMGINP--DDDLSSSSQKYKTSANLIE 474

Query: 494  AYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAK 553
            A VPVY R  QDELSELTDTFNTMTD LD+HY LLEERVRARTKQLEAAKIQAESANEAK
Sbjct: 475  ARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAK 534

Query: 554  TVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSK 613
            TVFIANISHELRTPLNGILGMTAI+M E D+ K++ +LKLIFRSG            FSK
Sbjct: 535  TVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTFSK 594

Query: 614  NVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQ 673
            NVL+RTKLE+RDF + ++ALQIKSIFGKLAKDQHVKLSI L PN +R+ VLWGDSNRIIQ
Sbjct: 595  NVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQ 654

Query: 674  IVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNLTS 733
            +VMNLVSNALKFTPVDG VDVRI LLGEYD +RS++ DY++V+V  G+E           
Sbjct: 655  VVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTE----------- 703

Query: 734  TTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLXXXXX 793
                 LP N S        ++   S  ++T+  + + E+ T ++ +  D S  +      
Sbjct: 704  -----LPLNISHLKTE---ENNDISRKSETELNNDENETHTISKDDTADSSIKIGNEDVE 755

Query: 794  XXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFR-DLKVPKTWVISME 852
                    M+ L       YDD       K+++ STD D +EN    +LK  KTWVIS+E
Sbjct: 756  ISEVDKMGMASLVTTSSKSYDDTAL---MKQLIKSTDLDDDENKLGVELKEQKTWVISVE 812

Query: 853  VEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGV 912
            V+DTGSGIDP LQESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+ MM GTM+L+S+VGV
Sbjct: 813  VKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGV 872

Query: 913  GSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKI--NSSRKSVQTKKS-KS 969
            GSKFIFT+PL+QT+EI     E  F DEFN  S+KNRKVKFK   +SS KS++T+ S  S
Sbjct: 873  GSKFIFTLPLKQTREISIPDDE-LFNDEFNAVSKKNRKVKFKFSGSSSAKSIKTRNSIGS 931

Query: 970  SIDG-HSDNNVSERKASNSTENSV--GNVRVDRPFLQSTGTATSTRSI------------ 1014
            S++  HS  ++    + +  E++V   +VR++RPFLQSTGTATST+++            
Sbjct: 932  SLNNRHSTTSIDSSSSDSDEEDNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSK 991

Query: 1015 SSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESY 1074
            + V +++    +LVAEDN+VNQEVIKRML+LEG+ ++D+A DGQ+A++K + + +N  +Y
Sbjct: 992  NKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNY 1051

Query: 1075 SMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGF 1128
             +IFMDVQMPR+DGL ATKMIR +L Y  PIVAL+A+  + N+K CL+ GM+ F
Sbjct: 1052 DIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDF 1105

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1017 (53%), Positives = 680/1017 (66%), Gaps = 90/1017 (8%)

Query: 20   PPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQN 79
            PPF +G+R QL  LV  +  +SL I+ +TTGVYFT NYK++R++RL +AAQLKSSQ+DQ 
Sbjct: 11   PPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQIDQT 70

Query: 80   LNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTS 139
            LNYLYYQ Y++S+RDTLQ AL N+ AGN S +NW  +   L+KFL SS LFS A+VYD S
Sbjct: 71   LNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYDAS 130

Query: 140  FNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLP 199
            F TV+N TNNG+GD IP+++LA+L PLS   PLSSSL TTGI+TDPV N + YL+SMSLP
Sbjct: 131  FTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMSLP 190

Query: 200  VSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHF 259
            +  NPS+IL  + + GY+TV+ SAE L+ V NDT AL+KS+V+I+SAV+++ S+LT Y F
Sbjct: 191  IFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAYRF 250

Query: 260  VFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVN 319
            VF P G  S+    T+ + NG+F++ A   GK GS+  T     +N+A+GYSP TF  VN
Sbjct: 251  VFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSFVN 310

Query: 320  WVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIIT 379
            WVAVV+Q E VFLSP+ +L KIIAGTV AI VF+ ++TFP+AHWAV+PIVRLQKATE+I+
Sbjct: 311  WVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATELIS 370

Query: 380  SGRDLKHYSNTGNSDSNTA------------ITHSRTRSTSNQNQVMKLFNKSVTKGTPS 427
             GR LK    + N DS +              +H R RS+++  Q           G   
Sbjct: 371  EGRGLK----STNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQY--------TGEKQ 418

Query: 428  NYLNHNY------NVFPPSRTDSP--------------------------------SVSA 449
             Y  H+Y      N+ P   + SP                                 +  
Sbjct: 419  IYPTHSYQHNTIRNMSPQRLSPSPLGLSINRHNHNNDINNNNNNNNNISPDNNLNLPLHG 478

Query: 450  RNSQT------IPR-GPGDLTRSATTG----STPFSNDSSSYTSERYIKSTNLVEAYVPV 498
             N Q+       PR G  +L RS++ G     T FS  S   T+     S NL+EA VP 
Sbjct: 479  NNFQSDSVSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTT-----SANLIEARVPD 533

Query: 499  YRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAKTVFIA 558
            YRR F DELS+LTDTFNTMTD LD+HYALLE+RVRARTKQLEAAKI+AE ANEAKTVFIA
Sbjct: 534  YRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIA 593

Query: 559  NISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKR 618
            NISHELRTPLNGILGMTAI+M ETD+ K+++SLKLIFRSG            FSKNVLKR
Sbjct: 594  NISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSGELLLHILTELLTFSKNVLKR 653

Query: 619  TKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQIVMNL 678
            T LE+RDF + D+ALQIKSIFGK+AKDQ VKLSI LTPN IRT+VL+GDSNRIIQIVMNL
Sbjct: 654  TTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNL 713

Query: 679  VSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSE----ANDDFEFNLTST 734
            VSNALKFTPVDGKV+V++KL+GEYD   S   +++EV+V  G+E    +N   + N +  
Sbjct: 714  VSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIEKTNESIP 773

Query: 735  TPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSI-QVESETSTEGNDNDESSIVLXXXXX 793
            +P     NSSS    T+ KD + S T+   E S   ++ E     +  +E++        
Sbjct: 774  SPKSENNNSSS---TTSGKDTTNSETSFEDEKSADDLDDEKIATKDAENENTDDTENLDE 830

Query: 794  XXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEV 853
                    +S L       YDDAIF+SQFKK     D D   +    ++ PKTWVI + V
Sbjct: 831  QTDSVCDNIS-LVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISV 889

Query: 854  EDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVG 913
            EDTG GID +LQESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKL S+VGVG
Sbjct: 890  EDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVG 949

Query: 914  SKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSS 970
            S F FTVPL+QT+EI FD  E  FEDEFN  SRKNRKVKFK+    +S+++KKS++S
Sbjct: 950  STFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL---ARSIRSKKSRAS 1003

 Score =  193 bits (490), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 118/159 (74%), Gaps = 8/159 (5%)

Query: 995  VRVDRPFLQSTGTATSTRSISSVASEVTRH-------RVLVAEDNNVNQEVIKRMLQLEG 1047
            V +DRPFLQSTGTATS+R++  V SE  +        ++LVAEDN+VNQEVIKRML LEG
Sbjct: 1094 VSLDRPFLQSTGTATSSRNVP-VLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEG 1152

Query: 1048 LTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVA 1107
            +  +D+ACDGQEA++KV+ + +  +SY++IFMDVQMP+VDGLL+TKMIR DL Y  PIVA
Sbjct: 1153 VNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVA 1212

Query: 1108 LTAYADDSNIKVCLESGMDGFXXXXXXXXXXXXXXAQYC 1146
            LTA+ADDSNIK CLESGM+GF               +YC
Sbjct: 1213 LTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYC 1251

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1068

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1131 (45%), Positives = 710/1131 (62%), Gaps = 100/1131 (8%)

Query: 10   SLKALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAA 69
            +LK LR   +PP+ + LR QLI L C + ++SL I++++TGVYFT NYKS+RAE+L +AA
Sbjct: 2    NLKNLRLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAA 61

Query: 70   QLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGL 129
            QLKSSQ+DQ+LNYLYYQ  W    D L DAL+ + +GN + +NW  +  S+  FL SS +
Sbjct: 62   QLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSI 121

Query: 130  FSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNW 189
            FS A +YDT+F  + N +NNG+G +IP++++ +L PLS  E L +S+ T G +TDPV N 
Sbjct: 122  FSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNT 181

Query: 190  TNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVF- 248
            +NYL+S+SLP+  NPSIIL+ + + GY+T+I  A S+ AV NDT AL+ S+V+I+SA + 
Sbjct: 182  SNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYR 241

Query: 249  DSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAV 308
            +S +   GYHFVFPP+G+ +    + +P+ N +F+ DAF     GSV  T       +AV
Sbjct: 242  NSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAV 301

Query: 309  GYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPI 368
            GYS  TF L NWVAVV+QPE VF S T++L KII+GTV  IA  +C +TF ++++ V+PI
Sbjct: 302  GYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPI 361

Query: 369  VRLQKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSN 428
            ++L++ATE+I+ GR L+ Y    N    T+  ++ TR+T + + +               
Sbjct: 362  IKLKQATELISRGRGLRPYYE--NLSDRTSQDNTSTRTTIDLSDL-------------DG 406

Query: 429  YLNHNYNVFPPSRTDSPSVSARNSQ------TIPRGPGDLTRSATTGSTPFSNDSSSYTS 482
            Y N      P    D  S S  N        T+ +  G  +RS             S TS
Sbjct: 407  YTNEKEKSLPTCTEDERSKSLSNIASKSIFTTLRKILGFSSRSGML----------SPTS 456

Query: 483  ERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAA 542
              +I + +     VPV+  +  DEL+EL +TFN M D LD H  LLEERV+ARTK+LEAA
Sbjct: 457  TNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAA 516

Query: 543  KIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXX 602
            KI AE+ NEAKTVFIANISHELRTPLNGILGMTAIA+ E D +K+Q SLKLI+RSG    
Sbjct: 517  KIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLL 576

Query: 603  XXXXXXXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTL 662
                    FSKNVL++TKLE+  F + DIALQIKSIFGK+AKDQ V  SI ++PN IRT+
Sbjct: 577  HILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTM 636

Query: 663  VLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSE 722
            V +GDSNRIIQ++MNLVSNALKFTP+DG VDVRIKLLGEYD ++S   +Y +V++  G+ 
Sbjct: 637  VFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTS 696

Query: 723  ANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDND 782
               D +   T     ++ F   S S++        +   KT     +++S+ ST  + ++
Sbjct: 697  FTGDNDAIPTEPISDKISFAGGSSSIHDYCSKTDENDNIKT-----EIKSDDSTISDYSE 751

Query: 783  ESSIVLXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFRDLK 842
            E+                                I  S +       ++         + 
Sbjct: 752  EN--------------------------------IMGSYY-------ENKNPGQELLGVP 772

Query: 843  VPK--TWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMM 900
            +PK   WVIS++VEDTG GI P+LQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +M
Sbjct: 773  IPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIM 832

Query: 901  KGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINS-SR 959
             GTM+LDS  G+GSKF FTVPL Q ++I+F   EK FEDEFN +S+KNRKV FK +  + 
Sbjct: 833  HGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTS 892

Query: 960  KSVQTKKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVAS 1019
            + + +K ++ + D +++          +T N+    +  +P             I+    
Sbjct: 893  RGIPSKAAEKNDDANTN--------GQTTLNAEAKSKTLKP-----------THITISED 933

Query: 1020 EVTRH--RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMI 1077
             + +H  +VL+ EDN VNQEVIKR+L+LE +  ++ A DGQEA + V++ +   + + +I
Sbjct: 934  NIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDII 993

Query: 1078 FMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGF 1128
            FMD+QMP VDG  AT++IRN+L Y  PIVALTA+ADDSN K C  SGM+ F
Sbjct: 994  FMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAF 1044

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/713 (56%), Positives = 523/713 (73%), Gaps = 15/713 (2%)

Query: 20  PPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQN 79
           PP+ + +RTQLI +V  + +LSL I+ VTTGVYFT++YK++RA RL +AAQLKSSQ+DQ 
Sbjct: 25  PPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQT 84

Query: 80  LNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTS 139
           L YLYYQ YW+STRDTLQD+L NF AGN S  NW S E  LEKFL SS  FSA +VYD +
Sbjct: 85  LTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDEN 144

Query: 140 FNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLP 199
           F+TV++ TNNG+G+ I  +VL +LFPLS   PLSSSL TTGI+TDPV N T+YL+SMSLP
Sbjct: 145 FDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSLP 204

Query: 200 VSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHF 259
           V  NPSIIL+T+ + GYIT+I +A+ L +V NDT A++KS+V+I+SAV+++ S L  YH 
Sbjct: 205 VFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYHL 264

Query: 260 VFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVN 319
             PP+G ++  + + F +KN +F+  A + GK GS+ KT+ +  + +AVGYSP +F+L N
Sbjct: 265 ALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELAN 324

Query: 320 WVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIIT 379
           WV+VV+Q E VF  P+ +L KIIAG V  I+VF+ L+T P+A++AV+PIVRL+KATEIIT
Sbjct: 325 WVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEIIT 384

Query: 380 SGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHNYNVFP- 438
            GR L+  +    S S T+   S  R  S +  ++    KS   G  SN LN N      
Sbjct: 385 EGRGLRPTTPGSGSVSRTS---SMRREKSPRTSIVS-SRKSTATGN-SNSLNENSASLSS 439

Query: 439 -PSRTDSPSVSARNSQTIPRGPGDLTR------SATTGSTPF--SNDSSSYTSERYIKST 489
            P    S +V   N   + R P ++ +      SA+T +T    SND  S  S+  I  T
Sbjct: 440 HPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLITFT 499

Query: 490 NLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESA 549
           NL EA VP+ R+ F DELS+LT+TFNTMTD LD HY LLE+RVRARTKQLEAAKIQAE+A
Sbjct: 500 NLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQAEAA 559

Query: 550 NEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXXX 609
           NEAKTVFIANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSG           
Sbjct: 560 NEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHILTELL 619

Query: 610 XFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSN 669
            FSKNVL+RTKLE+R+F + D+ALQ+KSIFGK+AKDQHV+LSI L+PN +RT+VL+GDSN
Sbjct: 620 TFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDSN 679

Query: 670 RIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSE 722
           RIIQ+VMNLVSNALKFTPVDGKV V+IKLLGEYD + S++  +++V+V  G+E
Sbjct: 680 RIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTE 732

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/719 (57%), Positives = 517/719 (71%), Gaps = 20/719 (2%)

Query: 15  RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74
           + +  PPF + +RTQL  LVC + +LSL I+ V TGVYFT+++KS+RAERL VA+QLK+S
Sbjct: 14  KRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKAS 73

Query: 75  QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134
           Q+DQNL YLYYQ Y+LSTRD LQ+AL  + AGN++ +NW  A  +L+KFLGSS LFS AR
Sbjct: 74  QIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133

Query: 135 VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194
           VYD+SF  V+N++NN SG+ +PE+VL +LFPLS    L SSL   G++TDPV N T YL+
Sbjct: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLM 193

Query: 195 SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254
           SMSLP+  NPSIIL+T+++ GYITV+ SAE LK V NDT AL+ SSV ++S V+D N  L
Sbjct: 194 SMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD-NREL 252

Query: 255 TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314
            GYH VFPP+G  S      + I N +F+ DAF+  K GS+  T+ +  + +A+GYSP +
Sbjct: 253 AGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCS 312

Query: 315 FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374
             LV WVA++TQPE  FL P+ RL +II GT  AIAV  C +TFP++HWAVQPIVRLQKA
Sbjct: 313 SDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKA 372

Query: 375 TEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTK-GTPSNYLNHN 433
           TEIIT+GR L+       SD N +  +S  RS++ ++    L   S+ + G+ +    H 
Sbjct: 373 TEIITAGRGLR-------SD-NGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHK 424

Query: 434 YNVFPPS------RTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIK 487
           Y   P S      + D   +     +           S T GS  FS   S+  SERYI 
Sbjct: 425 Y--IPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSL-FSEQRSA-RSERYIT 480

Query: 488 STNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAE 547
           STNL+EA VP Y R F DELSELT+TFNTMTDELDRHYALLE+RVRART+QLEAAKI+AE
Sbjct: 481 STNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540

Query: 548 SANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXX 607
            ANEAKTVFIANISHELRTPLNGILGMTAIAMAE DMQKV++SLKLIFRSG         
Sbjct: 541 GANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTE 600

Query: 608 XXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGD 667
              FSKNVLKRTKLEERDF+V +IALQ++SIFGKLAKDQHV L+I++ PN +RT+VLWGD
Sbjct: 601 LLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGD 660

Query: 668 SNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDD 726
           SNRI+QIVMNLVSNALKFTPVDG+V+V+  LLGEYD  ++ +  +    VVP  E+  +
Sbjct: 661 SNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKE 719

 Score =  394 bits (1013), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/335 (60%), Positives = 247/335 (73%), Gaps = 13/335 (3%)

Query: 813  YDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPF 872
            YDDAIFHS+ +K  S  + D      R L+ P+   I+MEV+DTG GI+P+LQESVFEPF
Sbjct: 837  YDDAIFHSRLRKGNSGENEDG-----RPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPF 891

Query: 873  VQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDG 932
            VQGDQTLSRQYGGTGLGLSICRQLA MM G+M LDSKVGVGSKF FTVPL QTKE+ F+ 
Sbjct: 892  VQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEE 951

Query: 933  AEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSSIDGHSDN-NVSERKASNSTENS 991
             E  FEDEFN  S+KNRKVKFK++ + K  ++  S S  +       VSE      +E S
Sbjct: 952  DENPFEDEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSGQNSSVGTPTVSE------SEVS 1005

Query: 992  VGNVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDL 1051
            VG+VRVDRPFLQSTGTA STRS+++  S   + +VLVAEDNNVNQEVIKRML LEGL D+
Sbjct: 1006 VGSVRVDRPFLQSTGTALSTRSVTTT-SVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDV 1064

Query: 1052 DMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAY 1111
            D+ACDGQ+A++KV+   + G+ Y +IFMDVQMPRVDGL AT+MIRN+L Y  PIVALTAY
Sbjct: 1065 DLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAY 1124

Query: 1112 ADDSNIKVCLESGMDGFXXXXXXXXXXXXXXAQYC 1146
            ADD NIK C+++GM+GF              ++YC
Sbjct: 1125 ADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYC 1159

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/726 (54%), Positives = 470/726 (64%), Gaps = 104/726 (14%)

Query: 489  TNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAES 548
            + ++E  VPVYRR F DELSELTDTFNTM+D LD+HYALLEERVRARTKQLEAAKI+AE+
Sbjct: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 549  ANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXXXXXXX 608
            ANEAKTVFIANISHELRTPLNGILGMTAI+M E D+  +++SLKLIFRSG          
Sbjct: 532  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 609  XXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDS 668
              FSKNVL+RTKLEERDF + D+ALQIKSIFGK+AKDQHVKLSI L PN IRTLVLWGDS
Sbjct: 592  LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 669  NRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFE 728
            NRIIQIVMNLVSNALKFTP+DGKV VR+ LLGEYD ++S++ DY+EVFV  G+E  +++ 
Sbjct: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711

Query: 729  FNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGND---NDESS 785
              L      +L    S+ S +   +                  +E   E ND   N+  S
Sbjct: 712  KILQKLNTEKLIATRSARSCDNEER-----------------HNELIGEKNDIISNNHQS 754

Query: 786  IVLXXXXXXXXXXXXXMSILXXXXXXXYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPK 845
                               L       YD+ +F+ QFKK+    D D EE    ++K PK
Sbjct: 755  SNTTFDISIHNRTRDDTLSLLSTSTSSYDETVFNDQFKKITGLQDHD-EERLGVEIKEPK 813

Query: 846  TWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMK 905
            TWVI +EVEDTG GI P+LQESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTM 
Sbjct: 814  TWVICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMV 873

Query: 906  LDSKVGVGSKFIFTVPLQQTKEIVFDGAE---KQFEDEFNIHSRKNRKVKFKINSS---- 958
            L+SKVG GSKF FTVPL QT+EIV    E   + F+DEFNI+S+KNRKVKF I SS    
Sbjct: 874  LESKVGSGSKFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAIPSSPGTT 933

Query: 959  --RKSVQTKKSKSSID----GHSDN-NVSERKASNSTE-NSVGNVRV------------- 997
                S++++KSK S++    G   N N +E  A NS + NS G +++             
Sbjct: 934  LANSSLKSRKSKGSLNSSFVGEIQNVNEAEEDAYNSKDINSSGELKIRHISTSTSNNNSI 993

Query: 998  ---DRPFLQSTGTATSTRSI--------SSVASEVTRHR--------------------- 1025
               DRPFLQSTGTATST  I        S+    VT                        
Sbjct: 994  PSLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVT 1053

Query: 1026 ------------------VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEI 1067
                              +LV EDN+VNQEVIKRML+LE L+++D+ACDG+EAY KV+EI
Sbjct: 1054 QNNSSIIIDEEEEDEGIRILVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEI 1113

Query: 1068 L-----KNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLE 1122
                  K    Y +IFMDVQMPR+DGL +TK+IR++L Y  PIVALTA+AD+SNIK CL+
Sbjct: 1114 TSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLD 1173

Query: 1123 SGMDGF 1128
             GMDGF
Sbjct: 1174 VGMDGF 1179

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/724 (48%), Positives = 484/724 (66%), Gaps = 44/724 (6%)

Query: 7   RRCSLKALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQ 66
           R C++   +     P+ V LRTQL  LVC + ++SL I+ ++TGVYFT NY+ +R ++L 
Sbjct: 3   RACNVSIWK----APYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLY 58

Query: 67  VAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGS 126
           +AA+LKSSQ+DQ +N LYYQ  WL+ RD ++ AL ++ AGN S +NW S  D L  FL S
Sbjct: 59  IAARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLES 118

Query: 127 SGLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPV 186
           S +F    +YD+ FN ++N TNN + D IP++VL+ L PLSG + L S L TTG++TDPV
Sbjct: 119 SVVFLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPV 178

Query: 187 YNWTNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSA 246
            N + YL+SMSLP+  NPS+ L+ + + GY+TV+ SAE+++AVVNDT AL+KS V+++S+
Sbjct: 179 LNDSTYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISS 238

Query: 247 VFDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNI 306
              + +S   YHFVFPPHG S       +P++N TF++DAF + + GS+ K+  +  + +
Sbjct: 239 TNTNGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAV 298

Query: 307 AVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQ 366
           A+GY P +F L NWV  V+QPE VF+S +I+L KIIAGTV AI VF+C++TFP++ W+VQ
Sbjct: 299 AIGYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQ 358

Query: 367 PIVRLQKATEIITSGRDLK--HYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKG 424
           PIVRLQKATE+I S RD    H SN+ +S  +T  ++ R++   + +    L+ + V K 
Sbjct: 359 PIVRLQKATEVI-SKRDGNEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLY-EDVEKY 416

Query: 425 TPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSER 484
           T     N +      S+ +    S+ NS  I      + ++      P         S R
Sbjct: 417 TEIGKANKSTESL--SKENITDYSSSNSSAIV-----MRKNLADFQVP--------ASRR 461

Query: 485 YIKS--TNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAA 542
           ++K   + L E Y     +   D L E              H  LLE RV+ RTKQLEAA
Sbjct: 462 FVKDELSELTETY-----KLMTDALDE--------------HSQLLEYRVKERTKQLEAA 502

Query: 543 KIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXX 602
           KI+AESANEAKTVFIAN++HELRTPLNGILGMTAIAM ETDM+++Q+SLKLI+RSG    
Sbjct: 503 KIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLL 562

Query: 603 XXXXXXXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTL 662
                   FSKNVLK+TKLE+  F V+D+ALQI+SIFGK++KDQHVKLSI + PN +R++
Sbjct: 563 HILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSM 622

Query: 663 VLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSE 722
           VLWGD NRI+Q++MNLVSNALKFTPVDGK+ V IKLLGEYD  RS + +Y++V++     
Sbjct: 623 VLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMKEIRN 682

Query: 723 ANDD 726
           +N D
Sbjct: 683 SNGD 686

 Score =  333 bits (853), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 227/335 (67%), Gaps = 14/335 (4%)

Query: 814  DDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFV 873
            ++ I+ ++FK    S   DT++     L   + WVIS+EVEDTG GI+PSLQ+SVFEPFV
Sbjct: 721  NNTIYSNKFKN--GSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFV 778

Query: 874  QGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGA 933
            QGDQTLSRQYGGTGLGLSICRQLA +M GTMKL+S+VGVGSKFIFTVPL QT+EI F+G 
Sbjct: 779  QGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGN 838

Query: 934  EKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSSIDGHSDNNVSERKASNSTENSVG 993
            E  FEDEFNI+S+KNR+VKF      + +  +  + +I+G+S   V   K +   +++  
Sbjct: 839  ELVFEDEFNINSKKNREVKF------QEITDEVDQVNIEGNSGVEVEPGKCTEPKKSTES 892

Query: 994  NVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDM 1053
              +   P      + +S    +S+  +V   ++L+ EDN VNQ V+ RML+LEG+ +  +
Sbjct: 893  ESQAVVP------SKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTI 946

Query: 1054 ACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYAD 1113
            ACDGQEA EK++EI   GE Y ++ MD+QMP+VDG+ ATK+IR +L Y  PIVALTA+AD
Sbjct: 947  ACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFAD 1006

Query: 1114 DSNIKVCLESGMDGFXXXXXXXXXXXXXXAQYCSK 1148
            DSNI+ C +SGMDGF               ++C K
Sbjct: 1007 DSNIQACYKSGMDGFLAKPIKREQLKGILTEFCPK 1041

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/721 (45%), Positives = 465/721 (64%), Gaps = 20/721 (2%)

Query: 8   RCSLKALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQV 67
           +  LK  ++   PP+   LR QL ILVC + ++SLT + + TGVYFTT+YK +   RL +
Sbjct: 7   KIKLKMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYI 66

Query: 68  AAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSS 127
           A+QLKSSQ+DQ LNYLYYQ YW+++R+T+Q  + +   G  +      ++  L+KF+G+S
Sbjct: 67  ASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTS 126

Query: 128 GLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLT-TGIVTDPV 186
            LF    +YD +  +++NSTNN SG N+  ++L+ L PLS        L+  TGI+TDP+
Sbjct: 127 DLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPI 186

Query: 187 YNWTNYLLSMSLPVS---TNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSI 243
            N T YL+SMSLP+S   +  + I N + I GY+TV+ SAESLK+V NDT  L  S+ ++
Sbjct: 187 LNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTAL 246

Query: 244 LSAVFDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQE 303
           LSA++ +++    +HFVFPP             IKNGTF   AF+  K GS  K  +V +
Sbjct: 247 LSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNK 306

Query: 304 RNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHW 363
           +N A+GY+P  F L  WVAVV  P+  F S + +L KII GTV  IAVF+ L++ P+++W
Sbjct: 307 KNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYW 366

Query: 364 AVQPIVRLQKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTK 423
           AVQPIVRLQ+A+E+IT  R L++ ++    DSN   T+      SN +     +   +  
Sbjct: 367 AVQPIVRLQRASELITKRRGLRNLNDDSFDDSNDDHTYD-----SNDDHT---YESKLIS 418

Query: 424 GTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSE 483
            TP+   N + N+      D  S   R          + T +  T +  F+    + +  
Sbjct: 419 STPT-LKNSDSNIH-----DEKSGRTRGDANSGTLNSNNTITNNTNNKDFNRLRRNVSVS 472

Query: 484 RYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAK 543
            ++  +   E  VPVYR+ F DEL+ELTDTFN M++ LD HYALLE+RV  RTKQLEAAK
Sbjct: 473 THVSLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAK 532

Query: 544 IQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGXXXXX 603
           +QAE+ANEAKTVFIANISHELRTPLNGILGMT+ ++ E D++K+++ LKLIFRSG     
Sbjct: 533 VQAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLN 592

Query: 604 XXXXXXXFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTP-NFIRTL 662
                  FSKNVL +TKLE R+F++++I  QIK+IF KL + Q VKL I L P  F+++L
Sbjct: 593 ILTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSL 652

Query: 663 VLWGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGS 721
           + +GDSNRI+Q++MNL+SNA+KFTP V+GKV+V + LLGEYD + S++ +Y +V + P +
Sbjct: 653 LFYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPST 712

Query: 722 E 722
           +
Sbjct: 713 Q 713

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score =  387 bits (995), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/365 (53%), Positives = 249/365 (68%), Gaps = 32/365 (8%)

Query: 813  YDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPF 872
            YDDA+F++QFKK     + D + N   +L  PKTWVI++EV+DTG GIDPSLQ+SVFEPF
Sbjct: 804  YDDAVFNNQFKKTPELYE-DEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPF 862

Query: 873  VQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDG 932
            VQGDQTLSRQYGGTGLGLSICRQLA MM GTM+L S+VGVGS F FTVPL QT+E+  + 
Sbjct: 863  VQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNE 922

Query: 933  AEKQFEDEFNIHSRKNRKVKFKINSSR------------------KSVQTKKSKSSI--- 971
             +  FEDEFN  SRKNR+VKFK+  S                    +VQ +K +  +   
Sbjct: 923  DDHPFEDEFNPASRKNRRVKFKLAKSLRSRKSRSSTTTFSTTNSLHNVQEEKEEDKLGDN 982

Query: 972  ----------DGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEV 1021
                      D H +   S  K +    + +G V +DRPFLQSTGTATSTR+I +V    
Sbjct: 983  EETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTIQTVPDAG 1042

Query: 1022 TRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDV 1081
             + ++LVAEDN+VNQEVIKRML LEG+ ++++A DGQ+A+ +V+ +++ GE + MIFMDV
Sbjct: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102

Query: 1082 QMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFXXXXXXXXXXXXX 1141
            QMP+VDGLL+TKMIRNDL Y  PIVALTA+ADDSNIK CLE+GM+GF             
Sbjct: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162

Query: 1142 XAQYC 1146
              +YC
Sbjct: 1163 LEEYC 1167

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (53%), Gaps = 9/115 (7%)

Query: 1013 SISSVASEVTR--HRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKN 1070
            S S  A+E  R  + VL+ ED+ V+ ++  + L+  G T +++  DG  A   +E     
Sbjct: 411  SQSPTATEELRKGYHVLLVEDDAVSIQLCSKFLRKSGCT-VEVVTDGLAAISILEAF--- 466

Query: 1071 GESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGM 1125
               Y ++ MD+ MP +DG  AT +IRN    + PI+A+T   +D ++   L+ GM
Sbjct: 467  --RYDLVLMDIVMPNLDGATATSIIRN-FDKETPIIAMTGNIEDQDLITYLQHGM 518

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%), Gaps = 7/101 (6%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ ED++V  ++  + L+  G + +++  DG  A E VE+       Y ++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 384

Query: 1086 VDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
            +DG  AT +IR+    + PI+A+T   +D ++   L+ GM+
Sbjct: 385  LDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMN 424

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 58/102 (56%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED++V  ++  + L+  G + +++  DG  A E VE+       Y ++ MD+ MP
Sbjct: 319  HVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKF-----QYDLVLMDIVMP 372

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT +IR+    + PI+A+T   +D ++   L+ GM+
Sbjct: 373  NLDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMN 413

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (54%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+ V+  +  + L+  G T +++  DG  A   +E+       Y ++ MD+ MP
Sbjct: 382  HVLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVMP 435

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT +IRN    + PI+A+T   +D ++   L+ GM+
Sbjct: 436  NLDGATATSIIRN-FDNQTPIIAMTGNIEDQDLITYLQHGMN 476

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (63%), Gaps = 6/74 (8%)

Query: 1023 RHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQ 1082
            R  VL+ EDN +NQ ++   L+  G++   +A DG EA EK +E    G+S+ +I MD+Q
Sbjct: 393  RINVLIVEDNAINQAILALFLRKNGIS-YKVAKDGVEAIEKWKE----GDSH-LILMDLQ 446

Query: 1083 MPRVDGLLATKMIR 1096
            +P + GL ATK IR
Sbjct: 447  LPLLSGLEATKKIR 460

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 57/102 (55%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED++V+ ++  + L+  G T + +  DG  A   +E+       Y ++ MD+ MP
Sbjct: 406  HVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEKF-----RYDLVLMDIVMP 459

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R+    + PI+A+T   +D ++   L+ GM+
Sbjct: 460  NLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLITYLQHGMN 500

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 57/102 (55%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+ ++ ++  + L+  G T +++  DG  A   +E+       Y ++ MD+ MP
Sbjct: 354  HVLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVMP 407

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT +IR+    + PI+A+T   +D ++   L+ GM+
Sbjct: 408  NLDGATATSIIRS-FDNQTPIIAMTGNIEDQDLITYLQHGMN 448

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+ ++ ++  + L+  G T + +  DG  A   +E        Y ++ MD+ MP
Sbjct: 404  HVLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLE-----NSRYDLVLMDIVMP 457

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT +IR+    + PI+A+T   DD ++   L+ GM+
Sbjct: 458  NLDGATATSIIRS-FDNQTPIIAMTGNIDDGDLITYLQHGMN 498

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 57/102 (55%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+ V  ++  + L+  G T +++  DG  A   +E+       Y ++ MD+ MP
Sbjct: 377  HVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEKF-----RYDLVLMDIVMP 430

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R+  ++  PI+A+T   +D ++   L+ GM+
Sbjct: 431  NLDGATATSIVRSFDIHT-PIIAMTGNIEDQDLITYLQHGMN 471

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 76/159 (47%), Gaps = 17/159 (10%)

Query: 976  DNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVN 1035
            D N S R  S   E     +   RP   ST   T T + ++      +  VL+ EDN +N
Sbjct: 431  DENTSRRPVSPLNEA----IEHTRPLRISTSGFTLTSATTTTEKVFPKINVLIVEDNVIN 486

Query: 1036 QEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMI 1095
            Q ++   L+   ++   +A +G+EA     E+ KNG    +IFMD+Q+P + G+ A K I
Sbjct: 487  QAILGGFLRKHKIS-YKVAKNGKEAV----EMWKNG-GLHLIFMDLQLPVLSGIDAAKQI 540

Query: 1096 RNDLLYKGP------IVALTAYADDSNIKVCLESGMDGF 1128
            R D   + P      IVALTA     + +  L SG + +
Sbjct: 541  R-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDY 578

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 56/102 (54%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+++  ++  + L   G T +++  DG  A   +E+       Y ++ MD+ MP
Sbjct: 306  HVLLVEDDSICIQLCSKFLMKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVMP 359

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R+    + PI+A+T   +D ++   L+ GM+
Sbjct: 360  NLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMN 400

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 56/102 (54%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED++V  ++  + L   G + +++  DG  A   +E+       Y ++ MD+ MP
Sbjct: 308  HVLLVEDDSVCIQLCSKFLLKYGCS-VEVVTDGLSAISTLEKF-----RYDLVLMDIVMP 361

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R+    + PI+A+T   +D ++   LE GM+
Sbjct: 362  NLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMN 402

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+ V  ++  + L+  G T +++  DG  A   +E+       Y ++ MD+ MP
Sbjct: 335  HVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVMP 388

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R+      PI+A+T   +D ++   L+ GM+
Sbjct: 389  NLDGATATSIVRS-FDNHTPIIAMTGNIEDQDLITYLQHGMN 429

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 56/102 (54%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED++V+ ++  + L+  G T + +  DG  A   +E+       + ++ MD+ MP
Sbjct: 383  HVLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAAISILEKF-----RFDLVLMDIVMP 436

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT +IRN    + PI+A+T   +  ++   L+ GM+
Sbjct: 437  NLDGATATSIIRN-FDNRTPIIAMTGSIEHQDLITYLQHGMN 477

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 58/102 (56%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED++V  ++  + L+  G + +++  DG  A   +E+     + + ++ MD+ MP
Sbjct: 330  HVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAISTLEK-----QRFDLVLMDIVMP 383

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R+    + PI+A+T   DD ++   L+ GM+
Sbjct: 384  NLDGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMN 424

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 73/153 (47%), Gaps = 14/153 (9%)

Query: 974  HSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNN 1033
            HS+NN +    + ST      V +  P L    + T     ++V      H VL+ ED+ 
Sbjct: 336  HSNNNTNNASPAAST------VSLQLPNLPDENSLTPNAQGTTVTLRKGFH-VLLVEDDA 388

Query: 1034 VNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATK 1093
            V+ ++  + L+  G T + +  DG  A   +E+       Y ++ MD+ MP +DG  AT 
Sbjct: 389  VSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATS 442

Query: 1094 MIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
            ++R     + PI+A+T    + ++   L+ GM+
Sbjct: 443  IVR-SFDNETPIIAMTGNIMNQDLITYLQHGMN 474

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 54/102 (52%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+ V  ++  + L+  G T + +  DG  A   +E        + ++ MD+ MP
Sbjct: 417  HVLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAISVLEN-----HRFDLVLMDIVMP 470

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++RN   Y  PI+A+T   +D ++   L+ GM+
Sbjct: 471  NLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMN 511

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+ V+ ++  + L+  G T + +  DG  A   +E+       Y ++ MD+ MP
Sbjct: 378  HVLLVEDDAVSIQLCSKFLRKYGCT-VQVVSDGLSAISTLEKY-----RYDLVLMDIVMP 431

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R     + PI+A+T    + ++   L+ GM+
Sbjct: 432  NLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMN 472

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+ V+ ++  + L+  G T + +  DG  A   +E+       Y ++ MD+ MP
Sbjct: 379  HVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVLMDIVMP 432

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R+    + PI+A+T    + ++   L+ GM+
Sbjct: 433  NLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMN 473

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+ V+ ++  + L+  G T + +  DG  A   +E+       Y ++ MD+ MP
Sbjct: 380  HVLLVEDDVVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVLMDIVMP 433

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R     + PI+A+T    + ++   L+ GM+
Sbjct: 434  NLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMN 474

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 7/101 (6%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ ED+ V+ ++  + L   G T + +  DG  A   +E+       + ++ MD+ MP 
Sbjct: 352  VLLVEDDEVSIQLCSKFLIKYGCT-VQVVTDGLAAISTLEKY-----RFDLVLMDIVMPN 405

Query: 1086 VDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
            +DG  AT +IRN    + PI+A+T   +  ++   L+ GM+
Sbjct: 406  LDGATATSIIRN-FDNETPIIAMTGSIEHQDLITYLQHGMN 445

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 12/89 (13%)

Query: 1015 SSVASEVTRHRV------LVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEIL 1068
            +SV S  TR RV      L+ EDN +NQ ++   L+   ++  ++A +G EA EK     
Sbjct: 494  ASVPSNQTRDRVFPKINVLIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWR--- 549

Query: 1069 KNGESYSMIFMDVQMPRVDGLLATKMIRN 1097
            K G    +I MD+Q+P + G+ A K IRN
Sbjct: 550  KGG--IHLILMDLQLPLLSGIDAAKQIRN 576

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084
             VL+ ED+++  ++  + L     T +++  DG  A   +E+       + ++ MD+ MP
Sbjct: 303  HVLLVEDDSICIQLCSKFLMKYACT-VEVVTDGLSAISTLEKF-----RFDLVLMDIVMP 356

Query: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMD 1126
             +DG  AT ++R+    + PI+A+T   +D ++   L+ GM+
Sbjct: 357  NLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMN 397

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 6/72 (8%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +GQEA      I K G    +IFMD+Q+P 
Sbjct: 506  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVN----IWKEG-GLHLIFMDLQLPV 559

Query: 1086 VDGLLATKMIRN 1097
            + G+ A K IR+
Sbjct: 560  LSGIEAAKQIRD 571

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 6/72 (8%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +GQEA      I K G    +IFMD+Q+P 
Sbjct: 488  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVN----IWKEG-GLHLIFMDLQLPV 541

Query: 1086 VDGLLATKMIRN 1097
            + G+ A K IR+
Sbjct: 542  LSGIEAAKQIRD 553

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 13/115 (11%)

Query: 989  ENSVGNVRVDRPFLQSTGTATSTRSISSVASE-VTRHRV------LVAEDNNVNQEVIKR 1041
            E  +G V    P +Q  G+     ++ SV +E +TR +V      LV EDN +NQ ++  
Sbjct: 364  EEEIGLVPPRDPIVQREGSPFILSAMESVTTESITRDKVFPKISVLVVEDNMINQAILSS 423

Query: 1042 MLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIR 1096
             L+   +    +A +G EA ++ +E         +I MD++MP + G+ A K IR
Sbjct: 424  FLRKHKI-HYKVAKNGVEAVDRWKE-----GGMHLILMDLEMPLLSGIDAAKEIR 472

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 6/78 (7%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +G+EA +K +E         +IFMD+Q+P 
Sbjct: 513  VLIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWKE-----GGLHLIFMDLQLPV 566

Query: 1086 VDGLLATKMIRNDLLYKG 1103
            + G+ A K IR    +KG
Sbjct: 567  LSGIDAAKEIREYEKHKG 584

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 6/72 (8%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +GQEA      I K G    +IFMD+Q+P 
Sbjct: 505  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVN----IWKEG-GLHLIFMDLQLPV 558

Query: 1086 VDGLLATKMIRN 1097
            + G+ A K IR+
Sbjct: 559  LSGIEAAKQIRD 570

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 6/72 (8%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ +++  L+   ++   +A +GQEA ++ +E         +IFMD+Q+P 
Sbjct: 503  VLIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWKE-----GGIDLIFMDLQLPV 556

Query: 1086 VDGLLATKMIRN 1097
              G+ A K IR+
Sbjct: 557  FSGMDAAKKIRD 568

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 34/131 (25%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++  ++A +G EA EK  +         +I MD+Q+P 
Sbjct: 551  VLIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWRQ-----GGIHLILMDLQLPL 604

Query: 1086 VDGLLATKMIRN-------------DL-------------LYKGP--IVALTAYADDSNI 1117
            + GL ATK IR+             DL              ++ P  IVALTA++  ++ 
Sbjct: 605  LSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHADR 664

Query: 1118 KVCLESGMDGF 1128
            +  L +G + +
Sbjct: 665  REALVAGCNDY 675

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 6/72 (8%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +GQEA      I K G    +IFMD+Q+P 
Sbjct: 495  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVN----IWKEG-GLHLIFMDLQLPV 548

Query: 1086 VDGLLATKMIRN 1097
            + G+ A K IR+
Sbjct: 549  LSGIEAAKQIRD 560

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 11/103 (10%)

Query: 996  RVDRPFLQSTGTATSTRSIS--SVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDM 1053
            R D PFL+S     +T SI+   V  +++   VLV EDN +NQ ++   L+   ++   +
Sbjct: 392  REDSPFLRSAMETFTTESITRDKVFPKIS---VLVVEDNMINQTILSSFLRKHKIS-YKV 447

Query: 1054 ACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIR 1096
            A +G EA ++ +E         +I MD++MP + G+ A K IR
Sbjct: 448  AKNGIEAVDRWKE-----GGMHLILMDLEMPLLSGIDAAKEIR 485

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 68/135 (50%), Gaps = 20/135 (14%)

Query: 1002 LQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAY 1061
            + + GT TST      A+   +  VL+ EDN +NQ ++   L+   ++   +A +G+EA 
Sbjct: 500  IPNNGTNTSTS-----ANVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAV 553

Query: 1062 EKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYK------GP--IVALTAYAD 1113
            +    I K G    +IFMD+Q+P + G+ A K IR D   K       P  IVALTA   
Sbjct: 554  D----IWKEG-GLHLIFMDLQLPVLSGIDAAKQIR-DCEKKRTASQNAPVIIVALTASNS 607

Query: 1114 DSNIKVCLESGMDGF 1128
              + +  L SG + +
Sbjct: 608  IEDKRKALISGCNDY 622

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +G+EA EK +E         +IFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWKE-----GGIHLIFMDLQLPV 526

Query: 1086 VDGLLATKMIRNDLLYKG 1103
            + G+ A K IR     KG
Sbjct: 527  MSGIDAAKEIRECEKLKG 544

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 6/71 (8%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +G+EA +K +E      +  +IFMD+Q+P 
Sbjct: 465  VLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWKE-----GNLHLIFMDLQLPV 518

Query: 1086 VDGLLATKMIR 1096
            + G+ A K IR
Sbjct: 519  LSGIEAAKKIR 529

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 59/122 (48%), Gaps = 25/122 (20%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +G+EA +    I K G    +IFMD+Q+P 
Sbjct: 547  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVD----IWKEG-GLHLIFMDLQLPV 600

Query: 1086 VDGLLATKMIR--------------NDLLY---KGP--IVALTAYADDSNIKVCLESGMD 1126
            + G+ A + IR              N L     K P  IVALTA     + +  L SG +
Sbjct: 601  LSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISGCN 660

Query: 1127 GF 1128
             +
Sbjct: 661  DY 662

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 6/72 (8%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +G+EA +K     K G    +I +D+Q+P 
Sbjct: 464  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGREAVDK----WKQG-GIHLILLDLQLPI 517

Query: 1086 VDGLLATKMIRN 1097
            + G+ ATK IRN
Sbjct: 518  LSGIEATKEIRN 529

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 6/72 (8%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   ++   +A +G+EA +    I K G    +IFMD+Q+P 
Sbjct: 672  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVD----IWKEG-GLHLIFMDLQLPV 725

Query: 1086 VDGLLATKMIRN 1097
            + G+ A + IR+
Sbjct: 726  LSGIEAARQIRD 737

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 6/95 (6%)

Query: 1002 LQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAY 1061
            L+ST      +  S+  +   R  +L+ EDN +NQ ++   L+   +    +A +G+EA 
Sbjct: 543  LKSTTNPVKPKMRSTSENIFPRINILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAV 601

Query: 1062 EKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIR 1096
            +K +E         +IFMD+Q+P + G  A K IR
Sbjct: 602  DKWKE-----GGIHLIFMDLQLPVLSGTDAAKEIR 631

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085
            VL+ EDN +NQ ++   L+   +    +A +GQEA +    + + G    +IFMD+Q+P 
Sbjct: 567  VLIVEDNVINQTILSSFLRKHKIF-YKVAKNGQEAID----VWREG-GIHLIFMDLQLPV 620

Query: 1086 VDGLLATKMIR 1096
            + G+ A K IR
Sbjct: 621  LSGIDAAKKIR 631

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 17/82 (20%)

Query: 849 ISMEVEDTGSGIDPSLQESVFE----------------PFVQGDQTLSRQYGGTGLGLSI 892
           + + + D G GIDP +++ VF+                 +V   Q + +   G G GL +
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEV-QNVAGMGFGLPM 383

Query: 893 CRQLAKMMKGTMKLDSKVGVGS 914
           C+   ++  GT+ + S  G G+
Sbjct: 384 CKAYLELFNGTLDIQSLWGWGT 405

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 849 ISMEVEDTGSGIDPSLQESVFE-------------PFVQGDQTLSR--QYGGTGLGLSIC 893
           +S+ V D G GI P  +  + +             P  Q +Q  +   +  G G GL +C
Sbjct: 301 LSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGFGLPLC 360

Query: 894 RQLAKMMKGTMKLDSKVGVGS 914
           R  A++  G++ + S  G+G+
Sbjct: 361 RMYAELFGGSLSIQSLWGLGT 381

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 45/103 (43%), Gaps = 15/103 (14%)

Query: 827 SSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYG-- 884
           S++D++T E       V K   + + + D G GI P +++ +F+       T ++  G  
Sbjct: 297 STSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMS 356

Query: 885 -------------GTGLGLSICRQLAKMMKGTMKLDSKVGVGS 914
                        G G GL +C+   +M  GT+ + S  G G+
Sbjct: 357 AYVIPGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGT 399

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 849 ISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 893
           + + + D G GI P +++ +FE      Q  ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 894 RQLAKMMKGTMKLDSKVGVGS 914
           +   +M  G++ + S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>TDEL0H02230 Chr8 complement(375714..377006) [1293 bp, 430 aa] {ON}
           Anc_7.222 YIL042C
          Length = 430

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 44/103 (42%), Gaps = 15/103 (14%)

Query: 827 SSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFV-----QGDQTLSR 881
           S++++D  E       V K   + + + D G GI P+++E +++        +   T + 
Sbjct: 312 STSENDLTEKPIEITIVRKDDEMQIRIRDYGGGISPAVEERMYDYSYSTVSEKAKDTGAE 371

Query: 882 QY----------GGTGLGLSICRQLAKMMKGTMKLDSKVGVGS 914
            Y           G G GL +C+    M  G + + S +G G+
Sbjct: 372 AYMIPGEDVNNVSGMGFGLPMCKAYIDMFDGGLDVQSLLGWGT 414

>NDAI0A07020 Chr1 complement(1601054..1602085) [1032 bp, 343 aa]
           {ON} Anc_3.105
          Length = 343

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 5/97 (5%)

Query: 366 QPIVRLQKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGT 425
           +P++    + E   +  DL+H S     D+N  + ++   +  N      + N  +  G 
Sbjct: 122 EPLLNSLHSIERALTIPDLEHGSQDFTYDNNKKLRNNGNLTIHN----FLIVNSVIFSGF 177

Query: 426 PSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDL 462
            S Y+ +  +  PP R  + SVS + S T+PR   DL
Sbjct: 178 LSWYIQYC-STLPPRRDTASSVSPKASTTVPRLEMDL 213

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,561,957
Number of extensions: 5035319
Number of successful extensions: 30930
Number of sequences better than 10.0: 307
Number of HSP's gapped: 32213
Number of HSP's successfully gapped: 334
Length of query: 1155
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1034
Effective length of database: 39,606,813
Effective search space: 40953444642
Effective search space used: 40953444642
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)