Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00594g5.702ON1748174886510.0
Ecym_40185.702ON1769173129700.0
SAKL0E14916g5.702ON1779172328830.0
AFR286W5.702ON1758173623590.0
KLTH0E01056g5.702ON1771173623030.0
Kwal_55.196975.702ON1760170722020.0
TDEL0B021905.702ON1810171021390.0
ZYRO0G06600g5.702ON1820168820600.0
Suva_11.3315.702ON1898174120020.0
Smik_11.3585.702ON1878174219310.0
Skud_11.3345.702ON1885174319110.0
YKR095W (MLP1)5.702ON1875174918960.0
NCAS0A032005.702ON1788152318070.0
CAGL0G02497g5.702ON1780175217970.0
NDAI0E050405.702ON1973174116170.0
TBLA0E017305.702ON1820142910351e-114
Skud_9.195.702ON168016449651e-105
YIL149C (MLP2)5.702ON167916739431e-103
Suva_9.395.702ON168216778963e-97
NCAS0G002305.702ON173515028795e-95
Smik_9.205.702ON168217558511e-91
KNAG0C065905.702ON165116407091e-74
KAFR0H002105.702ON145411085945e-61
KNAG0L021405.702ON160814825615e-57
NDAI0F002905.702ON15546295142e-51
Kpol_1043.705.702ON13214564712e-46
KAFR0D022205.702ON16744764589e-45
TPHA0E002305.702ON12847492904e-25
TPHA0D046105.702ON11832172233e-17
Kpol_2001.755.702ON10064881070.001
NCAS0G028302.215ON217104890.062
Suva_11.2481.288ON539168850.40
NCAS0B018008.604ON791209840.51
Kwal_47.166744.364ON64074830.67
AER045C4.238ON1292112792.0
TDEL0H034907.101ON1103163792.1
TPHA0G018508.630ON52954782.7
Ecym_34863.340ON100495783.2
CAGL0F01749g8.38ON469168773.5
NDAI0H031602.354ON136140723.7
YKR016W (FCJ1)1.288ON540172773.7
TBLA0A036205.414ON970272764.5
TBLA0E040608.604ON804177764.5
Kpol_495.20singletonON486115764.6
Kpol_1026.314.46ON1005120765.3
KLTH0H09658g1.285ON725123756.0
Suva_8.3088.708ON43752747.0
KLTH0B08316g2.16ON950164757.1
TDEL0D016201.295ON122379748.3
NDAI0A006901.134ON140249748.7
KLLA0D07326g8.653ON243142728.8
Smik_15.4428.708ON43749739.0
Skud_15.4258.708ON43749739.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00594g
         (1748 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...  3336   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...  1148   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...  1115   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   913   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   891   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   852   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   828   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   798   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   775   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   748   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   740   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   734   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   700   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   696   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   627   0.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   403   e-114
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   376   e-105
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   367   e-103
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   349   3e-97
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   343   5e-95
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   332   1e-91
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   277   1e-74
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   233   5e-61
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   220   5e-57
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   202   2e-51
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   186   2e-46
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   181   9e-45
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   116   4e-25
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    91   3e-17
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    46   0.001
NCAS0G02830 Chr7 complement(520473..521126) [654 bp, 217 aa] {ON...    39   0.062
Suva_11.248 Chr11 (453665..455284) [1620 bp, 539 aa] {ON} YKR016...    37   0.40 
NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {O...    37   0.51 
Kwal_47.16674 s47 complement(57126..59048) [1923 bp, 640 aa] {ON...    37   0.67 
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    35   2.0  
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    35   2.1  
TPHA0G01850 Chr7 complement(383439..385028) [1590 bp, 529 aa] {O...    35   2.7  
Ecym_3486 Chr3 complement(907305..910319) [3015 bp, 1004 aa] {ON...    35   3.2  
CAGL0F01749g Chr6 (172820..174229) [1410 bp, 469 aa] {ON} highly...    34   3.5  
NDAI0H03160 Chr8 complement(753702..754112) [411 bp, 136 aa] {ON...    32   3.7  
YKR016W Chr11 (469717..471339) [1623 bp, 540 aa] {ON}  FCJ1Mitoc...    34   3.7  
TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.4...    34   4.5  
TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8...    34   4.5  
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    34   4.6  
Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {...    34   5.3  
KLTH0H09658g Chr8 (831223..833400) [2178 bp, 725 aa] {ON} simila...    33   6.0  
Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON...    33   7.0  
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    33   7.1  
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    33   8.3  
NDAI0A00690 Chr1 (126791..130999) [4209 bp, 1402 aa] {ON} Anc_1....    33   8.7  
KLLA0D07326g Chr4 (625107..625838) [732 bp, 243 aa] {ON} similar...    32   8.8  
Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {...    33   9.0  
Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {...    33   9.4  

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score = 3336 bits (8651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1696/1748 (97%), Positives = 1696/1748 (97%)

Query: 1    MSVEPIASRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQS 60
            MSVEPIASRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQS
Sbjct: 1    MSVEPIASRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQS 60

Query: 61   ENKLESFKIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQK 120
            ENKLESFKIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQK
Sbjct: 61   ENKLESFKIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQK 120

Query: 121  ELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSK 180
            ELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSK
Sbjct: 121  ELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSK 180

Query: 181  SEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIAR 240
            SEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIAR
Sbjct: 181  SEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIAR 240

Query: 241  TSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLK 300
            TSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLK
Sbjct: 241  TSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLK 300

Query: 301  KEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDS 360
            KEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDS
Sbjct: 301  KEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDS 360

Query: 361  EVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNS 420
            EVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNS
Sbjct: 361  EVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNS 420

Query: 421  FKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQ 480
            FKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQ
Sbjct: 421  FKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQ 480

Query: 481  IQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQ 540
            IQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQ
Sbjct: 481  IQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQ 540

Query: 541  KNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILS 600
            KNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILS
Sbjct: 541  KNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILS 600

Query: 601  KERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENS 660
            KERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENS
Sbjct: 601  KERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENS 660

Query: 661  NLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDK 720
            NLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDK
Sbjct: 661  NLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDK 720

Query: 721  RTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQ 780
            RTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQ
Sbjct: 721  RTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQ 780

Query: 781  LQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQE 840
            LQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQE
Sbjct: 781  LQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQE 840

Query: 841  KIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLV 900
            KIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLV
Sbjct: 841  KIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLV 900

Query: 901  ETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENER 960
            ETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENER
Sbjct: 901  ETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENER 960

Query: 961  NQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKI 1020
            NQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKI
Sbjct: 961  NQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKI 1020

Query: 1021 AMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAM 1080
            AMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAM
Sbjct: 1021 AMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAM 1080

Query: 1081 ENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDSSDL 1140
            ENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDSSDL
Sbjct: 1081 ENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDSSDL 1140

Query: 1141 LISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQ 1200
            LISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQ
Sbjct: 1141 LISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQ 1200

Query: 1201 ENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIK 1260
            ENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIK
Sbjct: 1201 ENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIK 1260

Query: 1261 IKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVI 1320
            IKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVI
Sbjct: 1261 IKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVI 1320

Query: 1321 AEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELE 1380
            AEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELE
Sbjct: 1321 AEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELE 1380

Query: 1381 ERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVE 1440
            ERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVE
Sbjct: 1381 ERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVE 1440

Query: 1441 MLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRS 1500
            MLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRS
Sbjct: 1441 MLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRS 1500

Query: 1501 KFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDIDALKNEWEKEY 1560
            KFEAEKESAWNS                      TTVQSPSQPTLDIDIDALKNEWEKEY
Sbjct: 1501 KFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQSPSQPTLDIDIDALKNEWEKEY 1560

Query: 1561 EKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGND 1620
            EKQT             RIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGND
Sbjct: 1561 EKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGND 1620

Query: 1621 AITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKS 1680
            AITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKS
Sbjct: 1621 AITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKS 1680

Query: 1681 TIKPVENDTSNMSAAFQAPVXXXXXXXXXXXXXXXXXPNKRPIDDTATEQPEKRHKEPES 1740
            TIKPVENDTSNMSAAFQAPV                 PNKRPIDDTATEQPEKRHKEPES
Sbjct: 1681 TIKPVENDTSNMSAAFQAPVFGSHSTFTSPFSTSEISPNKRPIDDTATEQPEKRHKEPES 1740

Query: 1741 DTEDGQEA 1748
            DTEDGQEA
Sbjct: 1741 DTEDGQEA 1748

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score = 1148 bits (2970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/1731 (40%), Positives = 1125/1731 (64%), Gaps = 88/1731 (5%)

Query: 8    SRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESF 67
            S+VA FL+VD+  +Q+++  ++     K  +  K K++N+R++ ++D LK   E K+ +F
Sbjct: 16   SKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTF 75

Query: 68   KIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELADASK 127
            K  + +L   +   + E+   E+EK +L+   +Q++  +++L  ++E  +Q  E+  ++K
Sbjct: 76   KEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAK 135

Query: 128  QDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILRME 187
            QD+ + L EKI +L+++K + +    ANKELR+  ++ E  +Q  ++ ELR KSEI R+ 
Sbjct: 136  QDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLH 195

Query: 188  QEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLK 247
            QE+ L++ N DWL+ +L +K  QLN FRE T SELQ+   +V++++S+LE AR +N  LK
Sbjct: 196  QELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLK 255

Query: 248  QSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDATK 307
                 L  QL++KL E K++ D  N  K+E T+EMSLKQR+ID LE  + S+K +++   
Sbjct: 256  AKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAY 315

Query: 308  NNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTS-----NIKLEDSEV 362
             + + +  +  E+D+L++EL   K  L+A+++  IKL+ T++EL S      + + +S V
Sbjct: 316  QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNV 375

Query: 363  GNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFK 422
             +T+  S+  +S +PKL GD+G+LKKQLV E+RQK+EL+ QVE+FVVELEHKIP+LNSFK
Sbjct: 376  SDTSLDSK--ISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFK 433

Query: 423  ERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQ 482
            ER++MLERELN+VT+LLEST K RDQK+ +L+  K  + +YE+Q+ SL  QR DLAHQ+Q
Sbjct: 434  ERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQ 493

Query: 483  YLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKN 542
            YLL+  S++ +  GPL+ +E++FVK + +S++    SDTQGII++RLV+F+SV+ELQ KN
Sbjct: 494  YLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKN 553

Query: 543  SELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKE 602
            +ELL+TIR LAD+LE  E +++ +++ +E +TV+EAKE IL+L +H Q LE+QL I+SKE
Sbjct: 554  AELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKE 613

Query: 603  RDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENSNL 662
            RDA+K  +     G + P + TY S   D+ + +LE RL  + +++++N K  + E   L
Sbjct: 614  RDAFKLANSANKQGDSAPSS-TYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKAL 672

Query: 663  RKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDKRT 722
             K   E+++  E E++S+ LAE+RL L+QSTL L+K +  EL KRS DLQ +L KQD++T
Sbjct: 673  YKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKT 732

Query: 723  QETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQLQ 782
            Q T+D +I TKS LS++ S+L+IL SE+ F+ K++ ELK ENE  +KE+   K+L++QLQ
Sbjct: 733  QSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQLQ 792

Query: 783  TLQREREMLLKETQNSYKEKLRKLEIELSGSLE----RLEEIEKNTTGIASNKEHQYNWF 838
            TLQRER++LL+E Q +Y++ + KLE +L  + E    R  E E+      S    QY WF
Sbjct: 793  TLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTS----QYKWF 848

Query: 839  QEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQN 898
            Q K+D L  +    + TL+EK   ++ +Q      +AKL+EAE R QSY++L+N DD  +
Sbjct: 849  QAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITD 908

Query: 899  LVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLEN 958
             +ETLR+ LEK N+ L+D+YSQIE +K++A+ S QS  E+S+A EE+Q   +K I  LE 
Sbjct: 909  KIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQ 968

Query: 959  ERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEE 1018
            ER  L   + +LNDQ+KDLN+E+ HQKS+ Q+E++  ++++S LQ  + S+D  K++YEE
Sbjct: 969  ERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEE 1028

Query: 1019 KIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQL 1078
            KI+ +Q+DL  Q  YAN++Q++YE ELQKHADV+KTI+ LR E+Q YKS++E  K  +  
Sbjct: 1029 KISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASE 1088

Query: 1079 AMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDN----- 1133
            A   L+ +E+ W +Q  + E +LS+ +QR +EL+TQN+LLYDQ+ELL+K    D+     
Sbjct: 1089 AKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDSEAAAS 1148

Query: 1134 -SHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSE 1192
             S +S +L+++LRRERD+LETKL+V++ E+ +L+QRL +AK+E+E++  + S+ + ++ +
Sbjct: 1149 MSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATAPD 1208

Query: 1193 SAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSI 1252
            S    E QE IM++L+QL+LLRESNVTLR+E+  + ++  + ++++ +  ++L PL+S +
Sbjct: 1209 SIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLESQL 1268

Query: 1253 SSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTT 1312
             SL   I  ++Q++   KEE+ RWK RSQDILHKYERIDP EH KL +E+ ++KNEL+  
Sbjct: 1269 KSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKNELE-- 1326

Query: 1313 KDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKC 1372
            K +L+++     + + +F+++R QA +RL+  K  +  + SE   ++ AK+Q+EA+L + 
Sbjct: 1327 KKSLENL-----ESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQT 1381

Query: 1373 KTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENAS------KTEQNNA 1426
                 ELE +L     E        N +   L+E+L  ++     A+      K E  ++
Sbjct: 1382 LDKVSELESKLSSSANEK-------NGEADSLKEELEELRANFIEANEAVADIKAEAASS 1434

Query: 1427 DSDEK--IKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFE 1484
            + D K  I+ LTE ++ L S+I+  E EA N+      + +P    D   IV+N+K +FE
Sbjct: 1435 EKDLKNQIQELTEKIKTLESEIEHSELEAKNS------NDSP----DFAPIVENMKKKFE 1484

Query: 1485 AEKEQLIKDKEKELRSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQS-PSQP 1543
             EK+ LI++K++ELR K E                               + V+S P+ P
Sbjct: 1485 EEKQVLIQEKDEELRMKLE------------EIQKQYEEERERELSELKASLVESTPNAP 1532

Query: 1544 TLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFE 1603
               ID + LK++ E EYEK+T             RIRLP++++I++++E R+  L++ FE
Sbjct: 1533 L--IDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFE 1590

Query: 1604 EKVNEKAQKLAGE-----IGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGK 1658
             +V  +A +L  E     +G+ A  +++H+ E+    D +  +F+  LA +++K+FEEGK
Sbjct: 1591 LRVRARALELFKENPESFVGDTAKLIKEHQEEM----DKLEAKFDEQLALVRKKAFEEGK 1646

Query: 1659 QQVSLKLKFLESKIRNLEQQKSTIK---------PVENDTSNMSAAFQAPV 1700
            QQ+ +K+K LESKI  LE Q + I          P++N+ +N S     P+
Sbjct: 1647 QQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKIPIDNN-NNSSPQGAQPI 1696

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 1115 bits (2883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1723 (40%), Positives = 1117/1723 (64%), Gaps = 77/1723 (4%)

Query: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69
            ++ FL++D   +  ++  V+ ++  K     + K++NL+ + TLD+LKS SE + E+FK+
Sbjct: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80

Query: 70   HISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELADASKQD 129
             + ++ +  E  + E+  FE+EK +LI+  +  +K +  L+ ++   +QQ E+  +SKQD
Sbjct: 81   QLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQD 140

Query: 130  IAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILRMEQE 189
            + + LNEKI +L +++ +  +     K LR++V+  E E+QT ++ +LR K+E+ R+ QE
Sbjct: 141  VVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQE 200

Query: 190  ITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLKQS 249
            + LL+ NN WL  +L +K+ +   +R+   SELQ +  +++++ SELEI R+S+Q LK  
Sbjct: 201  MNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIERSSSQTLKSR 260

Query: 250  VHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDATKN- 308
             + L +QL+ K++E K ++D  +  KQE T+EM+LKQR+ID LEK +ES K E+++ +N 
Sbjct: 261  ANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESARNK 320

Query: 309  NMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSE--VGNTT 366
            ++ +S   + ER+++IEEL   K +L+ SES  +KL+ET+DEL S     D E   GNT+
Sbjct: 321  SVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDELLST----DGERGAGNTS 376

Query: 367  -ASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKERS 425
              S +   S++PKL+GD+G+LKK+L+ E+RQK++L+ QVEAFV+ELEHK+PVLNSFKER+
Sbjct: 377  KVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERT 436

Query: 426  EMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLL 485
            EMLE+EL++V ++LE+T KD+++K  +L  +K+ +  YETQI SL +QR DLAHQ+Q+LL
Sbjct: 437  EMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLL 496

Query: 486  VNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSEL 545
            +  S++++  GPL+ EE  F+K + NS E     D Q II++RLV F S+VELQ+KN EL
Sbjct: 497  IQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQEKNMEL 556

Query: 546  LSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERDA 605
            L++IRNLAD+LE  E E+KS+ + +E ETV+EAKE ILTL ++ ++LE+QL I++KERDA
Sbjct: 557  LNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEIIAKERDA 616

Query: 606  YKALSVNASSGTNTPKAITYPSPDN------DDKVKDLETRLTAVIQEAENNAKEWSSEN 659
            +K L+ +  + +N P  +   S +N      ++K+K+LE  L+++ +E+  N K  + E 
Sbjct: 617  FKILASDKGT-SNGPSNVN--SSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEI 673

Query: 660  SNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQD 719
             +L +   + S+N E E++SR LAEDR  L+ +TLE++K + +EL+KR   LQ+ + KQD
Sbjct: 674  HSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENILKQD 733

Query: 720  KRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIA 779
             +TQ+T++SLI  KS LS++QS+L+  +SE+  +  +Q+ LK ENE  S+E    ++LI 
Sbjct: 734  SKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERNNMRILIT 793

Query: 780  QLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQ 839
            QLQTLQ ERE LL+ETQ +++ K  KLE ELS +LE+L+   K  +   S K+ Q  W+Q
Sbjct: 794  QLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQ 853

Query: 840  EKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNL 899
            EK D+L  E    +  L  K   +Q ++  +   + KL+E+EAR Q++  L+  +  ++ 
Sbjct: 854  EKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQ 913

Query: 900  VETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENE 959
             ETLRQELEK  ++L+D+YSQ+E +K++A+ S +S   +  A E+++ E  + I TL  E
Sbjct: 914  TETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKE 973

Query: 960  RNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEK 1019
            R+  +  V IL DQ+ +LNNE+ HQKS+++++ +     +  L+  +  +D  KA+YE+K
Sbjct: 974  RDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEYEQK 1033

Query: 1020 IAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLA 1079
            I+ IQ+DL  QT YAN +Q++YE ELQKHADVSK I+ LR EAQ YKS+ ETL+  ++ A
Sbjct: 1034 ISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAAENA 1093

Query: 1080 MENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDN------ 1133
             + L+ SE  W +Q ++YED+L +  QR+++L+ Q+K+LYDQI+ L+K +   +      
Sbjct: 1094 KKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPI 1153

Query: 1134 SHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSES 1193
            S ++ +LL SLRRE+D+LETKLEV+  E+ VL+Q+L + +S++E    +LS+++ ++S +
Sbjct: 1154 STETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAASGN 1213

Query: 1194 AHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSIS 1253
            +  L+ QE IM +L+QL+LLRESN+TLR+E     +    LK++L     ++ PL+S ++
Sbjct: 1214 SATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVT 1273

Query: 1254 SLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTK 1313
             LQN ++ K+ ++    EEAERWK RSQDILHKYERIDPEEH KL +++++++ E+++  
Sbjct: 1274 LLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKS 1333

Query: 1314 DTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCK 1373
            D       E ++ +++F+R++ QA ++LNA+K  + +L+S++N +   K ++E DLG  K
Sbjct: 1334 D-------ENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQK 1386

Query: 1374 TACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQM-ENASKTEQNNADS---- 1428
               K LE ++  +       E+  +S+ + LQE L + Q ++ E  +K EQ  + S    
Sbjct: 1387 EEVKNLESKITDI-------EKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLE 1439

Query: 1429 ---DEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEA 1485
               +E+I+SL   +++L   +++ + E+ N     +E     + E+T  IV+NLK EFE 
Sbjct: 1440 KELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSE-----LVENTSKIVENLKIEFEE 1494

Query: 1486 EKEQLIKDKEKELRSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQSPSQPTL 1545
            EK ++I DKE ELR +FE EK S   +                         Q    P  
Sbjct: 1495 EKAKMISDKESELREQFEEEKASILEAKEQELREQ--------------LATQKLDPP-- 1538

Query: 1546 DIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFEEK 1605
             ++ID +K +WE+EYE++T             RIRLPT++KI+KIVE ++  LE  FE  
Sbjct: 1539 -VNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEAN 1597

Query: 1606 VNEKAQKLAGEIGNDAI----TLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQV 1661
            V +KA+++A             LEKH+ +L  LK  M+K+F+ D+A+IK+++FEEGKQQ 
Sbjct: 1598 VQKKAEEIAKSKSASNSNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQA 1657

Query: 1662 SLKLKFLESKIRNLEQQ----KSTIKPVENDTSNMSAAFQAPV 1700
            S+K  FLE KI  LE Q     S I P+ ND S+ + A   P 
Sbjct: 1658 SMKSTFLEKKIAKLETQIKAHDSAI-PI-NDNSSATPAESGPT 1698

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1736 (36%), Positives = 1031/1736 (59%), Gaps = 104/1736 (5%)

Query: 8    SRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESF 67
            SR+A  L ++Q  +Q +   ++  +  + +  R+ ++EN R+  ++   +S  E+ +E+ 
Sbjct: 19   SRLAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAENTRLKVSIGAAESACEHGVEAL 78

Query: 68   KIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELADASK 127
            +    QLA   E G  +R   E        G S V +R+   +Q++E   ++    D+++
Sbjct: 79   RERQQQLAA--EAGAQQRGQGEAGSAGRAGGPS-VPERV---QQQLEETERRVAAGDSAR 132

Query: 128  QDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILRME 187
            +D+A  L EKI +L +++ +L    G NKELR+  +  E  +Q+Q++  LR ++EI R++
Sbjct: 133  RDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQ 192

Query: 188  QEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLK 247
            QE+ L+R N +W T QLN K  QLN +RE T  E+Q +Q++++ +++ELE+   +   L+
Sbjct: 193  QELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALR 252

Query: 248  QSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDATK 307
                 L +QL+  L E K + D  +  KQE  +EM+LKQR+I+ L   + ++K++++   
Sbjct: 253  SKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAY 312

Query: 308  NNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDEL--TSNIK------LED 359
            +   +   ++ ER+ L+ +L   K +L+ S++N  +L++TI EL  T N++      +E 
Sbjct: 313  DVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEH 372

Query: 360  SEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLN 419
            + VG+ +  S      I  +YGDL  L+KQLV E+R K+EL++QVE+FVVELEHKIPVLN
Sbjct: 373  ANVGSPSGGS-----TISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLN 427

Query: 420  SFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAH 479
            SFK+R E LE++LN VT+LLE+T ++RD+K  Q+   K  V  YETQ+  L +QR DLA 
Sbjct: 428  SFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLAR 487

Query: 480  QIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQ 539
            Q+Q LL++ S++ +  GPL+AEE++FVK L + ++    SDTQ II++RLVEF+SVVELQ
Sbjct: 488  QVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQ 547

Query: 540  QKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVIL 599
            QKN+ELL+ IR LA +LE+ E + +S+++ LE  TV EAKE IL+L +H Q LE+QL  +
Sbjct: 548  QKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETV 607

Query: 600  SKERDAYKALSVNASSGTN----TPKAITYPSP-DNDDKVKDLETRLTAVIQEAENNAKE 654
            + ERD++K L    S G N     P       P +  D +  LE RL A+ +E+E +AK 
Sbjct: 608  TTERDSFKLL---VSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKM 664

Query: 655  WSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDI 714
             + E   L K   ++++  E E++SR LA+++L+L+Q +LEL K +  +LQ R+  LQ +
Sbjct: 665  LNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQAL 724

Query: 715  LTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEY 774
            L +QD R Q T++  +  KS L SI S+L+IL+SE+ F+ KV+ +LK ENE  +K++ + 
Sbjct: 725  LLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDS 784

Query: 775  KVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQ 834
            ++LI QL+T Q+ER+ L++ET+  Y+ ++ +L+ ELS + ++LE  ++    ++S+   Q
Sbjct: 785  QLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQ 844

Query: 835  YNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVD 894
              WFQ K+D L  E    K  L+ K ++L  +++ +N  ++KL+ A    Q  +++   D
Sbjct: 845  CKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESD 904

Query: 895  DAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTII 954
             A   V++L ++L++ N +LS +YS+IE +K  A  + +  +    A ++ +  S++  I
Sbjct: 905  HASR-VQSLSKDLDEANRKLSSAYSEIERYKA-ASNATERPSLSYNAVQDNKDGSKQAAI 962

Query: 955  TLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKA 1014
            +LE E  +L S + + ND++K L +E+  +++ Y TER+   E+I+ L   K+ ++  KA
Sbjct: 963  SLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKA 1022

Query: 1015 DYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKT 1074
            DY++KI  +Q DLE Q    NE++  Y+  LQK A++S+ I SLR  ++SYKS++   K+
Sbjct: 1023 DYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKS 1082

Query: 1075 QSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQI------ELLNKT 1128
             ++ A + L+ +E+ W++QK + E  L +  QR++ELSTQN+LLYDQI         +  
Sbjct: 1083 AAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSLE 1142

Query: 1129 EDRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKN 1188
             D   S D+ +L+++LRRERD+LETK++V+  E+ +L+QRL++ KSE+++L  QLS+ K 
Sbjct: 1143 PDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKG 1202

Query: 1189 SSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPL 1248
              +E     + QE + ++L+QL+LLRE N++LR+E+    +  + L++++    +++ P+
Sbjct: 1203 LVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPM 1262

Query: 1249 QSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNE 1308
            +  I SL   +  KEQ+L   KEE++RWK RSQDILHKYERIDPEE+ KL  EI  +K E
Sbjct: 1263 EEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAE 1322

Query: 1309 LQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEAD 1368
            L+          AE  D + +F+++R QA +RL+  K  +  + SE+      KSQ+EA 
Sbjct: 1323 LERKS-------AESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAK 1375

Query: 1369 LGKCKTACKELEERLQVVTQEAETKEQTFNSQL----SKLQEDLHSIQVQMENASKTEQN 1424
            L + +     LE   Q+  + A   +   + +L    +KLQ+  ++I     N  K+E +
Sbjct: 1376 LSEAREKITSLE--TQLTERPASEDDNPVSHELEETKTKLQDAENTI-----NMLKSEWS 1428

Query: 1425 NADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFE 1484
             ++   K K L E  + L + IQ+  A +S      + H  P       +++++ K + E
Sbjct: 1429 ISEESFK-KQLDELNKQLET-IQKNSAPSSGHSDPSSYHEQPT------AVLEDFKKQVE 1480

Query: 1485 AEKEQLIKDKEKEL-------RSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTV 1537
             E+  LI+  ++EL       R  F AEKE A                          +V
Sbjct: 1481 EERRTLIESHQQELTARLEASRKNFLAEKEKAL---------------EELRDSLTNVSV 1525

Query: 1538 QSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAV 1597
            ++ SQ     +++ALK +WE+EYE+QT             RIRLP++++I++++E ++  
Sbjct: 1526 EAASQ-----NLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKA 1580

Query: 1598 LEESFEEKVNEKAQKLAGE----IGNDAITLEK-HRAELNALKDSMRKQFEADLAEIKQK 1652
            LE+ F  KVN  A  L  E    I +D   L K H+ E+  LK  +  +FE  L ++K+K
Sbjct: 1581 LEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKK 1640

Query: 1653 SFEEGKQQVSLKLKFLESKIRNLEQQK--------STIKPVENDTSNMSAAFQAPV 1700
            +FEEG+QQ  +K+K LESKI  LE Q          T  P+EN       A Q PV
Sbjct: 1641 AFEEGRQQGIMKVKLLESKISKLESQAKAPLGTNVPTKIPLEN---TQPLAQQVPV 1693

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/1736 (36%), Positives = 1012/1736 (58%), Gaps = 123/1736 (7%)

Query: 13   FLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKIHIS 72
            FL ++   +  ++  V+  I  K  + ++ ++ENLR + T+D+L+S SE KL + K  + 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 73   QLAKALEDGKDERLHFEE-------EKRRLIEGNSQVTKRIIELEQEIEVERQQKELADA 125
             L + LE  + E   FE+       EK+R +  +  +  R   LEQ       QK+  ++
Sbjct: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQ-------QKQALES 134

Query: 126  SKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILR 185
            SK D+A  LNEKI ELSS K + ++    N+ LRQ+ ++ E+E +  ++ +L+ K+E+ R
Sbjct: 135  SKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHR 194

Query: 186  MEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQK 245
            + QE++L R N++WL +QL  K  + N +R +T S+L     K+  +E EL+ +  +N+ 
Sbjct: 195  LSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKS 254

Query: 246  LKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKK--EM 303
            L++    +   LE +L   K++ D  N  KQE T+EMSLK+R++D LE  ++SLK   E+
Sbjct: 255  LREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLEL 314

Query: 304  DATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVG 363
             +T    D   F+    + L EEL     +L+ SE    KL++T+ +L S     D E  
Sbjct: 315  RSTAGEGDDGSFSNP-LNALSEELAQKTQQLEESEFKVQKLEQTVQDLVST----DKESR 369

Query: 364  NTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKE 423
              +++ E   SV   LYGD+ +LK+Q++ EKRQK+ L+ QVEAFVVELE K+P+L+SFK+
Sbjct: 370  LKSSAHEYPASVTD-LYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKD 428

Query: 424  RSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQY 483
            R++MLE +L E   +LES  KD++  +  L   KA +  +E QI+ L++QR DLA Q+QY
Sbjct: 429  RNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQY 488

Query: 484  LLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNS 543
            LL+  S++S+  GPL+ EE+ FV+ +    +++   DTQ +I++RLVEFR +VELQ KNS
Sbjct: 489  LLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNS 548

Query: 544  ELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKER 603
            +LL TIRNLAD+LE  E ++K + + +E++ +REAKE I+TL +HAQ LE+++ +L+KER
Sbjct: 549  DLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKER 608

Query: 604  DAYKALSVNASSGTN-TPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENSNL 662
            DAYKA+  + ++G   T  A+         +V DLE  L    +EAE N K  +SE   L
Sbjct: 609  DAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQEL 668

Query: 663  RKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDKRT 722
             ++  ++++  E E+TS+ LAE+RL + Q +L+L+K++ EEL KR   +QD L KQD +T
Sbjct: 669  LRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKT 728

Query: 723  QETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQLQ 782
            QET+  LI+ +S L++++SEL    ++ + ++  QK+     E+ + E     +L+ QLQ
Sbjct: 729  QETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQLQ 788

Query: 783  TLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKI 842
            TLQ ER+ LL ET+ SYKEK+  LE+E S    +L   ++         + +  W+QEKI
Sbjct: 789  TLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKI 848

Query: 843  DKL-------TSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDD 895
            D L       TS+   Q  T  + E+Q + ++        +LKE E +AQSY +L+  DD
Sbjct: 849  DSLNETLKVVTSQLESQAQTTRDLESQKKLLE-------GRLKEVETKAQSYDVLNQTDD 901

Query: 896  AQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIIT 955
                 E LR ELEK  ++L D+YSQIE H++  + + ++++ ++ AFE  + E  K    
Sbjct: 902  VLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGN 961

Query: 956  LENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKAD 1015
            ++ + ++L   V  L  Q+ +LNNE+ HQK ++ +E+N    ++  LQ  +E+++  K  
Sbjct: 962  MKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEH 1021

Query: 1016 YEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQ 1075
            YE+++  + +DL  Q  +AN++Q +YE ELQ+HADVSKTI+ LR E+Q YK+    L++ 
Sbjct: 1022 YEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSS 1081

Query: 1076 SQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIEL--------LNK 1127
             +   + L  S+  W  QK EYE +L  L QR+++L+ QN LL DQ++L        L +
Sbjct: 1082 IEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQ 1141

Query: 1128 TEDRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVK 1187
            +E ++      +L+ SLRRERD+L+TKLEV+   +TV  ++L+  + E+     +LS ++
Sbjct: 1142 SEPQEKVR---ELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQ 1198

Query: 1188 NSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAP 1247
              SS+++ + ++   ++++L+QL+LLRESN+TLRSE     + C  L+ Q+      L P
Sbjct: 1199 ALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQP 1258

Query: 1248 LQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKN 1307
            L+S ++SL+  ++ K+ ++    EE  RWK RSQDIL K+ERIDPEEH KL EE++  K 
Sbjct: 1259 LESELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKA 1318

Query: 1308 ELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEA 1367
            EL    D       +  + E +FQR++ QAR+RL+A+K  + +LS E+ Q  EA+S +E 
Sbjct: 1319 ELAAKAD-------QNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMEL 1371

Query: 1368 DLGKCKTACKELEERLQVVTQEAE---TKEQTFNSQLSKLQ------EDLHSIQVQMENA 1418
             L K +   K L+E LQ V  EA+   T +    S L KL       +D+ S + Q+E A
Sbjct: 1372 QLRKEQDVNKALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKA 1431

Query: 1419 SKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDN 1478
             ++E       EK+KS  E +E    ++ E   E  + +++     T        S ++ 
Sbjct: 1432 LQSEL------EKVKSHAEELE---RRLDEARREVESLEEVKQGAFT------DSSELEK 1476

Query: 1479 LKTEFEAEKEQLIKDKEKELRSKFE---------AEKESAWNSXXXXXXXXXXXXXXXXX 1529
            +K + E     LI +KE E+RS +E          EKE   N                  
Sbjct: 1477 MKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYEKELEENGK---------------- 1520

Query: 1530 XXXXXTTVQSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDK 1589
                     +P      +DI+ LK +WE++YE++T             RIRLPT++KI+K
Sbjct: 1521 --------HTP------VDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINK 1566

Query: 1590 IVEARKAVLEESFEEKVNEKAQKLAGEIGNDAI---TLEKHRAELNALKDSMRKQFEADL 1646
            IVE RK+ LE+ FE K+ ++A +LA E    A     +++H+ E+  LK  + ++ + ++
Sbjct: 1567 IVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEM 1626

Query: 1647 AEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQ--KSTIKPVENDTSNMSAAFQAPV 1700
            A++++K+F+EGKQQ S+K  FLE KI  LE Q   S  + V +  ++ ++  + PV
Sbjct: 1627 AQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEKPV 1682

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1707 (34%), Positives = 1024/1707 (59%), Gaps = 122/1707 (7%)

Query: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69
            VA FL++D++ + +++  V  +I  K+ + ++ ++ENL+ + T+D+L+S S +KL + K 
Sbjct: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80

Query: 70   HISQLAKALEDGKDERLHFEE-------EKRRLIEGNSQVTKRIIELEQEIEVERQQKEL 122
             I  L + +E  + E L  E+       E++R I  +  +  R   LEQ       QK++
Sbjct: 81   QIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQ-------QKQV 133

Query: 123  ADASKQDIAESLNEKIEELSS----TKAKLNEAQGANKELRQKVVNTETELQTQQALELR 178
             +A+K D+A+ LNEKI ++++    T+  L EA    + LRQ+ +  E + +  ++ EL+
Sbjct: 134  LEANKNDVAQLLNEKIGDIATLQQETERLLQEA----RTLRQQNLELEGQARVYKSEELK 189

Query: 179  SKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEI 238
             K++  ++ Q+++LL  NN+WL +QLN K  + N +R+ T SEL     ++   E +L+ 
Sbjct: 190  HKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQA 249

Query: 239  ARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMES 298
            A  + + L++       +LE +    K++ DE   +KQE T+EMSLKQR+++ LE  + +
Sbjct: 250  ATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSA 309

Query: 299  LKKEMDATKNNMDSS--YFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIK 356
            LK E++  KN+  +S    T + + ++ +EL     +L+ SE    KL++T+++L S   
Sbjct: 310  LKSELEF-KNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLS--- 365

Query: 357  LEDSEVGNTTASSEKSVS---VIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEH 413
                       + EK++S    +P LY D+G+LKKQ++ E+RQK+ L+ QVEAFVVELE+
Sbjct: 366  -----------ADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELEN 414

Query: 414  KIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQ 473
            K+P+L+SFK+R+++LE+EL E   +L+S  KD+D+ ++ L   K+ ++  E+QI++L++Q
Sbjct: 415  KVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQ 474

Query: 474  RVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFR 533
            R DLA Q+QYLL+  +++ +  GPLSAEE  FVK + N +      D QGII++RLVEF+
Sbjct: 475  RSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFK 534

Query: 534  SVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLE 593
            ++VELQ KN++LL T+RNLA++LE  E + KS+ + +E++T+ EAKE I+TL DH Q LE
Sbjct: 535  NIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELE 594

Query: 594  NQLVILSKERDAYKAL-SVNASSGTNTP-KAITYPSPDNDD-KVKDLETRLTAVIQEAEN 650
             ++ ++++ERDAYKA+ S  +  G+N   + +   + +N D K+++LE  L+A  +EAE 
Sbjct: 595  TRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEA 654

Query: 651  NAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSD 710
            N K   +EN  L +   E+ +N E EK+SR LAE+RL + +S+L L+K++ EEL KR   
Sbjct: 655  NVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLV 714

Query: 711  LQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKE 770
            L++ L KQD RTQET+  LI  KS L+++ +EL    +++  +    ++LK  NE+ +KE
Sbjct: 715  LENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKE 774

Query: 771  SVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASN 830
              E  +L+ QLQTLQ+ER+ LLK++ +++K K+  LE E+S     L +     +   S 
Sbjct: 775  RNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMST 834

Query: 831  KEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTML 890
             + +  W+QEKID L        + L  K   +Q++QS  +  ++KL++AE ++QSY++L
Sbjct: 835  SDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVL 894

Query: 891  SNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQ 950
            +  DD     + LR ELEK  + L D++SQ++ +K L   + +++  ++ A E ++++  
Sbjct: 895  NQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHT 954

Query: 951  KTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQT---ERNATMEEISKLQMVKE 1007
              + TL+ ER+ L +   +L DQ+ +LN+E+ +QK+  +T   E N   EE+   +  K 
Sbjct: 955  IEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEV---KSNKT 1011

Query: 1008 SVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKS 1067
            ++   K  Y+ +++ + +DL  Q  YAN++Q +YE ELQ+HADVSKTI+ LR EAQ +K+
Sbjct: 1012 ALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKN 1071

Query: 1068 DLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNK 1127
             + +L+       ++L+ +E  W  QK EYE + S+  QR+++LSTQN+LL+DQI L   
Sbjct: 1072 KVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISL--- 1128

Query: 1128 TEDRDN-------SHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLN 1180
             +D D+         ++ +L+ +L+RE D+L+TKLE+A  +++ LKQ+L+  + E+    
Sbjct: 1129 -KDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAK 1187

Query: 1181 TQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQE 1240
            +++ + + +S   + ++E+   I+++L+Q++LLRESN+TLR+E     +   +L+  ++E
Sbjct: 1188 SEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEE 1247

Query: 1241 CNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKE 1300
              + L PL++ I +LQ  +  K++++    EE  RWK RSQDIL KYER+DPEEH KL E
Sbjct: 1248 LQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAE 1307

Query: 1301 EINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINE 1360
            E       L   +    +   ++ + E +FQR++ QAR+RL+ ++  + +L++E+ +  E
Sbjct: 1308 E-------LSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARE 1360

Query: 1361 AKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSK--LQEDLHSIQVQMENA 1418
            ++  +E  L K +   + L+E ++  T+E E +    NS  ++  LQ+ L   +++   A
Sbjct: 1361 SQKALEDALDKEREKTRSLQESIKA-TEENEIE----NSSATRDQLQDALQ--KLEDAQA 1413

Query: 1419 SKTEQNNADSDEKIKSLTETVEMLNSKIQELE---AEASNAQKIVAEHHTPVINEDTKSI 1475
               E + A S E+ ++L E +E     +++LE   A+  N  +++ E    V    T++ 
Sbjct: 1414 RINEMSTAPSQEE-QTLREELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQV--SGTEAE 1470

Query: 1476 VDNLKTEFEAEKEQLIKDKEKELRSKFE-------AEKESAWNSXXXXXXXXXXXXXXXX 1528
            +  +KTE      +L+ +KE E++ K+E       AE E +  S                
Sbjct: 1471 IARVKTELIDHSNKLLAEKEAEIKEKYEKQRLEDKAELEKSLAS---------------- 1514

Query: 1529 XXXXXXTTVQSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKID 1588
                        S+     DI+ LK EWE+EYE++T             RIRLPT++KI+
Sbjct: 1515 ------------SESLKSSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKIN 1562

Query: 1589 KIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAI---TLEKHRAELNALKDSMRKQFEAD 1645
            KI+E RK  L+E FE K+ ++  +LAGE    A     +++H+ E+  LK  M+++ + +
Sbjct: 1563 KIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEKLKADMKREMDEE 1622

Query: 1646 LAEIKQKSFEEGKQQVSLKLKFLESKI 1672
            +A+ K+K+F+EGKQQ S+K  FLE KI
Sbjct: 1623 VAQAKKKAFDEGKQQASMKSMFLEKKI 1649

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/1710 (35%), Positives = 1011/1710 (59%), Gaps = 93/1710 (5%)

Query: 6    IASRVADFLQV-DQQLIQDINNDVLGR-IEEKLEDLRKQKSENLRITATLDQLKSQSENK 63
            ++ R+A FL + D +L   + + VL   +  KL++    +S NLR+ AT+D+LK+   +K
Sbjct: 16   LSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSK 75

Query: 64   LESFKIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELA 123
            ++S K    +L +  +  K  R   EE+  +L +  +    ++  ++ E++   +QK + 
Sbjct: 76   VDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVL 135

Query: 124  DASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEI 183
             ++KQ++ + L EKI EL ++K +  E    NK LRQ+++ T+ E+QT +   L  KSE+
Sbjct: 136  KSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSEL 195

Query: 184  LRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSN 243
              ++Q++ +L ++N+WL  ++ +KT QL ++R+   +ELQ S  +V+ ++++ ++ ++S 
Sbjct: 196  EIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSR 255

Query: 244  QKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEM 303
            + L +    + + L+ KL E K++ DE N  KQE ++EMSLKQ+++D  ++ ++S K+E+
Sbjct: 256  EFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEEL 315

Query: 304  DATK---NNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDS 360
              T+   N+ ++      ++   +++L  V+ +L+ S    ++L+  ++E+     + DS
Sbjct: 316  RLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEV-----MGDS 370

Query: 361  EVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNS 420
            E  +  +++  S   IPKLYGD+G+LKKQL+ E+ QK+ L+ Q+E+FVVELE+K+PV+NS
Sbjct: 371  EEFDLDSTANVS---IPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINS 427

Query: 421  FKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQ 480
             KERS  LE+EL+++ +LLE T  ++++K+ +L+     +K  E    +L +QR DLA Q
Sbjct: 428  LKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQ 487

Query: 481  IQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQ 540
            +Q+LL N +++++  GPL+A+E+ F+K +  ++  +  SD+Q IIT+RLVEF+ +  LQ+
Sbjct: 488  VQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQE 547

Query: 541  KNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILS 600
            +N+ELL T R LAD LE  E  +  +I  LE +T+ EAKE I+TL +    +E+++  + 
Sbjct: 548  RNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIE 607

Query: 601  KERDAYKA-LSVNASSGTNTPKAITYP-SPDNDDKVKDLETRLTAVIQEAENNAKEWSSE 658
            KERDAYKA LS  + S  N   A     S +N + +K LE +L+ +  E   N +  + E
Sbjct: 608  KERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELLNQE 667

Query: 659  NSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQ 718
              NL +   +++++ E E++SRTLAEDRL LLQSTLE++K +  EL +RS +LQ IL+KQ
Sbjct: 668  IRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQ 727

Query: 719  DKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLI 778
            + R  ETV+  I  +S LS +++  + L +EK  +      L+ E ++ S E     +++
Sbjct: 728  EARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMV 787

Query: 779  AQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASN---KEHQY 835
             QLQTLQ ERE LLKE+Q S+K  + +LE++ S   E   EI      I ++   K  Q 
Sbjct: 788  TQLQTLQSERENLLKESQASHKAAIAQLEVQTS---ELKTEISSKDNEIKASEDAKRAQT 844

Query: 836  NWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDD 895
             WFQEKID+++S+A + +  L  K A + +++  +N+   K++E+++R  SY  L++  +
Sbjct: 845  KWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGN 904

Query: 896  AQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIIT 955
             +     LR++LEK  ++L  +YSQ E  K ++  + +++  +S  FEE  +  +     
Sbjct: 905  GETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEK 964

Query: 956  LENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKAD 1015
               E+ QL+  V+ L   +  LNNE   QK+  + E+N  ++++  L+  + S+ + K +
Sbjct: 965  YLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKE 1024

Query: 1016 YEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQ 1075
            Y++K+  +QKDLE QT YAN +Q++YE ELQKHA+VSK I+ LR+E QS +S+++ LK  
Sbjct: 1025 YDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKAS 1084

Query: 1076 SQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTE-DRDNS 1134
             Q A E L+N EK W  QKTE +  +  L+++V  +S+QNKLL+ Q+ELL+K+E + +N 
Sbjct: 1085 EQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENK 1144

Query: 1135 --HDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSE 1192
                SS+LLISLRRERD+LETKL V+  E+ +L Q+    + E+ +   +L +++ + S 
Sbjct: 1145 LLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSN 1204

Query: 1193 SAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSI 1252
             + + +Q E+IM++L+Q++LLRESNVTLR+  ++ +++  +L+S+L     ++ PL S +
Sbjct: 1205 HSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSEL 1264

Query: 1253 SSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTT 1312
            S  +  I+ K+Q +I   +EA+RWK RS DIL ++E+IDPEE+ KL+EEI+++K EL+  
Sbjct: 1265 SECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAK 1324

Query: 1313 KDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKC 1372
                     E  D   +F R++ QA ++LNASK  + +LS+E+N++   K+++E  L + 
Sbjct: 1325 S-------KENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKET 1377

Query: 1373 KTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQM-ENASKTEQNNADSDEK 1431
            +T    LE+ L     E+   E     +L    E    I+V++ E    +E   +  +E+
Sbjct: 1378 QTKVLNLEKLLTERDSESANNED-LRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEE 1436

Query: 1432 IKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLI 1491
            I SL E V +   K  +   E S                   ++V+++K  FE EK + I
Sbjct: 1437 INSLKEQVRIFKEKENDSTLEGSQG---------------LSNVVESMKKAFEEEKIKFI 1481

Query: 1492 KDKEKELRSKFEAEKE--SAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDI 1549
            ++K +E   KFE EK   S+ N                           SP++P    D+
Sbjct: 1482 QEKTEEYNKKFEEEKAKLSSENG--------------------------SPAEPVSAPDV 1515

Query: 1550 DALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEK 1609
            ++LK +WE+EYE  +             RIR+PT+++I K+++ RK  LEE F+ ++ E 
Sbjct: 1516 NSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKE- 1574

Query: 1610 AQKLAGEIGNDAITLEKHRAELNALKDSMRKQFEAD----LAEIKQKSFEEGKQQVSLKL 1665
               L  E G DA    K R EL   K  +  +FEA     LA  K+K+FEEGKQQ ++K 
Sbjct: 1575 -NNLQPE-GGDA----KEREEL---KKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKS 1625

Query: 1666 KFLESKIRNLEQQKSTIKPVENDTSNMSAA 1695
              LE KI  LE Q   +    N T   +AA
Sbjct: 1626 TLLERKISKLESQ---LNSSNNPTPEKAAA 1652

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1688 (34%), Positives = 994/1688 (58%), Gaps = 80/1688 (4%)

Query: 8    SRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESF 67
             +++ F  V +  +  I+  +L  +E K+ D  + KS+NLR+  T+D++K+ S  + E  
Sbjct: 24   GKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGL 83

Query: 68   KIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELADASK 127
            K  I  L K  +  + ER   +EE  +      ++   +  L++++    Q++E     K
Sbjct: 84   KNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDK 143

Query: 128  QDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILRME 187
            +++   L EKI+EL S + +  ++   +K LRQ+V+  ET +Q  ++ ELR +SEI  + 
Sbjct: 144  REVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTIT 203

Query: 188  QEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLK 247
            Q +T+L++N+ WL  ++ +KT QL   R     EL     +  + ++EL++ ++ NQ + 
Sbjct: 204  QRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVIT 263

Query: 248  QSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDAT- 306
                 L + L++KL E K++ D     KQE   EMS+KQ++ID LE  ++SL+ E++A+ 
Sbjct: 264  TKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASL 323

Query: 307  -KNNMD--SSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVG 363
             K+N++  +S     E ++LI+EL  +K   + SE   ++L+  + EL   I  +DS+  
Sbjct: 324  DKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQEL---IPGDDSQDD 380

Query: 364  NTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKE 423
                SS  S+        D+G+LKK+L+ E+ QK+ L+ QVE+F+VELE+KIPV+NSFKE
Sbjct: 381  INNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKE 440

Query: 424  RSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQY 483
            R+ MLE+ELN+V +LL+ T  +++++  + + L   VK  E+ I +L++QR DLAHQ+Q+
Sbjct: 441  RTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQF 500

Query: 484  LLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNS 543
            LL+N S++ + GG LSAEE+ F+K + N+ +    SD+Q +I++RLVEF ++  LQ+KN 
Sbjct: 501  LLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNM 560

Query: 544  ELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKER 603
            ELL T+R LA++LE  E +   +IQ  E++T++EAKE I++L D+  NLE+++ IL+KE 
Sbjct: 561  ELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKEC 620

Query: 604  DAYKALSV------NASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSS 657
            DA+KA+        N S   N  +     S D ++K++ LE RLT++  E+  N K  ++
Sbjct: 621  DAFKAICSRNGSDQNGSLSANGTQGNRNGSSD-EEKLRTLEARLTSLTVESSQNNKMLNN 679

Query: 658  ENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTK 717
            E   L +   +IS+  E E++S+TL E+RL L+Q TLEL++ + ++L KRS +LQ I  +
Sbjct: 680  EIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDR 739

Query: 718  QDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVL 777
            QD RT ETV+ LI   S L+ ++++++ L++EK+ +   ++  +    + S+E    +++
Sbjct: 740  QDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIM 799

Query: 778  IAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNW 837
            ++QLQTLQ ERE  LKE Q +YKE L  LE E + +  RL+   K    + ++K  Q  W
Sbjct: 800  VSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQW 859

Query: 838  FQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQ 897
            +Q+K+D + +E+   K  L+ K   +  ++S + +   +++E+EAR QSY +LS  +   
Sbjct: 860  YQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVET 919

Query: 898  NLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLE 957
            +   +LR+ELEK  + LSD+Y++I+ +K L   + +S+++++Q +   ++E Q  + TL+
Sbjct: 920  SPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQELQLQVETLQ 979

Query: 958  NERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYE 1017
            NE++QLQ  V  LN+ V  L   +       + E+N   ++I+ L+   +   + K +Y+
Sbjct: 980  NEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYD 1039

Query: 1018 EKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQ 1077
             +I  +Q+DLE Q  +AN +QR+YE ELQK ++VSKTI+ LR ++Q  +  +  LK   +
Sbjct: 1040 AQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEE 1099

Query: 1078 LAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDS 1137
               + L+ +EK W+ QK EYE +L    Q +++LSTQN LLYDQIEL +K    DNS   
Sbjct: 1100 QVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSK----DNSDGV 1155

Query: 1138 S-------DLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSS 1190
            +       ++L +LRRERD+L TKL V+  E+  L+  L   ++E++    QLSQ +   
Sbjct: 1156 NGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEI 1215

Query: 1191 SESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQS 1250
            +  + L+ Q E I+++L+QL+LLRESN+TLR+      K+   L+ +L +  +R+ PL+S
Sbjct: 1216 TTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLRERILPLES 1275

Query: 1251 SISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQ 1310
             +++L   +  K+Q+L   KEEA RWK RSQ+ILHK++RIDPE+H +LKE+++ ++ +L 
Sbjct: 1276 ELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLD 1335

Query: 1311 TTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLG 1370
             T         E  + + +F R++ QA ++LN+SK  + +LS+++N++ EAKS++E    
Sbjct: 1336 ETN-------KENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFE 1388

Query: 1371 KCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDE 1430
              +    EL+ERL     + ET E +   +LS   E  HS +++ +N S T Q N     
Sbjct: 1389 AEERKVHELQERLNAHGNDTETVE-SVQKELSDALE--HSRELE-QNLSATLQQNE---- 1440

Query: 1431 KIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQL 1490
                  E  + LN +I  L+ E  + ++  A      I+ED  ++V++++  FE EK   
Sbjct: 1441 ------EITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINF 1494

Query: 1491 IKDKEKELRSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDID 1550
            +K+K +EL+   E +     N                          +   QP   ++ +
Sbjct: 1495 LKEKTEELKKLEEEKHTLQVNGN------------------------EPQQQP---VNYE 1527

Query: 1551 ALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKA 1610
             +K +WE E E+               RIRLPT+++I ++VE +KA LEE +++K+ E  
Sbjct: 1528 EIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESK 1587

Query: 1611 QKLAGEIGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLES 1670
              L    GN++  L+K       L+  ++++FEA++  +K+K+FEEGKQQ ++K   LE 
Sbjct: 1588 SSLESSDGNNS-DLKKQ------LEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLER 1640

Query: 1671 KIRNLEQQ 1678
            KI  LE Q
Sbjct: 1641 KISKLESQ 1648

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1741 (33%), Positives = 985/1741 (56%), Gaps = 151/1741 (8%)

Query: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69
            +A F     + ++ I+ D++  + +KL    + KSEN++IT TLD+LK+ S  K+ S K 
Sbjct: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83

Query: 70   HISQLAKALEDGKDER----LHFE---EEKRRLIEGNSQVTKRIIELEQEIEVERQQKEL 122
             +  + +  ++ + ER      FE    EK  L      + +++ +L +E      +KE+
Sbjct: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEE------KKEI 137

Query: 123  ADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSE 182
              +S+Q   + L+E+++EL   KA  N +    K+LR  ++  ET+ QT  + +L SKS+
Sbjct: 138  Q-SSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQ 196

Query: 183  ILRMEQEITLLRENNDWLTNQLNTKTVQLNEFREST---ISELQDSQLKVSNMESELEIA 239
            + R  QE+ LL+ N DWL  +L++K  Q   +R+ T   ISE+++   ++ N   + ++ 
Sbjct: 197  LERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRN---DFQLE 253

Query: 240  RTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESL 299
            +T+N  L+Q  + L + L++KL + K + D  N  K++ + E++LKQR+ID LE  + ++
Sbjct: 254  KTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAV 313

Query: 300  KKEMDATKN------NMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTS 353
            K+E++ T+       N D S     E ++L+++L   K++L   E+ C++L    +E   
Sbjct: 314  KEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEE--- 370

Query: 354  NIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEH 413
                         A  E  + +  K  GD  +LKKQL+ EKR K+ L+ Q+E+F+VELEH
Sbjct: 371  -------------AGKEDGI-LTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEH 416

Query: 414  KIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQ 473
            K+P++NSFKER++ LE ELN   +LLE T  +++ K  +L      +  Y+ +I  LSKQ
Sbjct: 417  KVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQ 476

Query: 474  RVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKN-LTNSQEITKTSDTQGIITDRLVEF 532
            R+DL  QIQYLLV  S+ ++  GPL  EE++F++N L N    T  SD+Q I+T+RLVEF
Sbjct: 477  RLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEF 536

Query: 533  RSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNL 592
            R +++LQ+KNSELL   RNLAD+LE  E ++K+ ++ +E+ET+ EAKE ILTL      L
Sbjct: 537  RDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQL 596

Query: 593  ENQLVILSKERDAYKALSVNASSGTNTP--KAITYPSPDNDDKVKDLETRLTAVIQEAEN 650
            E+++  L KER+ +K  +++  +  N    + +T    + + + +DL+ R++ V +E+  
Sbjct: 597  ESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTE 656

Query: 651  NAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSD 710
            N    + E  +L      +S+    EK+SR LAE+R  LL +TL+L+K + ++L+KRS +
Sbjct: 657  NMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSIN 716

Query: 711  LQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKE 770
            LQ+ ++KQD +TQET++  +  KS LS+I++ELS LK E+    +++K LK E    S E
Sbjct: 717  LQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSE 776

Query: 771  SVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKN--TTGIA 828
                 +++ QLQTLQ+ERE LL ET+ S + K+  L+      L + E I K+     + 
Sbjct: 777  KTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQ-NAQNEL-KTEAIRKDQYIKQLE 834

Query: 829  SNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYT 888
             + + +  W+Q KI+ L  +     ++L EK+ ++++ Q  I     +++E + R  +Y 
Sbjct: 835  EDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYN 894

Query: 889  MLS-NVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQK 947
            +L  +++D     ++LR+ELEK  + L+D+YSQI+ +K L E + +S+ E+S   +E+ K
Sbjct: 895  VLDESIND-----DSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNK 949

Query: 948  ESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKE 1007
                 I  L +E+  L+  V++L +Q+ +LNNE+  Q    + E+    ++IS LQ   +
Sbjct: 950  AFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNK 1009

Query: 1008 SVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKS 1067
             ++  K +YE K++ IQKDL+ QT YAN +Q +YE ELQKHADVSKTI+ LR +  +YK 
Sbjct: 1010 EIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKG 1069

Query: 1068 DLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNK 1127
             +ETL        + LK +E  WN QK    ++L +   R+++LS+QNKLLYDQIEL   
Sbjct: 1070 QVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTT 1129

Query: 1128 TEDRDNSHDSS-----DLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQ 1182
            T ++     S      D+LI+LRRERD+L+TK+ VA  +  +L+Q++ +   E+++  T+
Sbjct: 1130 TGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTK 1189

Query: 1183 LSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECN 1242
            L   K  + + + +++Q + +M++L+QL+LLRESN TLR+E  S   +   L+S+L+   
Sbjct: 1190 LCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLR 1249

Query: 1243 DRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEI 1302
              +AP++S +++L+  I+ KEQE+  +KEE  RWK RSQDI+ K++++   ++ KL+ EI
Sbjct: 1250 GNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEI 1309

Query: 1303 NDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAK 1362
              +K +L+    T Q       D E KF R+R QA+++L ASK  + S   ++N++ +AK
Sbjct: 1310 ESLKAQLEDK--TQQGA-----DSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAK 1362

Query: 1363 SQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTE 1422
              +E  L       +ELE+      + AE + Q   S + KLQED      ++E  +K E
Sbjct: 1363 LALEKSLNNANARIQELED-----AKVAENRNQL--SMIKKLQEDTEENSKELE--TKLE 1413

Query: 1423 QNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTE 1482
            +N    D  +K L E + +L    +ELE +    Q+  A   T    +D   +V+++K  
Sbjct: 1414 ENAISYDSTVKKLNEEIGILK---EELEKQRQIQQQFQAAAGTE--QDDLSKVVESMKRS 1468

Query: 1483 FEAEKEQLIKDKEKELRSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQSPSQ 1542
            FE +K + I++K +E+  K    +E+                           T   PS 
Sbjct: 1469 FEEDKIKFIEEKTREVNQKIREFQEAQ----------------------EAEETGLKPS- 1505

Query: 1543 PTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESF 1602
               +I+ID +K +WE E+ ++              RIRLPT++KI KI+E +K  LE+ F
Sbjct: 1506 ---NINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEF 1562

Query: 1603 EEKVNEKAQKL--AGEI-----------------------------------GNDAITL- 1624
            +EKV E+ + +  +G++                                    +D I+  
Sbjct: 1563 DEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIISSD 1622

Query: 1625 --EKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTI 1682
              +K RA++ A    +R++F  +L  IK+KSFEEGKQQ  +K   LE K+  +E Q S  
Sbjct: 1623 DKDKLRADIEA---QLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSET 1679

Query: 1683 K 1683
            K
Sbjct: 1680 K 1680

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/1742 (33%), Positives = 971/1742 (55%), Gaps = 164/1742 (9%)

Query: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69
            +A F     + ++ IN+D++  + +KL    + KSENL+IT + D+LK+ S  K+++ K 
Sbjct: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83

Query: 70   HISQLAKALEDGKDER------LHFEEEKRRLIEGNSQVTKR----IIELEQEIEVERQQ 119
             +  L K  +  + ER      L  E+ ++  I    +  KR    +IE ++E++  +Q+
Sbjct: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143

Query: 120  KELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRS 179
                        + L+E+++EL   ++  N +    K LR  +++ ET+ Q     +L S
Sbjct: 144  ----------TLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNS 193

Query: 180  KSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIA 239
            ++E+ R  QE+ +L+  NDWL  +L +K  Q   +R+ T   + + + +++++ S+ ++ 
Sbjct: 194  RAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVE 253

Query: 240  RTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESL 299
            +T N  L Q    L + L++KL E K + D  +  KQE + E++LKQR++D LE  + ++
Sbjct: 254  KTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAV 313

Query: 300  KKEMDATKN----NMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNI 355
            K+E+D+T+     N    + +EKE  +L++EL   K  L   +S CI+L   I E     
Sbjct: 314  KEELDSTRGLETSNDSKKHMSEKE--DLVKELQLTKEELAQCKSECIRLSSIIGE----- 366

Query: 356  KLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKI 415
                        + E+S S   +   D  +LKKQL+ EKR K+ L+ Q+E+F++ELEHK+
Sbjct: 367  ------------TDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKV 414

Query: 416  PVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRV 475
            P++NSFKER++ LE ELN   +LLE T  +++ K  +L      +K  E  I +L KQR+
Sbjct: 415  PIINSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRL 474

Query: 476  DLAHQIQYLLVNESIKSEDGGPLSAEELQFVKN-LTNSQEITKTSDTQGIITDRLVEFRS 534
            DL  Q+QYLL+  S+  +  GPL  EE+ F++N L N  +    +D+Q I+T+RLVEFRS
Sbjct: 475  DLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRS 534

Query: 535  VVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLEN 594
            ++ELQ+KN+ELL  +RNLAD LE  E E+K  +Q +E ET+ EAKE ILTL    + LE+
Sbjct: 535  IIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLES 594

Query: 595  QLVILSKERDAYKALSVN--ASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNA 652
            ++  L KE +  KAL  N   S   +T + +     + + +++DL++ ++ + +E+  N 
Sbjct: 595  KVEELEKECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENM 654

Query: 653  KEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQ 712
               + E  +L     +IS+    EK+SR LAE+R  LL +TL+L+K + ++L+KR   LQ
Sbjct: 655  SLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQ 714

Query: 713  DILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESV 772
              + KQD +TQET++  I  KS L+  ++EL  LK E++     ++ LK E ++ S E  
Sbjct: 715  STILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKT 774

Query: 773  EYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEI---ELSGSL----ERLEEIEK-NT 824
              ++++ QLQTLQ+ERE LL ET+ SY+ K+ +LE    EL G      +R++++E+ N 
Sbjct: 775  GLRIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNN 834

Query: 825  TGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARA 884
            + I         W+Q KI+ L  +      ++ +K+A+++K+Q  +     ++ E + R 
Sbjct: 835  SSIE--------WYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRL 886

Query: 885  QSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEE 944
             +Y    NV D     ++LR+ELEK  + L+D+YSQI+ +K L E + +S+ ++   FEE
Sbjct: 887  HTY----NVIDGTINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEE 942

Query: 945  AQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQM 1004
            + K+    I  L NE++ L+  +++L +Q+ +LNNE+  Q    + E+    ++IS LQ 
Sbjct: 943  SSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQN 1002

Query: 1005 VKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQS 1064
              + V+  K++YE K++ IQKDL+ QT YAN +Q +YE ELQKHADVSKTI+ LR +  +
Sbjct: 1003 NNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHT 1062

Query: 1065 YKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIEL 1124
            Y+  + TL          LK +E+ W  Q+    ++L     R+++L++QNKLLYDQIEL
Sbjct: 1063 YRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIEL 1122

Query: 1125 LNKTE----DRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLN 1180
                +    D ++    + +L+SLRRERD+L+TK+ VA  +  +L+Q++ +   E+++  
Sbjct: 1123 YTTADKGVTDTNDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEAR 1182

Query: 1181 TQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQE 1240
            T+L   +    +   +++Q E+IM++L+QL+LLRESN+TLR+E  +  +E   L+S+L +
Sbjct: 1183 TKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDK 1242

Query: 1241 CNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKE 1300
                +AP++S +++L+  ++ KEQEL  +KEE  RWK RSQDIL K+ ++   ++ KL+ 
Sbjct: 1243 LKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEH 1302

Query: 1301 EINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINE 1360
            EI+ +K +L   + T Q   AE+     +F R+R QA++RL  SK    +L+ ++N +  
Sbjct: 1303 EIDSLKVKLD--EKTRQGAEAEE-----RFNRLRRQAQERLKTSKLSLDTLTEQVNDLKN 1355

Query: 1361 AKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASK 1420
            AK ++E  L    T  +ELE            K +  N+QL  ++     +Q   EN+SK
Sbjct: 1356 AKIKLEKSLDDANTKIEELEN----------AKAEQDNNQLDAIK----RLQQDAENSSK 1401

Query: 1421 TEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINE--DTKSIVDN 1478
              +     +EK      T++ LN +I  L  E    ++I  +  +   NE  D   IV++
Sbjct: 1402 --EFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQRRIQQQLQSEPANEQNDLSKIVES 1459

Query: 1479 LKTEFEAEKEQLIKDKEKELRSK-FEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTV 1537
            +K  FE +K   I++K KE+  K  EA+                                
Sbjct: 1460 MKKTFEEDKINFIREKTKEVNEKILEAQ-------------------------------- 1487

Query: 1538 QSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAV 1597
            +  +QP+ +I+ID LK +W+ E+E++              RIRLPT++KI KI+E ++  
Sbjct: 1488 ERLNQPS-NINIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKRED 1546

Query: 1598 LEESFEEKVNEKAQKLAGEIGNDAITLEKH------------------------------ 1627
            LE+ F+EKV E+  KL  + G   +T +K                               
Sbjct: 1547 LEKEFDEKVEERI-KLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSIS 1605

Query: 1628 ---RAELNA-LKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIK 1683
               R +L A ++  MRK+ + +L  IK+KSFEEGKQQ  +K   LE K+  +E Q S  K
Sbjct: 1606 IDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1665

Query: 1684 PV 1685
             +
Sbjct: 1666 KI 1667

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/1743 (32%), Positives = 995/1743 (57%), Gaps = 161/1743 (9%)

Query: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69
            +A F     + ++ I+ D++ R+ EKL    + KSENL+IT + D+LK+ S  K++  K 
Sbjct: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83

Query: 70   HISQLAKALEDGKDER----LHFE---EEKRRLIEGNSQVTKRIIELEQEIEVERQQKEL 122
             +  + +  ++ + ER      FE    EK +L      V +++ +L +E      +KE+
Sbjct: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEE------KKEI 137

Query: 123  ADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSE 182
              +++Q   + L+E+++E+   K + N      + LR  VV  ET+ QT    +L S+SE
Sbjct: 138  Q-SNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSE 196

Query: 183  ILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTS 242
            + R  QE+ LL+ N DWL  +L++K+ Q   +R+ T + + + + +++ ++++ ++ +T+
Sbjct: 197  LERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTN 256

Query: 243  NQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKE 302
            N  LKQ  + L   L++K+ + K + D  N  KQE + E++LKQR+ID LE  + ++K+E
Sbjct: 257  NDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEE 316

Query: 303  MDATKNNMDSSYFTE-------KERDELIEELNAVKYRLDASESNCIKLKETIDELTSNI 355
            + + + + DSS  T         E + L+++L   K +L   ES C++L    +E     
Sbjct: 317  LKSIRKS-DSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEE----- 370

Query: 356  KLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKI 415
                        + E+S ++  +   D  +LKKQ + EKR K++L+ Q+E+F+VELEHK+
Sbjct: 371  ------------TGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKV 418

Query: 416  PVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRV 475
            PV+NSFKER++MLE ELN   +LLE T  +++ K  +L+     +   E  I  L++QR+
Sbjct: 419  PVINSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRL 478

Query: 476  DLAHQIQYLLVNESIKSEDGGPLSAEELQFVKN-LTNSQEITKTSDTQGIITDRLVEFRS 534
            DL  Q+QYLL+  S+ ++  GPL  EE++F++N L N    T  SD+Q I+T RLVEFR+
Sbjct: 479  DLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRN 538

Query: 535  VVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLEN 594
            V+ELQ+KN+ELL   RNLAD+LE  E ++K  +  +E++T+ EAKE IL+L     +LE+
Sbjct: 539  VIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLES 598

Query: 595  QLVILSKERDAYKA-LSVNASSGTNTP-KAITYPSPDNDDKVKDLETRLTAVIQEAENNA 652
            ++  L +ER+  K+ +S  ASS  N+  + +T    + + +V+DL+ R++ + +E+  N 
Sbjct: 599  KVEELERERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNM 658

Query: 653  KEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQ 712
               + E  ++     +IS+    EK+SR LAE+R  LL +TL+L+K + ++L+KRS  LQ
Sbjct: 659  SLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQ 718

Query: 713  DILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESV 772
              ++KQD +T ET++  I  KS LS  ++ LS LK E++     +K LK E ++ S E  
Sbjct: 719  SSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKT 778

Query: 773  EYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLE-------IELSGSLERLEEIEKNTT 825
              ++++ QLQTLQ+ERE LL E + S + K+ ++E       +E S   + + ++E++ T
Sbjct: 779  SLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNT 838

Query: 826  GIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQ 885
                    +  W+Q KI+ L  +       + EK+ +++K+Q  +     +++E + R  
Sbjct: 839  S-------KIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLH 891

Query: 886  SYTMLS-NVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEE 944
            +Y ++   ++D     ++LR+ELE   + L+++YSQI+ +K L E + QS+ E++   +E
Sbjct: 892  TYNVMDETIND-----DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDE 946

Query: 945  AQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQM 1004
            + +     I +L +E+  L+  V++L +Q  +LNNE+  QK+E + ++    + I+ LQ 
Sbjct: 947  SNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQN 1006

Query: 1005 VKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQS 1064
              + ++  K++YE K++ IQ DL+ QT YAN +Q +YE ELQKHADVSKTI+ LR +  +
Sbjct: 1007 NNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHT 1066

Query: 1065 YKSDLETLKTQSQLAMEN-LKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIE 1123
            Y+  ++TL T S+  +EN LK +EK W  QK    ++L +   R+++LS+QNKLLY+QIE
Sbjct: 1067 YRGQVKTL-TLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIE 1125

Query: 1124 LL----NKTED-RDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIED 1178
            L     N   D R+    ++D+L++LRRERD+L+TK+ VA  +  +L+Q++ +   E++D
Sbjct: 1126 LYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQD 1185

Query: 1179 LNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQL 1238
              T+L+  +  + E + +++Q + IM++L+QL+LLRESN+TLR+E  +  K+   L+S+L
Sbjct: 1186 ARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSEL 1245

Query: 1239 QECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKL 1298
             +  + +AP++S +S+L+  ++ KEQE+  +KEE  RWK RSQDIL K++++   ++ KL
Sbjct: 1246 VKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKL 1305

Query: 1299 KEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQI 1358
            + E+  +K +L+   D +Q    +  + E +F R+R QA+++L  SK  +++L+ ++N++
Sbjct: 1306 ESEVESLKAQLE---DKMQ----QGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNEL 1358

Query: 1359 NEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENA 1418
             +AK  +E  L    T  +ELE        E   ++   +  + + QED      ++E  
Sbjct: 1359 KDAKVALERSLNDANTRIQELE-------GEKVAEDNNRSEMIKRSQEDAEKSSRELE-- 1409

Query: 1419 SKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDN 1478
             K E+N       ++ L E +  L  +I E + +     +  A H     +ED  +IV++
Sbjct: 1410 EKLEENAISYSSTVRKLNEEIATLKEEI-EKQGQIQKQLQTAAGHR----DEDLSNIVES 1464

Query: 1479 LKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQ 1538
            +K  FE +K + I++K +E+  K +  +E                               
Sbjct: 1465 MKKSFEEDKIKFIEEKTREVNKKIQEAQERL----------------------------- 1495

Query: 1539 SPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVL 1598
              +QP+  ++ID +K +WE E+E++              RIRLPT++KI KI+E +K  L
Sbjct: 1496 --NQPS-SVNIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDL 1552

Query: 1599 EESFEEKVNEKAQKLAGEIGNDAITLEK-----------------------------HRA 1629
            E+ F EK+ EK + ++G    +A+ L+K                             H +
Sbjct: 1553 EKEFNEKLEEKVKSISGSEQMEAM-LQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSS 1611

Query: 1630 ELNAL-KDSMRKQFEADLAE--------IKQKSFEEGKQQVSLKLKFLESKIRNLEQQKS 1680
             ++   KD +R + EA L E        +K+KSFEEGKQQ ++K   LE K+  +E Q S
Sbjct: 1612 SISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLS 1671

Query: 1681 TIK 1683
             IK
Sbjct: 1672 EIK 1674

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/1749 (33%), Positives = 981/1749 (56%), Gaps = 174/1749 (9%)

Query: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69
            +A F     + ++  + DV+  + +KL    + KSENL++T + D+LK+ S  K++  K 
Sbjct: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83

Query: 70   HISQLAKALEDGKDER----LHFE---EEKRRLIEGNSQVTKRIIELEQEIEVERQQKEL 122
             +  + +  +  + ER    + FE    EK +L      V +++ +L +E       K+ 
Sbjct: 84   EMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEE-------KKE 136

Query: 123  ADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSE 182
              +++Q   + L+E+++E+   + + N +    K+LR  +++ ET+ Q     +L S++E
Sbjct: 137  TQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTE 196

Query: 183  ILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTS 242
            + R  QE+TLL+ NNDWL  +L +K  Q   +R+ T   + D + +++ + ++ ++ RT+
Sbjct: 197  LERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTN 256

Query: 243  NQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLK-- 300
            N  LKQ  + L + L++KL E K + D  N  KQE + EMSLKQR++D LE  + ++K  
Sbjct: 257  NDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEE 316

Query: 301  ----KEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIK 356
                +E++  K   D S     E ++L++EL   K +L   E  C++L    DE      
Sbjct: 317  LNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSSITDEAD---- 372

Query: 357  LEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIP 416
             ED+E  N +A S            D   LKKQL+ E+R K+ L+ Q+E F+VELEHK+P
Sbjct: 373  -EDNE--NLSAKSS----------SDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVP 419

Query: 417  VLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVD 476
            ++NSFKER++MLE ELN   +LLE T  +++ K  +L+     +   E  + +L+KQR+D
Sbjct: 420  IINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLD 479

Query: 477  LAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKT-SDTQGIITDRLVEFRSV 535
            L  QIQYLL+  S+ ++  GPL  EE+QF++N+    + T T SD+Q ++T+RLVEF+++
Sbjct: 480  LCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNI 539

Query: 536  VELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQ 595
            ++LQ+KN+ELL  +RNLAD+LE +E ++K  +Q +E ETV EAKE I+TL     +LE++
Sbjct: 540  IQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESR 599

Query: 596  LVILSKERDAYKALSVN--ASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAK 653
            +  L KE +  K    N  AS    T K +T    D + +V+DL+TR++ + +E+  N  
Sbjct: 600  IEELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMS 659

Query: 654  EWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQD 713
              + E  +L     +IS+    EK+SR LAE+R  LL +TL+L+K + ++L+KR   LQ+
Sbjct: 660  LLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQN 719

Query: 714  ILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVE 773
             + KQD +T ET++  +  KS LS +++EL  LK E++    ++K LK E  + S E   
Sbjct: 720  TILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDS 779

Query: 774  YKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEH 833
             ++++ QLQTLQ+ERE LL+ET+ S ++K+ +LE  LS       E++K T    S K+H
Sbjct: 780  LRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALS-------ELKKET----SQKDH 828

Query: 834  QYN-----------WFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEA 882
                          W+Q KI+ L  +     T+++ K+  ++K+Q  +     +++E + 
Sbjct: 829  HIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKI 888

Query: 883  RAQSYTMLS-NVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQA 941
            R  +Y ++   ++D     ++LR+ELEK  + L+D+YSQI+ +K L E + QS+ + +  
Sbjct: 889  RLHTYNVMDETIND-----DSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSK 943

Query: 942  FEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISK 1001
             +E+ K+    I  L +E+  L+  +++L +Q+ +LNNE+  QK   + E+    + IS 
Sbjct: 944  LDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISI 1003

Query: 1002 LQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTE 1061
            LQ   + V+  K++YE K++ IQ DL+ QT YAN +Q +YE ELQKHADVSKTI+ LR +
Sbjct: 1004 LQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQ 1063

Query: 1062 AQSYKSDLETLKTQSQLAMEN-LKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYD 1120
              +YK  ++TL   S+  +EN LK +EK W+ QK    ++L +   R+++LS+QNKLLYD
Sbjct: 1064 LHTYKGQVKTLNL-SRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYD 1122

Query: 1121 QIELLNKTE----DRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEI 1176
            QI++    +    +  N    +++LI+LRRERD+L+TK+ VA  +  +L+Q++ +   E+
Sbjct: 1123 QIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVEL 1182

Query: 1177 EDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKS 1236
            +D  T+L   +      + +++Q ++IM++L+QL+LLRESN+TLR+E  +   +   L+S
Sbjct: 1183 QDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQS 1242

Query: 1237 QLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHG 1296
            +L +    +AP++S +++L+  ++ KEQEL  +KEE  RWK RSQDIL K+E++   ++ 
Sbjct: 1243 ELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYE 1302

Query: 1297 KLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEIN 1356
            KL+ EI ++K EL+  +        +  + E KF R+R QA++RL  SK  + SL+ ++N
Sbjct: 1303 KLESEIENLKEELENKE-------RQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVN 1355

Query: 1357 QINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQL---SKLQEDLHSIQV 1413
             + +AK+ +E  L +     +EL+            K    N+QL    KLQED      
Sbjct: 1356 SLRDAKNVLENSLSEANARIEELQN----------AKVAQGNNQLEAIRKLQED------ 1399

Query: 1414 QMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINE--D 1471
              E AS+  Q  A  +E   S   T+  LN +I  L+ E    ++I  +      NE  D
Sbjct: 1400 -AEKASRELQ--AKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSANEQND 1456

Query: 1472 TKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXX 1531
              +IV+++K  FE +K + IK+K +E+  K    +E                        
Sbjct: 1457 LSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERL---------------------- 1494

Query: 1532 XXXTTVQSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIV 1591
                     +QP+ +I+++ +K +WE E+E++              RIRLPT++KI+KI+
Sbjct: 1495 ---------NQPS-NINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKII 1544

Query: 1592 EARK-------------------------AVLEESFEEKVNEKAQKLAGE---------- 1616
            E +K                          VL +  E KV EK ++L  E          
Sbjct: 1545 ERKKEELEKEFEEKVEERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELK 1604

Query: 1617 -IGNDAITLEKHRAELNA-LKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRN 1674
             + + +   +  R +L A ++  +R++F  +L  IK+KSF+EGKQQ  +K   LE K+  
Sbjct: 1605 DVPHSSHISDDERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAK 1664

Query: 1675 LEQQKSTIK 1683
            +E Q S  K
Sbjct: 1665 MESQLSETK 1673

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1523 (33%), Positives = 877/1523 (57%), Gaps = 122/1523 (8%)

Query: 185  RMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQ 244
            ++ Q++  + E  + L  +L  K  +++E+  +  +E+Q  + K+S +E+   I ++ N 
Sbjct: 191  KLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSEND 250

Query: 245  KLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMD 304
             LK+    +   L +K S+ +E+ + YN  K+E  KE+SLKQ MID L+  ++ L+ +  
Sbjct: 251  ALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDDYT 310

Query: 305  ATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVGN 364
               N        ++ER+  +EEL               KL ET  +L  N +LE  E  N
Sbjct: 311  RILNTKQPIVQNDEERNLEVEELKQ-------------KLIETETQL--NKELE--ERRN 353

Query: 365  TTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKER 424
             T  +E S ++  +   DL  +KK+L+ E+ QK++L+ QVE F+VELE K+P +NSFK+R
Sbjct: 354  ITMQTESS-TLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQR 412

Query: 425  SEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYL 484
            ++MLE+EL + T+LLE+  ++++Q +++LD L+   KS + +  SL+KQR DLAHQ+QY+
Sbjct: 413  TDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYI 472

Query: 485  LVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSE 544
            L++ S++++  GPLSAEE++F++++ +++   ++SD+Q +I++RLV F+++VELQQKN +
Sbjct: 473  LIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIVELQQKNID 532

Query: 545  LLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERD 604
            LL ++R LA +LE +E   +S  QV+E + + EAKE I++L  +   LE+++  L+ E D
Sbjct: 533  LLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELD 592

Query: 605  AYKALSVNASSGTNTPKAITYPSPD-------------NDDKVKDLETRLTAVIQEAENN 651
             YK+L                P PD             N D +K+LETRL    +E+   
Sbjct: 593  CYKSL----------------PKPDTKVETEHLRLNEENTDLIKELETRLATSREESNKT 636

Query: 652  AKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDL 711
                ++E  ++R+   +     ++E+ SR LAE RL L+Q++L LSK + E+LQKR   L
Sbjct: 637  FASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEIL 696

Query: 712  QDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKES 771
            QDI  KQD+RTQET+   +  K  LS+ Q+EL+ ++S+       +K LK +    SKE 
Sbjct: 697  QDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKER 756

Query: 772  VEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNK 831
             E K L++QLQ+LQ ERE +   T+   + +L  +E EL    E+L+  ++    + SN+
Sbjct: 757  NELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNR 816

Query: 832  EHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLS 891
              +  W+Q KID +  +    +  L EK  ++ ++   I +    L+ +E+R  +Y +L+
Sbjct: 817  LSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLN 876

Query: 892  NVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQK 951
            N D+    +ETL+ ELEK  + LS++Y++++ +K  A +  + +       EE +KE  +
Sbjct: 877  NSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIR 936

Query: 952  TIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDR 1011
             I TL+ +R++L  T +IL++Q+ DLNNE+ HQ   +  E++   +++++L     +++ 
Sbjct: 937  KIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEE 996

Query: 1012 TKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLET 1071
                YE K++ +Q DLE Q  YAN +Q +YE ELQKHA+++KTI+ LR +A +Y+  +++
Sbjct: 997  VSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDS 1056

Query: 1072 LKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDR 1131
            ++  +    E L+ +EKLW EQ+  YED++  L++R+++LS+QNKLL+DQ++LL+K+E+ 
Sbjct: 1057 MQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENS 1116

Query: 1132 DNSHDSS----DLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVK 1187
             N   S+    DL++SLR +RD+L+T+L V   E   L+ +L    +E+ +   +L++++
Sbjct: 1117 YNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIR 1176

Query: 1188 NSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAP 1247
                 +   +E+ +NIM +L+QL+LLRESN+TLR+E +  +++   L+  L+   +++ P
Sbjct: 1177 QQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLP 1236

Query: 1248 LQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKN 1307
            L++  + L+  IK  EQ+L   KEE  RWK RSQDIL K+++IDP EH KL+ EI  +K 
Sbjct: 1237 LEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQ 1296

Query: 1308 ELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEA 1367
             L   K        E ++   +F RI+ QA +RLN+SK  +Q+L  +I Q+ +  + +++
Sbjct: 1297 NLADKK-------KENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQS 1349

Query: 1368 DLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENA---SKTEQN 1424
             L   +   +  EE+ +               Q++K  ED+ +++ Q+E A   SK  +N
Sbjct: 1350 LLETERGNIQNTEEKFR---------------QMNKQSEDVTALRSQLEEALLSSKEFEN 1394

Query: 1425 --NA---DSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNL 1479
              NA    SDE    L + ++ LN+++  L+   +N   +  +   P    D  ++V+ +
Sbjct: 1395 KFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQ---P----DLSNVVEEM 1447

Query: 1480 KTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQS 1539
            K  FE EK + ++D+  E + K   E                             T  Q+
Sbjct: 1448 KKSFEEEKIKFVQDQTTEFKEKLAEE---------------------VKRIEAQATDTQN 1486

Query: 1540 PSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLE 1599
             +   L  DI A + +WEKEYE+               RIRLPT++KI+ +++ +K  LE
Sbjct: 1487 KNVTPLQ-DISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELE 1545

Query: 1600 ESFEEKVNEKAQKLAGEIGNDAITLEKHRAELNALKDSMRKQFEAD----LAEIKQKSFE 1655
            + ++EKVN++A++L        ++ E+++  +  LK+ ++K+ E +    L   K K+FE
Sbjct: 1546 KEYDEKVNQRAKEL--------LSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFE 1597

Query: 1656 EGKQQVSLKLKFLESKIRNLEQQ 1678
            EGKQQ  +K  FLE KI  LE Q
Sbjct: 1598 EGKQQAMMKTTFLEKKISKLESQ 1620

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/1752 (32%), Positives = 987/1752 (56%), Gaps = 146/1752 (8%)

Query: 8    SRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESF 67
            S +A FL V++  ++ +  ++   I  K E+  + +S+NLR    L++ K+   +K E  
Sbjct: 7    SEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKL 66

Query: 68   KIHISQLAKALEDGKDERLHFEEEKRRLIE--------GNSQVTKRIIELEQEIEVERQQ 119
            K    +L   +ED    R     E + L E         NS++ + I +L+   E  +  
Sbjct: 67   K---EELDYVVEDNTKVRA----ENKTLSEKVWSLETSDNSKLAE-INQLKTSNEGLQNN 118

Query: 120  KELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRS 179
             + A+   +++  S +EK+ EL   + +  E Q   K L  K++  E + Q  Q+ EL  
Sbjct: 119  IDRANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNR 178

Query: 180  KSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIA 239
            KSE+ R  QEI LLR+N +WL  +L  K      +R+ T   + D+   V  ++S+L+I 
Sbjct: 179  KSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIE 238

Query: 240  RTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESL 299
            ++S + L + +    EQL+  L ENK++KD     KQE  KE+S+K ++I   E  ++SL
Sbjct: 239  KSSKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSL 298

Query: 300  KKEMD-----ATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSN 354
            +  +      A  N  +SS   +     L EEL+  + +L   E  C++L+  +D  +++
Sbjct: 299  ESTLQQKFKTAEANEENSSEVVKS----LKEELSLAERKLQDMEEKCVRLESILDHDSND 354

Query: 355  IKLEDSEVGNTT------------ASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKM 402
            + L+      T              S + S   + ++ GD+ +LK+QLV EKRQK++L+ 
Sbjct: 355  VSLQTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQN 414

Query: 403  QVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKS 462
            QVE+FV+ELEHKIPV+NSF+ER+ +LE+EL +  +LLE   K+ + K+++L  LK  +  
Sbjct: 415  QVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISD 474

Query: 463  YETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQ 522
              +Q+  L +QR DLAHQ+QYLL+N SI +++   L+ +E++F+KNL ++  +  T+D+Q
Sbjct: 475  DNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQ 534

Query: 523  GIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQ--VLED-ETVREAK 579
             +I++ L++F+ + +LQ+KN EL+ T+R LA +LE  E + KS     V ED E   EAK
Sbjct: 535  KVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAK 594

Query: 580  ETILTLHDHAQNLENQLVILSKERDAYKALSV-----NASSGTNTPKAITYPSPDNDDKV 634
            E ILTL    +NLE  L I++KERDA+K L       N  S  +  K     S  N+  V
Sbjct: 595  EAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSY-NETVV 653

Query: 635  KDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTL 694
            KDLE RLT +  ++  ++K  + E + L K++ ++++  E  +++++LAE+RL + Q+++
Sbjct: 654  KDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSM 713

Query: 695  ELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMA 754
            EL  ++ E+L+ RSS L+D L +QDK TQ+T  S ++  S  SS+++ +  L++E   + 
Sbjct: 714  ELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLK 773

Query: 755  KVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKL-------RKLE 807
              +  LK+E    ++E  + ++++ QLQ+LQ ERE LL+  Q+ +K+++        KL+
Sbjct: 774  DREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLD 833

Query: 808  IELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQ 867
             +LS   ER+ EI+K    I   +  QY W+Q+KID+ + +  Q +  L+ K  +L+++ 
Sbjct: 834  KQLS---ERVHEIDK----IEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLH 886

Query: 868  STINEQSAKLKEAEARAQSYTMLSNVDDAQNLVET-LRQELEKVNLQLSDSYSQIEHHKT 926
                    +L+ A+ R  +Y  + N ++++N  E  + +ELEK  ++L+D+YSQ+E  K 
Sbjct: 887  LQNKTLEKELEGAQIRIHTYETI-NQNNSENQEENDVIKELEKTKIELADAYSQLEEFKN 945

Query: 927  LAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKS 986
            L++ S  ++ E++ +F    ++ +  I TL  E+ +++    IL  Q++++ NE+  Q  
Sbjct: 946  LSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSE 1005

Query: 987  EYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQ 1046
            E ++ER    + I++LQ   + ++  K  +EEK+  ++ DLE QT YAN +Q++YE ELQ
Sbjct: 1006 EAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQ 1065

Query: 1047 KHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQ 1106
            +HADVSKTI+ LR + Q  K+D ++L  + Q   + +  +EK    ++ EY  ++ + +Q
Sbjct: 1066 RHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQ 1125

Query: 1107 RVQELSTQNKLLYDQIELLNKTED-RDNSHD-----SSDLLISLRRERDMLETKLEVALS 1160
            R+ +++ QN+LLY+QI+LLN+ E   +NS D     S+ L++SLRRERD+L+TK+ V  +
Sbjct: 1126 RIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIET 1185

Query: 1161 EQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTL 1220
            E+  L+Q+LD  ++E+E+     + +++  SE + L+   + I  +L+QL+LLRESNVTL
Sbjct: 1186 EKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTL 1245

Query: 1221 RSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRS 1280
            R+E      E D +   LQ C + L PLQS++ S  N IK K+ ++  + +E++RWK+R 
Sbjct: 1246 RNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRL 1305

Query: 1281 QDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDR 1340
            ++++ K+++++ +++ KL+E +N+       TK  L + + E ++   +F R++ QA ++
Sbjct: 1306 EEMIEKHQKVNVDDYTKLEETLNE-------TKQLLDNKVQETNELNDRFNRLKKQAHEK 1358

Query: 1341 LNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQ---EAETKEQTF 1397
            LN SKE + SL  +I+ +   K  +   L        EL   L    +   + ET  +  
Sbjct: 1359 LNTSKELQSSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQNDLETLREEL 1418

Query: 1398 NSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQ 1457
            N ++SK +E    +Q ++E++S   +N   ++++I+ L + ++ L +   +L A +++A 
Sbjct: 1419 NKEISKSEELEVKLQNEIESSSLASRN---TNKEIEELQKVIDDLKT---QLAANSTDA- 1471

Query: 1458 KIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSXXXXX 1517
                       +E T   V+ +K EFE +K + I +K +E   +   E E   N      
Sbjct: 1472 -----------DEQTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNE----- 1515

Query: 1518 XXXXXXXXXXXXXXXXXTTVQSPSQPT--LDIDIDALKNEWEKEYEKQTXXXXXXXXXXX 1575
                                Q   +P   L++D++AL+ +WE++ E+             
Sbjct: 1516 -------------------FQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNL 1556

Query: 1576 XXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAELN--- 1632
              RIRLP+++KI+KI+E R++ LE  F++K+ +KA+ L   + ND      H  E N   
Sbjct: 1557 KKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDL---LMND------HSNEFNNEL 1607

Query: 1633 --ALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQ----------KS 1680
              AL+  ++++FE +L   ++K+FEEGKQQ ++K   LE KI+ LE Q            
Sbjct: 1608 KEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQ 1667

Query: 1681 TIKPVENDTSNM 1692
             +KP EN T ++
Sbjct: 1668 DVKPEENSTPSV 1679

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/1741 (30%), Positives = 967/1741 (55%), Gaps = 163/1741 (9%)

Query: 5    PIAS----RVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQS 60
            P++S    +VA FL     ++Q ++  +L  +  + ++    ++E ++I+  L+  K  +
Sbjct: 15   PLSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTN 74

Query: 61   ENKLESFKIHISQLAKALE----DGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVE 116
               ++  K  +++L  + E    + +D      EE+ + I+   ++  ++I++     +E
Sbjct: 75   NTTIKKLKNELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIHS---LE 131

Query: 117  RQQKELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALE 176
                EL  + KQ++ +SL+++I EL+  +  +        + R K++  E E Q  +  +
Sbjct: 132  ENVSELQ-SKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKIND 190

Query: 177  LRSKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESEL 236
            L  ++++ R+ QE+  + +   WL  +L  K  Q + +RE +I+E QD +L+++ +++EL
Sbjct: 191  LSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNEL 250

Query: 237  EIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHM 296
            +  +++N  L++    L  +L    +  K I+   N  K    KE++LKQ++I  L+  +
Sbjct: 251  DQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQL 310

Query: 297  ESLKKE----MDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELT 352
              L++E    +  T ++  SS  + K+ D    E+N +K +L+  +   ++L+       
Sbjct: 311  NELQRENGNELSLTVSDTASS--SRKDSD-FTREINDLKNQLNHVQERNVELE------- 360

Query: 353  SNIKLEDSE----VGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFV 408
               KL  SE    V N+T+S +   S + K Y D+ +LKK+L  E+ Q++  +  +E F+
Sbjct: 361  --FKLRKSEDYTAVSNSTSSDDLRNS-LAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFM 417

Query: 409  VELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIA 468
             +LE ++P L +++ R+   E EL E T+LLE   K++   SS+L+  ++ ++S E +I 
Sbjct: 418  DDLETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIK 477

Query: 469  SLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLT--NSQEITKTSDTQGIIT 526
             ++KQR DLA+Q+Q+ LV+ S+ ++  GPL+ EE++F++N+   + +   K +DTQ +I+
Sbjct: 478  LVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVIS 537

Query: 527  DRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLH 586
            +RL +F+ ++ELQQKN ELL T R LA +LE  +   +++   +E+ET+ EAKE ILTL 
Sbjct: 538  ERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQ 597

Query: 587  DHAQNLENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDK------------V 634
            ++  +L  ++  L+KE + YK LS    S T          P + DK            V
Sbjct: 598  NYNSSLTAKIAALTKELETYKVLSNTEDSST----------PADFDKQREQREIEHTQLV 647

Query: 635  KDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTL 694
            K+LETR+ ++IQE++ NA   + +   L +K   IS+    EK+++ LAE+RL LLQ ++
Sbjct: 648  KELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSM 707

Query: 695  ELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMA 754
            +++  + E LQKR + L++++ +QDKRT ET++SLIKT+S L++++++ ++ ++E + + 
Sbjct: 708  DMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLH 767

Query: 755  KVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSL 814
              ++ LK E  R ++E    K+L+ +LQTLQ ERE LL  TQ+ + ++L  LE   +   
Sbjct: 768  SSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLR 827

Query: 815  ERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQ- 873
            ++L+E E+N           Y    E+  +L  +  Q+K +L+E+ + ++K  S I E+ 
Sbjct: 828  KKLKEAEEN-----------YGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKE 876

Query: 874  ----------SAKLKEAEARAQSYTMLSNVDDAQNL--VETLRQELEKVNLQLSDSYSQI 921
                      + +LKE     + Y   S  DD   L  + +L++EL+ +  +L++SYSQ 
Sbjct: 877  RETKWENTRLTKQLKEKTELIEKYKAAS--DDEGKLEEISSLQKELQVLKNELTESYSQT 934

Query: 922  EHHKT---LAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLN 978
            E ++    L  QS+  +N+     E A KE    I  +E  +N +  +  +L  Q+ DLN
Sbjct: 935  ESYRKDIELLNQSIADINKQVLNKEAAFKER---ITEVELAKNNIADSNTVLKTQIDDLN 991

Query: 979  NEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQ 1038
            NE+  QK  Y+ E+       ++L+ V + ++++K DYE+K+  + KDLE Q +YAN++Q
Sbjct: 992  NELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQ 1051

Query: 1039 RSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYE 1098
             +YE ELQ HA+VSKTI+ LR + Q Y++++  L   +  A   L  ++  W +Q+ EYE
Sbjct: 1052 NNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYE 1111

Query: 1099 DKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDSS--------DLLISLRRERDM 1150
             ++   ++R++E S QNK+L++Q +L  +  D DN+  S          L++SLR ERD+
Sbjct: 1112 KQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDL 1171

Query: 1151 LETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQL 1210
            L+ +L V  +E+ +L++RL   + +    + +L ++K  +     LLEQ + +M +L QL
Sbjct: 1172 LQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQL 1231

Query: 1211 HLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSK 1270
             LLRESN+TLR+E    + +  +L+++++  +D+L PL++ + +L N I+ K+++L    
Sbjct: 1232 DLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKDKQLSICH 1291

Query: 1271 EEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKF 1330
            EE+ERWK RSQDIL KY+RIDP EH  L EE    +N LQ     L+    E ++  ++F
Sbjct: 1292 EESERWKQRSQDILSKYQRIDPVEHENLAEE----RNRLQAQ---LEEKSKENEELGNRF 1344

Query: 1331 QRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQEA 1390
            ++++ QA ++LNASK  + SL+ +IN +   K ++ + L   K     LE+RL+V  + +
Sbjct: 1345 EKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNS 1404

Query: 1391 ETKEQTFNSQLSKLQEDLHSIQVQMENA-SKTEQNNADSDEKIKSLTETVEMLNSKIQEL 1449
                            D+ SIQ Q+E A  K++         ++S  +  E LNS+I++L
Sbjct: 1405 H---------------DIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIKKL 1449

Query: 1450 EAEASNAQKIVAEHH-----TPVINED--------TKSIVDNLKTEFEAEKEQLIKDKEK 1496
            + E+S  Q+ +A        T + N D        +  IV+++K  FE EK + I+++  
Sbjct: 1450 QEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEKIKFIEEQTT 1509

Query: 1497 ELRSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDIDALKNEW 1556
            E + K +AE                                ++     + ID +A++ + 
Sbjct: 1510 EFKKKLQAE------------------------INKLKAEYETKQIEPVSIDENAIRKQI 1545

Query: 1557 EKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQK-LAG 1615
            E+EYE+ T             RIRLPT++KI+K+++ R+  LE  F+ KV  +A++ L G
Sbjct: 1546 EEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTG 1605

Query: 1616 EIGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNL 1675
            +  N+    ++ + E   +++ + +++E +L  +K+K+F+EG+QQV +K  FLE KI  L
Sbjct: 1606 DEKNEF--FDRMKKE---IQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKL 1660

Query: 1676 E 1676
            E
Sbjct: 1661 E 1661

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  403 bits (1035), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 390/1429 (27%), Positives = 756/1429 (52%), Gaps = 178/1429 (12%)

Query: 6    IASRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLE 65
            I  +++  L V  + +   + D++  +++KL++LR  K ++  ++  +++L++ ++NKL 
Sbjct: 32   ILLQISSILDVPLEKLHTTDYDLILAVKDKLDELRNSKDQSNVVSNDINELQTLADNKLT 91

Query: 66   SFKIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELADA 125
            S                               G    T           VE ++KEL   
Sbjct: 92   SL------------------------------GGKLAT-----------VETEKKEL--- 107

Query: 126  SKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQ------------ 173
                        I++++  + + NE +  N+ L  KV N   EL+  +            
Sbjct: 108  ------------IDKVNGYETQFNELKIKNEGLNLKVSNLNIELENWKNNSNNFETEKLN 155

Query: 174  ------ALELRSKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNE--------FRESTI 219
                   L +R +SEI R++QE+T L EN   L+ Q   +  + N+           STI
Sbjct: 156  YVXXXXXLSIR-ESEIQRLKQEVTFLNENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTI 214

Query: 220  SELQDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELT 279
             +L+++   + +ME+++ +    N       + L ++ E  + E K +KD    +K ++ 
Sbjct: 215  -KLEEATTTLKSMEAKVSVLSDKN-------NDLTKKYENSIWEIKNLKDNLLVTKDDMN 266

Query: 280  KEMSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDASES 339
            KE+++K ++ID L+  + S ++E+   + N+               ELN+   +    ES
Sbjct: 267  KEIAMKSKLIDLLQGQLSSTQEEL---RQNV---------------ELNSKFTKFPDLES 308

Query: 340  NCIKLKETIDELTSNIKLEDSEVGNTTASS---------------EKSVSVIPKLYGDLG 384
                LK  I +LT  +K+E+ +  N   +S                   S +P LY  + 
Sbjct: 309  QNETLKSDIQDLT--LKIEELQNENFNLNSMINQMSNEQNNSNNSSSIDSNLPTLYSKIN 366

Query: 385  MLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGK 444
            +LKKQ+  EK +K  L+ Q+E+F++ELE+KIP+++SF+E+++ LE EL  +T+LL  T  
Sbjct: 367  LLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSN 426

Query: 445  DRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQ 504
            +++   ++L+   + + +Y++ I  L +QR+DLA+Q+++LL+  ++K++ GGPL+ EE++
Sbjct: 427  EKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIE 486

Query: 505  FVKNLTNSQEITKTSD--TQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAE 562
            F+  ++N+ E    S+  +Q +I++RLV F ++ ELQ KN ELL++IR+L++ LE    E
Sbjct: 487  FINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLEN--IE 544

Query: 563  NKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERDAYKAL---SVNASSGTNT 619
            N +  +  +++T+ +AKE ILTL  H   LE+++ +L  ERD++K L   +V+  S    
Sbjct: 545  NANSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKN 604

Query: 620  PKAITYPSPDNDDK-VKDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKT 678
                +  SP+ ++K ++ L+T +  +  E + N     S+ ++       ++++ E EK+
Sbjct: 605  DDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKS 664

Query: 679  SRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSS 738
            S TL  ++++L +S  ++ K + +EL KR  +LQ+I+ KQ+ +  + ++  I  ++ +S+
Sbjct: 665  SNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISN 724

Query: 739  IQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNS 798
            ++++LSI KSEK F+ K Q  L +E  + S+E  + +++++QLQ+LQ ER  LL +TQ  
Sbjct: 725  LKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKK 784

Query: 799  YKEKLRKLE---IELSGSL-ERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKT 854
            +  K+ +LE   ++L  +L  ++ EI+K    ++ + E Q  W+Q  ID L    +  KT
Sbjct: 785  FMSKIHELENNNLDLIKNLGSKMTEIQK----LSISNESQCTWYQNTIDDLKKINSAIKT 840

Query: 855  TLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSN--VDDAQNLVETLRQELEKVNL 912
             L  K        S I++ + K++  E  +QSYT+ +N     + N    + ++L+   L
Sbjct: 841  ELTSK-------NSLISDLNTKIELLE--SQSYTIDTNTRCSSSGNDFSQISKDLDITKL 891

Query: 913  QLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILND 972
             LS++Y+Q+E +K L   + +S+  +   FE  +      I  L +E   L+++    + 
Sbjct: 892  HLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDK 951

Query: 973  QVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQ 1032
            ++ +L+ ++ ++K++Y  E      +I++L   K+    T ++YEEKI+ +Q  LE++ +
Sbjct: 952  RISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAK 1011

Query: 1033 YANESQRSYE-------LELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKN 1085
            +A+ +Q  YE         LQ   +  + I  L       +SDLE    ++ L  EN   
Sbjct: 1012 FADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLE---KKTSLLSEN--- 1065

Query: 1086 SEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNK----TEDRDNSHDSSDLL 1141
             E LW +++  +   L   ++++  L+ QNKL  DQ+ELLNK     +    S ++  + 
Sbjct: 1066 -ESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFSSMDSSQLSSETKHMF 1124

Query: 1142 ISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQE 1201
              LR +RD+LETKL +A  +      +L+  + E+ ++  +L   +N     + L+E  E
Sbjct: 1125 NRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHE 1184

Query: 1202 NIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKI 1261
             I+ EL+Q+ L +ESN TLR++ S   ++   L+++L E N +L+ L   + S++  +  
Sbjct: 1185 KIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGD 1244

Query: 1262 KEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIA 1321
            KE +++  KEE+ +W+ R++++  + +++D +   KL  E++ +K++ +T +        
Sbjct: 1245 KETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKR-------K 1297

Query: 1322 EKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLG 1370
            +  + E +F  ++ QA +RLNASKE + SL+ +IN++  + + +E  L 
Sbjct: 1298 QNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALS 1346

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 71/153 (46%), Gaps = 44/153 (28%)

Query: 1537 VQSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKA 1596
            ++ PS+  ++  I+  K+E E EYE                 ++L  Q+K+++I   R +
Sbjct: 1520 IRLPSETKINRVIEKRKHELENEYE-----------------VKL--QEKLNEIEANRNS 1560

Query: 1597 VLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAELN-ALKDSMRKQFEADLAEIKQKSFE 1655
            +                      + I   K R E+   +K  M  +FE DL E K+KSFE
Sbjct: 1561 I----------------------ETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFE 1598

Query: 1656 EGKQQVSLKLKFLESKIRNLEQQKSTIKPVEND 1688
            EGKQQ S+K   LE KI  LE Q S  + +END
Sbjct: 1599 EGKQQSSMKTTLLERKISKLESQLS--EAIEND 1629

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  376 bits (965), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 448/1644 (27%), Positives = 793/1644 (48%), Gaps = 176/1644 (10%)

Query: 9    RVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFK 68
            ++++FL V  + ++ I +  L R+ +K+ +  + + E  ++   +D++KSQ       + 
Sbjct: 4    KISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQ-------YY 56

Query: 69   IHISQLAKALEDGKDERLHFEEEKRRL----IEGNSQVTKRIIELEQEIEVERQQ-KELA 123
              IS+L K L +  +E++   +   RL     E  S+ T++I  L +++    +  K+L 
Sbjct: 57   TRISKLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLE 116

Query: 124  D--ASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQT--QQALELRS 179
            D   +K++ A S  + +    STK  L++    NK L++K++  E  LQ     A+ L+ 
Sbjct: 117  DEEGAKEE-ASSWQDGLRNDDSTKHVLDKE---NKLLQRKLLEMENILQVCKSNAVSLQF 172

Query: 180  KSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIA 239
            K +    E+E+ L  +N  W   +L++   +      +  S LQ+ + K++  ++E E  
Sbjct: 173  KYDTASQEKELWL--QNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESV 230

Query: 240  RTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESL 299
             T N+ L      L   +E+KL E K +KD  N  K E +KEM+L+++M D L   + S 
Sbjct: 231  STYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSF 290

Query: 300  KKEMDA-TKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLE 358
            ++      K   D       E  ++ EEL   K +L+ S+  C        +L  NI  +
Sbjct: 291  ERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEEC--------QLLKNIVSD 342

Query: 359  DSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVL 418
              E   TT ++  +   + KL+ ++  LK+QLV E+ QK +++ Q++ FV+ELEHK P L
Sbjct: 343  CIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPAL 402

Query: 419  NSFKERSEMLERELNEVTILLE--STGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVD 476
             SFKER+E+LE EL   T LLE  S  K +D+K  +L  L+  + SYE  I SL +QR+D
Sbjct: 403  VSFKERTELLEHELKCSTELLETMSLAKRKDEK--KLTSLEQKINSYEANIHSLVRQRLD 460

Query: 477  LAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVV 536
            LA Q++ LL N S       PLS +EL  ++ L  S+      D+Q IIT++LVEF+++ 
Sbjct: 461  LARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNID 520

Query: 537  ELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQL 596
            ELQ+KN ELL  IR LAD+LE  E E    +  +E++T++EAKE I+ +      L  ++
Sbjct: 521  ELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRV 580

Query: 597  VILSKERDAYKALSVNASSGTNTPKAIT--YPSPDNDDKVKDLETRL-------TAVIQE 647
             IL++ERD+YK L   AS+  N   A T        + K+++L+++L       +A+IQ 
Sbjct: 581  NILTRERDSYKLL---ASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQN 637

Query: 648  AENNAKEWSSENSNLRKKLYEISLNFE---SEKTSRTLAEDRLNLLQSTLELSKRQCEEL 704
                   +    ++ +  L E   NF+   +EK +  + ++R+N L++ LE         
Sbjct: 638  LNGQLLTYKKSQTDGKIALQEFE-NFKVLVAEKEA--MLQERINHLKTQLE--------- 685

Query: 705  QKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAEN 764
            ++R S    +   QD +     D L  +++ + S++ E+S LK E   +  +++ L  + 
Sbjct: 686  KQRLSAAPPV---QDYKYSNLTD-LSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDL 741

Query: 765  ERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNT 824
            ER  KE ++  V +++ +T   E+ ++    +  Y  +++ LE  L     RLE  E+  
Sbjct: 742  ERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEI 801

Query: 825  TGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARA 884
              + S+K  Q  W Q  ID            L  KE  + ++   I     +L+  + + 
Sbjct: 802  KTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQ- 860

Query: 885  QSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEE 944
              Y  LSN  D   L  TLR+EL++  ++L D++SQI+ ++ +   +   + E++   ++
Sbjct: 861  --YKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKK 918

Query: 945  AQKESQKTIITLEN-ERNQLQSTVNILN---DQVKDLNNEIFHQKSEYQTERNATMEEIS 1000
            A KE  +T I LEN E+   +  ++ L    D+++ L  ++    S    +     ++  
Sbjct: 919  A-KEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASYLVLQSEKVGDQAQ 977

Query: 1001 KLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRT 1060
            ++Q +K  +D+  A  E               Y  E    Y+ EL+ + D+S+ +  L  
Sbjct: 978  RIQEMKNKIDKMAAIIE--------------AYQKEESSQYQSELKTNKDLSEWVMRLEK 1023

Query: 1061 EAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYD 1120
            EA  Y+++L+  K       E L   EK W E+K +YE +L    ++ + L  +N +L  
Sbjct: 1024 EAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVL-- 1081

Query: 1121 QIELLNKTEDRDNSHDSSDLLIS----LRRERDMLETKLEVALSEQTVLKQRLDIAKSEI 1176
             IE ++   +  NS++    L+S    LR ER  LETKL     +  +L+Q+    +  I
Sbjct: 1082 -IEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSI 1140

Query: 1177 EDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKS 1236
             DL    +  +N     A ++++ E I+KE+ Q+++LRE+N  L     +  ++ + +  
Sbjct: 1141 GDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYK 1200

Query: 1237 QLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHG 1296
            +L    + ++ LQ  +   +  + I   +++  + E E+ K R QD+  + +     E  
Sbjct: 1201 ELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETE 1260

Query: 1297 KLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEIN 1356
            KL   I D++ +L   ++          D E+KF R++ QA ++L+ASK+++ +L++E+N
Sbjct: 1261 KLHNVIGDLEVKLLNVQNA-------NADLENKFNRLKKQAHEKLDASKKQQTALTNELN 1313

Query: 1357 QINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQME 1416
            ++ E K ++E +L           E  +VV  E + KE     Q+ ++ +D  SI     
Sbjct: 1314 ELKETKDKLEENLHN---------EESKVVDLELKLKEHGL--QVGEVSKDHDSIA---- 1358

Query: 1417 NASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIV 1476
                            K   E +E L  ++Q       NA              D     
Sbjct: 1359 ---------------FKPFVEEIESLKKELQVFR----NAN-------------DASDAF 1386

Query: 1477 DNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTT 1536
            + +K   E EK ++I +K K+    FE + + A N                       + 
Sbjct: 1387 EKIKNNMEEEKNKIIDEKTKD----FEKKLQDAVN-----------------KSKSNESE 1425

Query: 1537 VQSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKA 1596
            V++         I+ALK EW KEYE++T             RIRLP++++I KI+  RK 
Sbjct: 1426 VENSEH------IEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKG 1479

Query: 1597 VLEESFEEKVNEKAQKLAGEIGND 1620
             LE+ FE K+ E  + L     N+
Sbjct: 1480 ELEQEFERKLKENNKSLVFSGSNE 1503

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  367 bits (943), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 462/1673 (27%), Positives = 822/1673 (49%), Gaps = 249/1673 (14%)

Query: 9    RVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFK 68
            ++++FL V  + +Q +   VL ++ +K+    + + E  ++   +D++KSQ       + 
Sbjct: 4    KISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQ-------YY 56

Query: 69   IHISQLAKALEDGKDERLHFEEE----KRRLIEGNSQVTKRIIELEQEIEVERQ-QKELA 123
              IS+L + L++  +++   +EE    K +L E  S+  + I  L++++ V  +  +E+ 
Sbjct: 57   SRISKLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVN 116

Query: 124  DASK----QDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQ--TQQALEL 177
            D  +     DI +S ++  + L+      ++    NK LR+K++  E  LQ     A+ L
Sbjct: 117  DEKRVKEEYDIWQSRDQGNDSLN------DDLNKENKLLRRKLMEMENILQRCKSNAISL 170

Query: 178  RSKSEILRMEQEITLLRENNDWLTNQLNTKTV---QLNEFRESTISE-------LQDSQL 227
            + K +    E+E+ L             +K +   +L+ F + T++E       +++ + 
Sbjct: 171  QLKYDTSVQEKELML------------QSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEE 218

Query: 228  KVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQR 287
            K+  M+S  E   T N+ L      L + +E+K+ E K +KD  +  K E +KEM+L++ 
Sbjct: 219  KLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKN 278

Query: 288  MIDALEKHMESLKKE--MDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLK 345
            M D L   + SL+K+  + A + N D+S     E  ++I+EL   K RL+ S++ C +L+
Sbjct: 279  MNDLLRSQLTSLEKDCSLRAIEKNDDNS-CRNPEHTDVIDELIDTKLRLEKSKNECQRLQ 337

Query: 346  ETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVE 405
              + + T     ++ E   TT++   +V    KL+ D+ +LK+QL+ E+ QK +L+ Q+E
Sbjct: 338  NIVMDCT-----KEEEATMTTSAVSPTVG---KLFSDIKVLKRQLIKERNQKFQLQNQLE 389

Query: 406  AFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYET 465
             F++ELEHK P L SFKER++ LE EL   T LLE+    + ++  ++  L+  +   E 
Sbjct: 390  DFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEA 449

Query: 466  QIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGII 525
             I SL KQR+DLA Q++ LL+N S   E   PLS +EL  ++ +  S  I   +D+Q II
Sbjct: 450  NIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAII 509

Query: 526  TDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTL 585
            T+RLVEF +V ELQ+KN ELL+ IR LAD+LE  E +    +Q +E++T++EAK+ I+ L
Sbjct: 510  TERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIEL 569

Query: 586  HDHAQNLENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVI 645
             +    +E ++ IL +ERD+YK L+    +  NT  ++T      + K+++LE  L++  
Sbjct: 570  ENINAKMETRINILLRERDSYKLLASTEENKANT-NSVTSMEAAREKKIRELEAELSST- 627

Query: 646  QEAENNAKEWSSENSNLRKKL--YEIS-----LNFESEKTSRTLAEDRLNLLQSTLELSK 698
             + EN+A        NLRK+L  Y+ S        E  +  + LA+++  +L+  ++  K
Sbjct: 628  -KVENSAI-----IQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLK 681

Query: 699  RQCEELQKRSSDLQD-ILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQ 757
                EL+K+ S +   I  ++++ + E   S IK KS    ++ E+S LK E       +
Sbjct: 682  ---AELEKQKSWVPSYIHVEKERASTELSQSRIKIKS----LEYEISKLKKETASFIPTK 734

Query: 758  KELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERL 817
            + L  + E+  KE  E ++ + + +    E +M     +  YK K+++LE     +LERL
Sbjct: 735  ESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELE----NNLERL 790

Query: 818  --------EEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQST 869
                    +EIE     I S K+ Q  W Q  ID    +     T L  KE  ++K+ S 
Sbjct: 791  RSDLQSKIQEIE----SIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSE 846

Query: 870  INEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAE 929
            I     +L++ + +   Y  L    DA  L  TLR+ELE++ +QL D+ SQI        
Sbjct: 847  IENLDKELRKTKFQ---YKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQI-------- 895

Query: 930  QSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQ 989
                      QA+EE    ++  +I L+NE   L  T    + +++    E + ++ +  
Sbjct: 896  ----------QAYEEIISSNENALIELKNE---LAKTKENYDAKIELEKKEKWAREEDLS 942

Query: 990  TERNATMEEISKLQ---------MVKESVDRTKADYEEKIAMIQKDLEMQT--QYANESQ 1038
              R   + EI  LQ          V++S ++ + + E    MI+K  +M T  Q   + +
Sbjct: 943  RLR-GELGEIRALQPKLKEGALHFVQQS-EKLRNEVERIQKMIEKIEKMSTIVQLCKKKE 1000

Query: 1039 RS-YELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEY 1097
             S Y+  ++++ D+S+ +  L  +A   +++L   K+    A + L   E+ W E+K +Y
Sbjct: 1001 MSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADY 1060

Query: 1098 EDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDSSD--------LLISLRRERD 1149
            E +L    ++ + L  +N +L ++++        D + ++ D        L  +LR ER+
Sbjct: 1061 ERELISNIEQTESLRVENSVLIEKVD--------DTAANNGDKDHLKLVSLFSNLRHERN 1112

Query: 1150 MLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQ 1209
             LETKL     E   +KQ+ D  +  I DL    +  +     SA ++++ ++I KE+ Q
Sbjct: 1113 SLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQ 1172

Query: 1210 LHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNG-IKIKEQELIQ 1268
            +++L+E+N  L+    S K   +  +   ++ NDR    Q  IS LQ   I+ KEQ  I 
Sbjct: 1173 VNILKENNAILQK---SLKNVTEKNREIYKQLNDR----QEEISRLQRDLIQTKEQVSIN 1225

Query: 1269 SKE------EAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAE 1322
            S +      E E+ K R QD+  + +    ++  KL  EI+D+K +L + ++        
Sbjct: 1226 SNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENA------- 1278

Query: 1323 KDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEER 1382
              D E+KF R++ QA ++L+ASK+++ +L++E+N++   K ++E DL             
Sbjct: 1279 NADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLH------------ 1326

Query: 1383 LQVVTQEAETKEQTF-NSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVEM 1441
                          F N+++  L   L + ++Q E+ S+  + +       ++L E +E 
Sbjct: 1327 --------------FENAKVIDLDTKLKAHELQSEDVSRDHEKDT-----YRTLMEEIES 1367

Query: 1442 LNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSK 1501
            L  ++Q  +   S++                    + LK   E EK+++I ++ KE    
Sbjct: 1368 LKKELQIFKTANSSSDAF-----------------EKLKVNMEKEKDRIIDERTKE---- 1406

Query: 1502 FEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDIDALKNEWEKEYE 1561
            FE + +   N                           + S+     DI+ LK EW KEYE
Sbjct: 1407 FEKKLQETLNKS-------------------------TSSEAEYSKDIETLKKEWLKEYE 1441

Query: 1562 KQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLA 1614
             +T             RIRLP++++I KI+  RK  LEE F +K+ E A  L 
Sbjct: 1442 DETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLT 1494

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  349 bits (896), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 449/1677 (26%), Positives = 815/1677 (48%), Gaps = 224/1677 (13%)

Query: 9    RVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFK 68
            +++++L V  + +Q +N  +L  + ++++   + + E  R+   +D++KSQ       + 
Sbjct: 4    KISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQ-------YY 56

Query: 69   IHISQLAKALEDGKDERLHFEEEKRRLIE----GNSQVTKRIIELEQEIEV--------- 115
              IS+L + L +  +E+   ++E  RL        S+  ++I  L +++           
Sbjct: 57   TRISKLNELLGESSEEKNVSKKELSRLHNLLKNERSKCARKIDALNKQLNASKNTITKLN 116

Query: 116  -ERQQKELADASKQDIAESLNEKIEELSSTKAKLNEAQGA-NKELRQKVVNTETELQTQQ 173
             ER  KE A+  K   AE  N  +E           A G  NK LR+K++  E  LQT +
Sbjct: 117  DERGVKEEAEVLK---AEHQNNDLER---------SALGHENKLLRRKLLEMENILQTCK 164

Query: 174  A--LELRSKSEILRMEQEITLLRENNDWLTNQL---NTKTVQLNEFRESTISELQDSQLK 228
            +  L L+ K + +  E+E+ L  EN  W+  QL   + KT+  +  R S +  L++   +
Sbjct: 165  SNTLSLKLKYDTVVQEKELIL--ENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEE---Q 219

Query: 229  VSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRM 288
            ++  +++ E   T+NQ L      L   +EQK+ E K +KD  N  K + +KEM+L++ M
Sbjct: 220  LNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNM 279

Query: 289  IDALEKHMESLKKEMDAT---KNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLK 345
             D L   + S +K    +   K+N D    ++     ++++L   K +L+ S+  C +L+
Sbjct: 280  NDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQ--HANVVDKLIDTKLQLEKSKDECQRLQ 337

Query: 346  ETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVE 405
              + +       ED    + T + + SV+   K++ D+  LK+QL+ E+ QK +L+ Q+E
Sbjct: 338  NIVADCIE----EDEAAFDNTHNVDPSVN---KVFSDIKALKRQLIKERNQKFQLQNQME 390

Query: 406  AFVVELEHKIPVLNSFKERSEMLERELNEVTILLE--STGKDRDQKSSQLDYLKATVKSY 463
            +F+ ELE K P L SFKER+E LE+EL   T LLE  S  K +D+K  +L  L+  + + 
Sbjct: 391  SFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEK--ELTSLRQKINNC 448

Query: 464  ETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQG 523
            E  I SL KQR+DLA Q++ LL+N S   +   PLS +EL  +K L  S ++    D+Q 
Sbjct: 449  EANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQI 508

Query: 524  IITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETIL 583
            IIT+RLVEF +  ELQ+KN ELL+ +R LAD+LE  E +    +  LE++T++EAK+ I+
Sbjct: 509  IITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAII 568

Query: 584  TLHDHAQNLENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRL-- 641
             L      LE+++ ILS+ERD+YK L+ +A+       A       N  K+K+LE+ L  
Sbjct: 569  ELEHVNSTLESRIDILSRERDSYKLLA-SANGNKIYADAANKTEAANLKKIKELESELSL 627

Query: 642  -----TAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLEL 696
                 +AV+Q             SN +  L E S NF      + LA ++ NLLQ+ ++ 
Sbjct: 628  TKVENSAVVQRLNKELLTCKKSQSNGQIALQEFS-NF------KVLAIEKENLLQTRIDD 680

Query: 697  SKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKV 756
             K + E  ++RSS    I       ++ET  S  K K+   S+  E+S L  +   +  +
Sbjct: 681  LKTKLE--KQRSSAPSSI--HGSIGSEETELSQYKNKT--KSLMCEISNLSKKNTDLRCM 734

Query: 757  QKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEI---ELSGS 813
            ++ L  + ER  KE ++ ++ + + +T   E+++     Q  Y  K++ LE    EL+  
Sbjct: 735  KESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNR 794

Query: 814  LE-RLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINE 872
            L  +++EIE     + ++K  Q  W Q  ID          T L EK+  ++K+      
Sbjct: 795  LHSKVQEIE----TLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKL------ 844

Query: 873  QSAKLKEAEARAQS----YTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLA 928
             S ++K+ E   Q     Y +L+N  DA  L   L++ELE+  + L D++SQIE ++ + 
Sbjct: 845  -SLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEII 903

Query: 929  EQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILN---DQVKDLNNEIFHQK 985
                 ++ E++    + ++E +    +L+ E N  +  ++ L    D+++ L  ++    
Sbjct: 904  STDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGA 963

Query: 986  SEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELEL 1045
                 +      +  ++Q + E +D+        I  + +++E            Y+ +L
Sbjct: 964  LRLVQQSEKLGNQTQRIQAMNEKIDKMTT-----IVELHQEVETS---------QYQAKL 1009

Query: 1046 QKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLE 1105
            + + D+S  +  L  E   Y+++L+  K+      E L   E+ W E+K +YE +L    
Sbjct: 1010 KANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNI 1069

Query: 1106 QRVQELSTQNKLLYDQIELLNKTEDRDNSH-DSSDLLISLRRERDMLETKLEVALSEQTV 1164
            ++ + L  +N  L ++I+      + D  +     L  SLR ER+ LETKL     +  +
Sbjct: 1070 EQTESLRVENSALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLAL 1129

Query: 1165 LKQRLDIAKSEIEDL-NTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRS- 1222
             KQ+    +  + D+  T L   K+    S  ++++ E+IMKE+ Q+++L+E+N  L+  
Sbjct: 1130 AKQKNANLEKSVNDMQQTHLVSRKDVQC-STDIIDEFEDIMKEIAQVNILKENNTILQKS 1188

Query: 1223 ------ENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERW 1276
                  +N +  KE  +L+ ++ +    LA  +  +S   N + + E E+       E+W
Sbjct: 1189 LKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEI-------EQW 1241

Query: 1277 KSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQ 1336
            K R  ++  + +    +E  KL  EI+D+K +L   ++          D   KF R++ Q
Sbjct: 1242 KQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNA-------NADLNDKFNRLKKQ 1294

Query: 1337 ARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQT 1396
            A ++L+ASK+++ +L++E++++ + K+++E  L   ++   ELE                
Sbjct: 1295 AHEKLDASKKQQTALTNEVDELKDMKNELEESLHSEESKVLELE---------------- 1338

Query: 1397 FNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNA 1456
                 +KL++ L    VQ E  SK ++ +       K L E +E+L  ++Q  +  +   
Sbjct: 1339 -----AKLKKHL----VQAEGVSKDQEEDTS-----KPLMEEIELLKRELQVFKETS--- 1381

Query: 1457 QKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSXXXX 1516
                          D+   ++ +K   EAEK ++I++K  E   K   E+ +  N+    
Sbjct: 1382 --------------DSSDTIEKMKEIMEAEKNKIIEEKTTEFERKL--EEATGKNT---- 1421

Query: 1517 XXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXX 1576
                               T+++        +++ LK +W K+YE++T            
Sbjct: 1422 -----------------GATIENGE------NMEELKKQWLKQYEEETMRRIKEAEENLK 1458

Query: 1577 XRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAELNA 1633
             RIRLP++++I KI+  RK  LE+ F+       +KL    G+  ++ +K   E+NA
Sbjct: 1459 KRIRLPSEERIQKIISKRKEELEQEFQ-------RKLKANSGSFTLSSDKKENEVNA 1508

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  343 bits (879), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 419/1502 (27%), Positives = 776/1502 (51%), Gaps = 159/1502 (10%)

Query: 214  FRESTISELQDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNF 273
             + S+ +EL++++  + ++E + E+    N+  K+  + L   +  +L + K ++++ N 
Sbjct: 214  LKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNE 273

Query: 274  SKQELTKEMSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFTEKERDELIEELNAVKYR 333
             K+  T+EM+L Q   D L++H+E LK   + TK     +   EK+R  L+ EL  +K  
Sbjct: 274  LKESFTREMTLTQHENDLLKEHIEYLK---NTTKETTGGTSTLEKDR--LLHELVDIKKS 328

Query: 334  LDASESNCIKLKETIDE-LTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVI 392
            L+ SE   + L + I++ LT N   E+S   N                 +L +LK+QL+ 
Sbjct: 329  LEKSELENVHLNDFIEQYLTEN---EESTSDN-----------------ELVLLKEQLIK 368

Query: 393  EKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQ 452
            EKRQKD L+ QVE FV+ELE+++P +NS K+R++ LE+EL ++T LLE T ++ D +  +
Sbjct: 369  EKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKE 428

Query: 453  LDYLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNS 512
            L      +K     I  L  QRVDLAHQ+Q+LL+N  +K      L+ +E+ F++ +  S
Sbjct: 429  LTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKS 488

Query: 513  QEITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLED 572
            +     SD+Q II++RLV+F  +  LQ++N ELL+T RNLA++LE  + ++  +I     
Sbjct: 489  RNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSVQKI----- 543

Query: 573  ETVREAKETILTLHDHAQNLENQLVILSKERDAYKALSVNASSGTNTP-KAITYPSPDND 631
             T  E+KE I  L +    L ++L  L KE+DAYK LS+  ++G  TP + +       +
Sbjct: 544  -TRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSL-QNTGEQTPTEELRSQLQKKE 601

Query: 632  DKVKDLETRLTAVIQE-AENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLL 690
            +++  LE R++++    AE  AK  +     L+K+ Y+++     E + R +AE +  +L
Sbjct: 602  EQLTKLE-RMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKML 660

Query: 691  QSTLELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSE- 749
            + +LEL  ++ +   K+    + +L   +          IK      + Q+++SIL+ E 
Sbjct: 661  EDSLELLHKKYDLAVKKYEHYETLLNDHNAEN-------IKHSRENETTQAKISILQKEI 713

Query: 750  ---KQFMAKVQKELKAENERFSKESVEYKVLIAQLQTLQREREM---LLKETQNSYKEK- 802
               KQ + +  K+ +    + +  + E + L ++L T++ E E    L++E +  YKE  
Sbjct: 714  ESYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHD 773

Query: 803  ------LRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTL 856
                  L+K +I+L   ++ +++ E       + K  Q NW+Q+++D LT       TT 
Sbjct: 774  SISERLLKKSKIQLEDKIKEVKDFE-------AKKNSQINWYQKRLDSLT-------TTN 819

Query: 857  EEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSD 916
            ++ + +L K  + IN Q  K+ + E      T+  N + + +L   + Q+ EK+  +L +
Sbjct: 820  DKLQVELNKELTKINIQRLKISDLEK-----TLSQNTNGSSSLPR-VDQDFEKLKNELKE 873

Query: 917  SYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKD 976
               +I  ++ L   + ++ N + +   +  K+ Q     +E  + QL   +  L  +   
Sbjct: 874  KQLEINQYRDLLNLAEETKNRLQK---DLNKQRQIVDDAMEG-KEQLDQQLAELTQECSS 929

Query: 977  LNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANE 1036
            +N+ +  QK++ + ++    ++ ++ + +K S+    +  E KI  ++ ++  +T+   E
Sbjct: 930  MNSLLQKQKAKCEDDQKIIQDKATETENLKNSL----SSLENKITTLENEMVEKTKSFEE 985

Query: 1037 SQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNS--EKLWNEQK 1094
             + +Y+ +L K ++ S  I  +  E ++YK+ L+ LK     A E+  ++  +KL +E K
Sbjct: 986  KENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIA-AYEDAISAYRQKLLDE-K 1043

Query: 1095 TEYEDKLSVLEQRVQELSTQ-----NKLLYDQIELLNKTEDRDNS--HDSSD---LLISL 1144
              +E ++   ++ +  L+ Q      K  +   E    + D D +  +D+SD   L+++L
Sbjct: 1044 FNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILAL 1103

Query: 1145 RRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIM 1204
            RRERD L+ KL+++  E   L+++++  K+ +++       +++  S      EQ +  +
Sbjct: 1104 RRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAV 1163

Query: 1205 KELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQ 1264
            K+L++L+ L+E+N  L+ +     KE + + ++L+   + + PL+  +  L+N I  K+Q
Sbjct: 1164 KQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQ 1223

Query: 1265 ELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQT-TKDTLQSVIAEK 1323
            +L    EE ERWK RS++IL K +++D EEH KL EE++ +K +L T TKD         
Sbjct: 1224 QLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDN-------- 1275

Query: 1324 DDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERL 1383
            +D   +F R++ QA ++L+A+K +  SL++EI  + +AKS++E DL          EER 
Sbjct: 1276 EDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLD---------EERK 1326

Query: 1384 QVVTQEAETKEQTFNSQ-LSKLQEDLHSIQVQMENASKTEQNNAD----SDEKIKSLTET 1438
            ++   E++ K++  N   ++ L+++L      +EN+ K E+N  +    S E  K LTE 
Sbjct: 1327 RIQEVESQLKQKPDNPDVITALEKELSD---SVENSKKIEENLQETVNSSLELNKKLTEE 1383

Query: 1439 VEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKEL 1498
            V  L S+++ L+    N   +++      IN +T   + +LK  FE EK +LI       
Sbjct: 1384 VNSLKSQLETLK----NQNGVISVADGSAINSET---IAHLKESFEVEKTELIT------ 1430

Query: 1499 RSKFEAEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDIDALKNEWEK 1558
                     +                          +     S+P   IDI+ +K+EWE+
Sbjct: 1431 ---------TLKEEFKKQLEEEKKKLLEEKEKEYYDSKPTGGSEP---IDIEKMKSEWEE 1478

Query: 1559 EYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIG 1618
            + E+               RIRLP+++KI++++E R+   E   E +   K Q L  E  
Sbjct: 1479 KQEEIIMQRIADAEENLKKRIRLPSEEKINRVIEKRRK--ELEEEYEKKLKRQGLTTETA 1536

Query: 1619 NDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQ 1678
             +    E+ R E+   +  +R +F+ +LAE+K+K+F EGKQQ  +K   LE K+  LE Q
Sbjct: 1537 IE----EELRKEV---ERELRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQ 1589

Query: 1679 KS 1680
             S
Sbjct: 1590 AS 1591

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  332 bits (851), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 454/1755 (25%), Positives = 827/1755 (47%), Gaps = 236/1755 (13%)

Query: 9    RVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFK 68
            ++++FL V  + +Q IN  VL ++ +K+++    + E  R+   +D++KSQ       + 
Sbjct: 4    KISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQ-------YY 56

Query: 69   IHISQLAKALEDGKDER-------LHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKE 121
              IS+L+K L +  +++        H +++   L++   +  ++I  L ++++  R   +
Sbjct: 57   SRISKLSKLLNESSEQKNIASKELSHLQDQ---LMQDRERCRRKIDALNKQLDSSRDAIK 113

Query: 122  LADASKQDIAESLNEKIEELSSTKAKLNEAQGA----NKELRQKVVNTETELQTQQA--L 175
              +  K    ES+  +     S    +N  Q      NK LR+K++  E  LQ  ++  +
Sbjct: 114  RLNDEKDAKEESMIRQ-----SKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSV 168

Query: 176  ELRSKSEILRMEQEITLLRENNDWLTNQL---NTKTVQLNEFRESTISELQDSQLKVSNM 232
             L+ K + +  E+E+ L  +N  W   +L   N KT+     + S I  L++   K+   
Sbjct: 169  SLQLKYDTIVQEKELML--QNKKWTEEKLSSYNNKTLADESTKASRIRNLEE---KLYQA 223

Query: 233  ESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDAL 292
            +++ E A + +Q L      L   +E+K+ E K +KD     K E +KEM+L++ M D L
Sbjct: 224  QADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLL 283

Query: 293  EKHMESLKKEMDATKNNMDSSYFT-EKERDELIEELNAVKYRLDASESNCIKLKETIDEL 351
               + S +++  + +   D      + + + + +EL   K +   S+  C +L+  I + 
Sbjct: 284  SSQLASFERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDF 343

Query: 352  TSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVEL 411
                  ED    +T  +S      + KL+ D+ +L+KQL+ E+ QK +L+ Q+E F++EL
Sbjct: 344  VQ----EDKATVDTNGASH----TVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILEL 395

Query: 412  EHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLS 471
            EHK P L SFKER++ LE EL   T LLE+    + +   +L  L+  + S E  I  L 
Sbjct: 396  EHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLV 455

Query: 472  KQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVE 531
            KQR+DLA Q++ LL+N S   +   PLS ++L  ++ +  S      +D Q II++RLVE
Sbjct: 456  KQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVE 515

Query: 532  FRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQN 591
            F ++ ELQ+KN ELL  IR LAD+LE  E +  + +  +E +T++EAK+ I+ L +    
Sbjct: 516  FNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMK 575

Query: 592  LENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENN 651
            +E+++ IL +ERD+YK L+ +  +  N   A  +    ++ K+K+LE  L++   E+   
Sbjct: 576  MESRINILLRERDSYKLLASSKENNVNV-NAKNFTEISHEKKIKELEAELSSTKVESSAV 634

Query: 652  AKEWSSENSNLRKKLYE---ISLNFES----EKTSRTLAEDRLNLLQSTLELSKRQCEEL 704
             +    E +  +K L +    S +FE+     K   ++ E R+N L++ LE  K      
Sbjct: 635  IQNLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTDLEKQKLSVPSF 694

Query: 705  QKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAEN 764
                         QD + +++ + L+++++    +  E+S LK E      +++ L  + 
Sbjct: 695  V------------QDNKVRDSTE-LLQSRTKTEILMHEISSLKKETANSMVLKESLTRDL 741

Query: 765  ERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEI---ELSGSLERLEEIE 821
            ER  KE +       QLQ   +E E+ L E + ++  K  K +    +L  SLERL  IE
Sbjct: 742  ERCCKEKI-------QLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERL-RIE 793

Query: 822  KNTTG-----IASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAK 876
              +       + S+K+ Q  W Q  ID    +     T L  KE  +  + S I     +
Sbjct: 794  LKSKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNE 853

Query: 877  LKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVN 936
            L+E + +   Y  L+N  DA  L   LR+ELE+  L+L D++SQ+  ++ +   + +++ 
Sbjct: 854  LRENKLK---YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALK 910

Query: 937  EVSQAFEEAQKESQKTIITLE-NERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNAT 995
            E++     + KE     I LE  E+   +  +++L  ++    +EI   + + +      
Sbjct: 911  ELNSQL-ASMKEDYDARIELECKEKLANEEELSLLRREL----DEIRSLQPKLKEGTVCL 965

Query: 996  MEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTI 1055
            +++  KL+   E +   KA    KI  +  ++++   Y  E    ++  ++ + ++S+ +
Sbjct: 966  VKQSEKLRNQAEKIQEMKA----KIDKMNWNVQV---YKKEKTSQFQSIMKANKELSELV 1018

Query: 1056 TSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQN 1115
            T L  EA   + +L+ LK+      + L   EK W E+K +YE +L    ++ + L  +N
Sbjct: 1019 TRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVEN 1078

Query: 1116 KLLYDQIELLNKTEDRDNSHDSSDL---LISLRRERDMLETKLEVALSEQTVLKQRLDIA 1172
             +L ++I  +  TE  D + D   L     +LR ER+ LETKL     +  ++KQ+    
Sbjct: 1079 SVLIEKIGSV--TEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASL 1136

Query: 1173 KSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECD 1232
            +  I DL       +     SA ++++  +I KE+ Q++LL+E+N  L+       K   
Sbjct: 1137 EKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQ-------KSLK 1189

Query: 1233 NLKSQLQECNDRLAPLQSSISSLQNG-IKIKEQ------ELIQSKEEAERWKSRSQDILH 1285
            N+  + +E  + L   Q  +S L++  IK KEQ      +++  + E ++ K R  D+  
Sbjct: 1190 NVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLST 1249

Query: 1286 KYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASK 1345
            +   +  +   KL  EI+D K +L   ++T       K + E+KF R++ QA ++L+ASK
Sbjct: 1250 QQREVQKKTIEKLNSEISDFKAKLLDAENT-------KTELENKFNRLKKQAHEKLDASK 1302

Query: 1346 EKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNS-QLSKL 1404
            +++ +L++E+ ++   + ++E DL           +  + V  + E KE T  S  L + 
Sbjct: 1303 KQQTALTNELKELKAVRDKLEQDLN---------SKNFKTVDLDTEPKEHTVQSGDLLRD 1353

Query: 1405 QEDLHSIQVQMENAS--------KTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNA 1456
            QE + S+ +  E  S        K   N++D+ EK++   E                   
Sbjct: 1354 QEKVASLPLIEEIESLKRELQVFKNANNSSDAFEKLRDNME------------------- 1394

Query: 1457 QKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSXXXX 1516
                 E    +INE TK        EFE + E+++        SK ++  + A NS    
Sbjct: 1395 -----EEKNKIINERTK--------EFEKKLEEIV--------SKSKSTGKVADNSE--- 1430

Query: 1517 XXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXX 1576
                                           +I+ LK EW KEYE++T            
Sbjct: 1431 -------------------------------NIETLKKEWLKEYEEETIRRIREAEENLK 1459

Query: 1577 XRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAELNALKD 1636
             RIRLP++++I KI+  RK  LEE F+ K+ E A          ++T    R E N   D
Sbjct: 1460 KRIRLPSEERIQKIISKRKEELEEEFQRKLKENAS---------SLTFSCDRKETNDDPD 1510

Query: 1637 -----------SMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIKPV 1685
                       S R     D  + K    +E  ++    + F +S+  ++ ++ S +  V
Sbjct: 1511 EDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSMNKENSALVKV 1570

Query: 1686 ENDTSNMSAAFQAPV 1700
             +D +  + +F  P+
Sbjct: 1571 NDDKAASTFSFGKPL 1585

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  277 bits (709), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 400/1640 (24%), Positives = 773/1640 (47%), Gaps = 207/1640 (12%)

Query: 103  TKRIIELEQEIEVERQQKELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKV 162
            T R +E   E+ VE  +  L  +S  D++  + E+ EE+   + +++   G    LR ++
Sbjct: 42   TVRTVEGRMELIVE--ENRLLKSSNLDMSRIVTERAEEIGRLRDEVSTVTGQTSALRAEL 99

Query: 163  VNTETELQTQQALELRSKSEILRMEQEITL-----LRENNDWLTNQLNTKTVQLNEFRES 217
             N + +L+      L+ K   L+ E++ T+     L+  N  L  ++  +  +L   R+ 
Sbjct: 100  ENLQNDLEL-----LKDKDLALQSERDSTVALLDGLKLENSALRAEIE-QAKELASIRQH 153

Query: 218  TI-SELQDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQ 276
               ++L      + + E EL +A++    L      L ++L Q+ ++ +++ D     + 
Sbjct: 154  DYEADLDSKTGALVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQD 213

Query: 277  ELTKEMSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDA 336
            E T E++L++     L++ + SL+KE     +  +  Y      +E+     A++ R   
Sbjct: 214  EYTDEINLQKHRARLLQEQVASLEKEAKLVGHETEPEYEIPPPGEEV-----ALQQR--- 265

Query: 337  SESNCIKLKETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQ 396
              S+ I    ++D L +         GN   S   S     +L  ++ +L  +L  E   
Sbjct: 266  --SHSI----SMDSLLT---------GNDETSHSMS-----ELNNNISILSNRLKRETLS 305

Query: 397  KDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYL 456
            K +L+ QV  FV ELE   P++ SFK++SE  + +++++ + LE   KD++    +++  
Sbjct: 306  KQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQY 365

Query: 457  KATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNS---Q 513
            K  ++    Q   L ++R DLA Q+QYLL+N  +K  D  PL++ E  ++K + N+   +
Sbjct: 366  KKQLEQISGQDKILRRERFDLARQLQYLLLNGFVKDSDD-PLTSSEFSYIKEILNTDPEE 424

Query: 514  EITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDE 573
              T ++D+Q II+ R+++F+S+VELQQ+N  LLS +R L+D  E  E + +S   +   E
Sbjct: 425  GNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDSI---E 481

Query: 574  TVREAKETILTLHDHAQNLENQLVILSKERDAYKAL-SVNASSGTNTPKAITYPSPDNDD 632
             + EAK+T+L L  +  +LE ++  L+ +  A +   S+      N+  +       + +
Sbjct: 482  AINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLS-------DGN 534

Query: 633  KVKDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQS 692
             ++ L+ +  +++ E+        S+ +NL++   +++   ES   S+ L EDRL + Q 
Sbjct: 535  NIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQD 594

Query: 693  TLELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQF 752
             L+LSK +   L+ R  +    L +++  T +T+   +   + L  IQ +L     EK  
Sbjct: 595  MLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDI 654

Query: 753  MAKVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSG 812
            +   Q  ++ +  +  KE   ++ LI QL+ LQ+ ++  LK+ Q S + K+  LE+E + 
Sbjct: 655  LQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTE 714

Query: 813  SLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTS--EAAQQK-----TTLEEKEAQLQK 865
               +++  E + +   +N + +  W+Q K D L+   +A  +K     +T+E    + Q 
Sbjct: 715  LRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQT 774

Query: 866  MQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHK 925
            +   + E ++K K  EAR         VDD   L   L  EL     +L+D+  ++E   
Sbjct: 775  LDILLQEANSKNKLLEAR-------ETVDDVNKLTGALETELATSRTRLTDTSRELE--- 824

Query: 926  TLAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQK 985
             ++  +++      +   E Q E       LENE   L+  + IL D       E+ H  
Sbjct: 825  -ISSNTIRQYQSEIKVLNERQSE-------LENENKHLRDEIAILRD-------ELTHNG 869

Query: 986  SEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELEL 1045
             E++ E+ A M+++S L++ +  + + + DY  +I  ++ DL+ Q     E + +++ E+
Sbjct: 870  GEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEV 929

Query: 1046 QKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVL- 1104
            ++       + +  TE  +Y+++LE ++ +            K++ E++ E E ++ +L 
Sbjct: 930  RE-------VQNRNTE--TYRNELELVEIRQT----------KVFVEKEKELESRIKILN 970

Query: 1105 ------EQRVQELSTQNKLLYDQIELL-----NKTEDRDNSHDSSDLLISLRRERDMLET 1153
                  ++R+++ S +  LL +Q++LL     +   D   S + +DL+  L  E+  LE+
Sbjct: 971  EQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLES 1030

Query: 1154 KLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLL 1213
            KL  + SE+  L+++L   +SEI  LN    Q K     +A +  +     + + QL  L
Sbjct: 1031 KLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEV--AAEVNNESGRAEEHIAQLESL 1088

Query: 1214 RESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEA 1273
            +ESN++L +E    +     + ++L E   +   ++S +   +N +  K+ +L++ + E 
Sbjct: 1089 KESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTEC 1148

Query: 1274 ERWKSRSQDILHKYERIDPEEHGK--LKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQ 1331
             R K+ S D+        P+   K    E +  +++ + T  + + ++     + E +F 
Sbjct: 1149 SRLKATSHDM--------PQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFG 1200

Query: 1332 RIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQ-VVTQEA 1390
            R++ QAR+RL+ASK    SL   +  + + K+ ++  + + K    EL  ++Q  +   A
Sbjct: 1201 RLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSA 1260

Query: 1391 ETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELE 1450
              KE    ++L+ +      I+ ++   SK+      S++   +L E +E L  ++Q L+
Sbjct: 1261 VMKE--LKTELAAVMSKNKDIEAELNETSKS------SNQLTTALNEEIESLKHEVQYLK 1312

Query: 1451 AEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIK----DKEKEL---RSKFE 1503
             EAS+A+        P  NE+   +V++++  FE EK   +K    D E  L   R K +
Sbjct: 1313 -EASSAE--------PQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLK 1363

Query: 1504 AEKESAWNSXXXXXXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDIDALKNEWEKEYEKQ 1563
             E E+                          + V  P       DI+ L+ +WE      
Sbjct: 1364 REMEALEKEKDSLVMEKTRLGEENTALMKARSDV--P-------DIETLQKQWE------ 1408

Query: 1564 TXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAIT 1623
                          R+ L  ++K D+++ A+   LEE F+ +V  K +            
Sbjct: 1409 ---------ASNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEK------------ 1447

Query: 1624 LEKHRAELNALKDSM----RKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQK 1679
                  ELNALKD +    +   E  L  +K+++FEEGKQQ ++K+  LE KI  LE + 
Sbjct: 1448 ------ELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAES 1501

Query: 1680 STIKPVENDTSNMSAAFQAP 1699
               K      S+MS +  AP
Sbjct: 1502 KATKS----GSDMSVSEDAP 1517

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  233 bits (594), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 281/1108 (25%), Positives = 575/1108 (51%), Gaps = 69/1108 (6%)

Query: 126  SKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILR 185
            +K ++ + L E+I ++ + KA LN+    NK L +       E++T +  +L  ++++ +
Sbjct: 73   TKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDK 132

Query: 186  MEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQK 245
            +   ++L  +      ++  +K      +++    E Q+    ++ +++EL +    N +
Sbjct: 133  VTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAE 192

Query: 246  LKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDA 305
            L +    L + L  K+SE K +++    S  +   E  L+ ++I+AL+  +++L++++++
Sbjct: 193  LFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLES 252

Query: 306  TKNNMDSSYFTEK-ERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVGN 364
              +       T+K ++ EL+ ++  +  +L+ SE   + L  +++E   NI  E+S   +
Sbjct: 253  LSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEF-QNIPEEESSSVS 311

Query: 365  TTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKER 424
            + AS   + ++   L GD+ +L+K  + E++QK +L+ Q+   + ELE  +P L+S+KER
Sbjct: 312  SHASGRNNSAL--SLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYKER 369

Query: 425  SEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYL 484
            S  LE+ELN   ILLE   K+   KS++L+  ++   +  + I SL+ QR  LA Q++YL
Sbjct: 370  STFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYL 429

Query: 485  LV----NESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQ 540
            L+    NE++    G  L  ++L+ +     +      SD++ I+ +RL +F++V ELQ 
Sbjct: 430  LLIIQNNETL----GSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQN 485

Query: 541  KNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILS 600
            +N +LL   R LA + E+ E  N  QI   EDET+ +AKE IL L +++Q LE+Q+  LS
Sbjct: 486  RNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELS 545

Query: 601  KERDAYKALSVNASSGT--NTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSE 658
             E      L+V     T   +  A++    D      DL  +L+A ++ +++     +SE
Sbjct: 546  DE------LAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSE 599

Query: 659  NSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQ 718
              NL +   +++++ + EK++R LAEDR NLL+  + L K + EELQ+  + LQ  +  +
Sbjct: 600  IENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDK 659

Query: 719  DKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLI 778
            +K+   +    I  KS LS+ ++E++ L++E +   + Q  L+ + E    E    ++ +
Sbjct: 660  EKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTV 719

Query: 779  AQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWF 838
             Q+ +L  E + LLKET++ Y +KL+   ++ + +  +L+ +++  + + S  + +  W+
Sbjct: 720  TQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWY 779

Query: 839  QEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQN 898
            +  ID L +   +    L++KE ++++   T+              Q+   L+N  D   
Sbjct: 780  KATIDDLKANVFELNEELKQKEEKIEEFSKTL-----------ENVQNELTLANSKDVSE 828

Query: 899  LVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLEN 958
                L +EL +V  QL  S  +++ ++ +   S +S    S  +E+  K     + +   
Sbjct: 829  EKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELR 888

Query: 959  ERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEE 1018
            ER  LQ  ++ L  ++    +E+        T  N T+   S+L++  +S+   +  +++
Sbjct: 889  ERTTLQENLSTLQARMVVQQDEL--------TSNNNTL---SELRVSYDSLLLEQKTFKD 937

Query: 1019 KIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKS------DLETL 1072
            K A ++  + ++T   +   +SYE  +Q+++++SK +  LR E ++  S      DLE  
Sbjct: 938  KEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTSNGEKEGDLEDT 997

Query: 1073 KTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRD 1132
            ++        +K  + +W+E+K  +E +++ L +R+ EL  +N+ L  ++E    ++D+ 
Sbjct: 998  ESI-------IKKGQDVWDEEKKVFEVQITNLNERLSELLEENESLLARLE----SQDKG 1046

Query: 1133 NSHDSS--------DLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLS 1184
            N+  S+        + L +LR ER  L  KL  A  E+  ++ +L   +  + +   +L 
Sbjct: 1047 NNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFELK 1106

Query: 1185 QVKNSSSESAHLLEQQENIMKELDQLHL 1212
            ++K+   E + L + + +I++ L  +HL
Sbjct: 1107 KIKSQIFELSSLPQNEHDILRHL--VHL 1132

 Score = 73.2 bits (178), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 70/102 (68%), Gaps = 3/102 (2%)

Query: 1578 RIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAEL-NALKD 1636
            RIRLPT++KI+ I+E RK+ LE SFE+K+ E+A+ L     +D I  +K   E+  + ++
Sbjct: 1242 RIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDDKI--KKIYKEIEESGRE 1299

Query: 1637 SMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQ 1678
            +++++F+  L  +++K+FEEGKQ V +K  FLE KI  LE Q
Sbjct: 1300 TLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  220 bits (561), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 375/1482 (25%), Positives = 663/1482 (44%), Gaps = 236/1482 (15%)

Query: 234  SELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALE 293
            SE++  R SN  L  S+  ++ +L  K + NK + D+ +  + +  +E++ + ++   L+
Sbjct: 167  SEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLK 226

Query: 294  KHMESLKKEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTS 353
            K + SL  E+    N  ++    E                               D+   
Sbjct: 227  KQVNSLHSELG---NGGETPAHAEPN-----------------------------DQFAK 254

Query: 354  NIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEH 413
                 + E+ N     E+ + ++ +    +  L+K L+ E+++   LK Q+E+FV+ELEH
Sbjct: 255  QSSQHEEEISNYKEQVEELLGILGQGAPSIAHLRKLLLKERKENVSLKKQMESFVIELEH 314

Query: 414  KIPVLNSFKERSEMLERELNEVT--ILLESTGKDRDQKSSQLDYLKATVKSYETQIASLS 471
            ++P L   +++++ ++++L+  T  ++ ES  K R Q+  +L   +  V         L 
Sbjct: 315  RLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQR--ELSSSRQKVDHLNQIFHKLR 372

Query: 472  KQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVE 531
             QR DLAHQIQ+LL   ++ S D   L   EL F+K +  ++      D+Q I++DRL+ 
Sbjct: 373  VQRSDLAHQIQFLL---TVNSSDT-VLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLR 428

Query: 532  FRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQN 591
            F ++ ELQ++N +L+ST+R+L D++E  EA+N S +      T+  AK  I  L      
Sbjct: 429  FDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNAQ 482

Query: 592  LENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENN 651
            LE+++         ++AL      G +    I     +   K+++LE++LT V    E++
Sbjct: 483  LESEV-------KNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDV---GESH 532

Query: 652  AKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDL 711
             ++ +  N  + +   + ++N  +E+   T+  D +N  +S L   KR+   L ++ S  
Sbjct: 533  VQKINVLNKTIDRN--QSTINMLNEQIKNTVKSD-MNA-KSELIACKRENLSLTQQISTK 588

Query: 712  QDIL-------TKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAEN 764
            Q+ L        ++++  Q  +  L    +   S ++   +L  EK  M + Q+ L    
Sbjct: 589  QNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSL---- 644

Query: 765  ERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIE-LSGSLERLEEIEKN 823
              F K   E K L+ QL+T  +E E+ +     S KE  RK   E LS  +  L E  K+
Sbjct: 645  --FDKIQQESKKLL-QLETRNKELEVKI-----SGKELHRKRSEETLSSKITFLSEENKS 696

Query: 824  TTGIASNKEH-----------QYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINE 872
                 + KE            Q  W+Q+ ID+L+ +   +   + E           +N+
Sbjct: 697  LHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIE-----------LND 745

Query: 873  QSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSV 932
            +   L E     + Y + + + + QN       EL  +   L  S SQ   +K   E++ 
Sbjct: 746  KLRLLSEKSLSNKPYPVGTELKELQN-------ELNGMKAALEVSESQATLYKDTLERNQ 798

Query: 933  QSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQT-- 990
               N  + +F       Q TI  L+++   L      L +Q+ +  N+    + E+QT  
Sbjct: 799  NFYNNSTLSF-------QNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTII 851

Query: 991  -----ERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQ--TQYANESQ-RSYE 1042
                 E+ A  E+++ L   +E +   K +Y+ +I  I+ +L++Q  T+   ES   S E
Sbjct: 852  DRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKE 911

Query: 1043 LELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLS 1102
             EL  +A     I  L TE     SD+  L   ++     +K  + L  E        L 
Sbjct: 912  KELTSYA---VQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQE--------LK 960

Query: 1103 VLEQRVQELSTQNKLLYDQIELLNKTE-DRDNSHDSSDLLISLRRERDMLETKLEVALSE 1161
            +  QR++ L+ QN +LYD    +   + D + + D  +L+I+LR ERDM +++   A  +
Sbjct: 961  LANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRD 1020

Query: 1162 QTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLR 1221
              +LK+ L     ++     ++ +  N+  +   L    E IM+EL+ L   +E N+ L 
Sbjct: 1021 VKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLD 1080

Query: 1222 SENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQS----KEEAERWK 1277
                S  ++    K  LQE   RL   +S   + +N   I EQE  Q     ++E+E+WK
Sbjct: 1081 ESIKSLNED----KRTLQEEVSRLR--ESEELAKKNSSAISEQEWQQKIETYQQESEKWK 1134

Query: 1278 SRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQA 1337
               Q +                 EI +++ +L+T K  +Q    E DD   +F R++ QA
Sbjct: 1135 LMCQQMSENT-----------ATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQA 1183

Query: 1338 RDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTF 1397
             ++LNASK    SL+ E++++      ++  L   +T   + E    ++ Q  E      
Sbjct: 1184 HEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEE----- 1238

Query: 1398 NSQLSKLQEDL-HSIQVQMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNA 1456
            N Q   L+ +L HS+               DS EK+             I ++  E +  
Sbjct: 1239 NKQAKSLELELRHSV---------------DSSEKL-------------IADMTKELTTL 1270

Query: 1457 QKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSXXXX 1516
            ++   +    V  ED    ++ LK+EFE EK  LI+    EL  +FE EK+   N+    
Sbjct: 1271 KENPIQGSVNV--EDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMNN---- 1324

Query: 1517 XXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXXXX 1576
                                         + +++ L+   E+E+E++T            
Sbjct: 1325 -----------------------------NANLEELRKPLEEEWERKTLQRIEEAKENLK 1355

Query: 1577 XRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLA-GEIGN-DAITLEKHRAELNAL 1634
              IRLPT++KI++++  RKA LEE F+ KV E+A  L   E+ N  A  LEK       +
Sbjct: 1356 KHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSELSNKTADELEKE------V 1409

Query: 1635 KDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLE 1676
            ++ ++ + E D   +K+K+FEEG+QQ S+K   LE KI  LE
Sbjct: 1410 REEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLE 1451

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  202 bits (514), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 199/629 (31%), Positives = 340/629 (54%), Gaps = 59/629 (9%)

Query: 4   EP---IASRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQS 60
           EP   I  +++ F  +     + ++   L +I  K  DL K   EN  ++A +D +K   
Sbjct: 8   EPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMK---ENSFVSAAIDDIKHVY 64

Query: 61  ENKLES-----FKIHISQLAKALEDGKDERLHFEE----EKRRLIEGNSQVTKRIIELEQ 111
           E K+ +     F + +    K L++ +   L   E    EK++  + N  +   I  ++ 
Sbjct: 65  EGKINTISQKYFNLQLEN--KKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKY 122

Query: 112 EIEVERQQKELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQT 171
           ++E  ++     D +  +  E   E +  L  +K +L ++   N  L++++   E +L +
Sbjct: 123 DLEAMQR-----DHTTLEARERKTENV--LEQSKLELQDSLTENSALKEQIGVFEGKLDS 175

Query: 172 Q-QALELRSKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTI---SELQDSQL 227
             Q L L + +E  +++  + LLRENN +L  ++  K    N+   S+    S LQD QL
Sbjct: 176 MTQELWL-ANTENKKLQTGMKLLRENNLYL--EIKCKETDKNKKLYSSAEDASRLQD-QL 231

Query: 228 KVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQR 287
           ++  + SE+   ++    LK    SL   L++KL   K++ D  N SKQE  KE++LKQR
Sbjct: 232 QI--VSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQR 289

Query: 288 MIDALEKHMESLKKEMD-ATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKE 346
           + + L   + S KK+++  T  N+++         ++I+EL  +K +L  SE  C +LK 
Sbjct: 290 VNELLHNEIASYKKQIERLTSKNLETP------EKKIIQELVDLKEKLVNSEKECNELKS 343

Query: 347 TIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEA 406
           T+D+    I +++ ++ +   + +K + +          L++QLV EKR KD L+ QVE+
Sbjct: 344 TVDKY---INIDEKKLISKFGNPKKLIEI----------LRRQLVKEKRHKDTLQRQVES 390

Query: 407 FVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQ 466
           F+VELE K+P+++SFKER+  LEREL  +T  LE T K+RD K  +L  L+  + + E  
Sbjct: 391 FLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQF 450

Query: 467 IASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIIT 526
              L +QR DLAHQ+QYLL+    KS    P + +E   VK + +++     +D+  II+
Sbjct: 451 NDELLRQRSDLAHQVQYLLLCIDNKS----PFTEKEATLVKKIVSNENTENDTDSHKIIS 506

Query: 527 DRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVRE-AKETILTL 585
            RL+ F++V ELQQKN ELL T R L   LER+E E +  +++ ++  + E AK T + L
Sbjct: 507 KRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDL 566

Query: 586 HDHAQNLENQLVILSKERDAYKALSVNAS 614
             H + LE+++ I+S+ERD+YK L  N++
Sbjct: 567 EKHIKTLESKINIISQERDSYKLLVTNST 595

 Score = 77.0 bits (188), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 74/114 (64%), Gaps = 10/114 (8%)

Query: 1578 RIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAELNALKDS 1637
            R+RLP+++KI+ ++E R+ VLE+ FE K+ E    L  + GN  +T    RA++   +  
Sbjct: 1376 RMRLPSEEKINAVIEKRRKVLEQEFETKLRELG--LNAD-GNGVVT--DTRAQI---EKE 1427

Query: 1638 MRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIKPVENDTSN 1691
            +R++F  +LAEIK+K+FEEGKQQ  +K   LE K+  LE Q  T+ P +N+ SN
Sbjct: 1428 LREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ--TLSPTKNNDSN 1479

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  186 bits (471), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 143/456 (31%), Positives = 258/456 (56%), Gaps = 20/456 (4%)

Query: 395 RQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLD 454
           +Q + LK  ++ ++ ELE ++P++ +FK   E L+  LN+  +++ES   D+ +    +D
Sbjct: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268

Query: 455 YLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQE 514
            +K T+    + I +L  QR DLAHQ+QYLL++ SI++++ GPLS  E+ F++NL N  +
Sbjct: 269 SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328

Query: 515 ITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDET 574
              +SD Q +I+DRL++F+ +V LQ+KN EL  +IRNLA  LE +E+E K+  +  +++T
Sbjct: 329 QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDT 388

Query: 575 VREAKETILTLHDHAQNLENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKV 634
           + EAKETIL+L ++   L  +L I + +    +  S   +S  +  +   Y S    + V
Sbjct: 389 INEAKETILSLQEYNNVL--KLEIGTLQSKISELQSSIPNSKESEKQHFNYHS----NLV 442

Query: 635 KDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTL 694
           KDLE++L+ +   +++  +  + +  NL  +  +I +N E EK+S  LA ++L LLQ++ 
Sbjct: 443 KDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSY 502

Query: 695 ELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMA 754
           +L   + EEL  ++S L+  L +++K     ++  IK K+ L    + L++L + K  + 
Sbjct: 503 DLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNKLGLE 562

Query: 755 KVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSG-- 812
           +    LK E     K + E    I  L +  +  E  L+   + Y +K+++LE+ +S   
Sbjct: 563 EENNSLKQE----IKSNYEQ---IKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLN 615

Query: 813 ----SLER-LEEIEKNTTGIASNKEHQYNWFQEKID 843
                LER L+        + S+   Q +W+Q+K+D
Sbjct: 616 EQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLD 651

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 72/128 (56%), Gaps = 23/128 (17%)

Query: 1551 ALKNEWEKEYEKQTXXXXXXXXXXXXXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKA 1610
             LK E+E + +K+              +IRLP+++KI+ I+E++ A LEE +++K+    
Sbjct: 1094 VLKTEYEGDIQKRVAEAEEALKR----KIRLPSEEKINTIIESKVADLEEDYKKKL---- 1145

Query: 1611 QKLAGEIGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLES 1670
                  +  ++  +EK           ++++FE +L   K+K+FEEGKQQ S+K KFLE+
Sbjct: 1146 ----ETVSAESTDIEK-----------IKQEFEDNLVNAKKKAFEEGKQQASMKTKFLEN 1190

Query: 1671 KIRNLEQQ 1678
            KI  LE Q
Sbjct: 1191 KIAKLESQ 1198

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score =  181 bits (458), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 141/476 (29%), Positives = 259/476 (54%), Gaps = 30/476 (6%)

Query: 150 EAQGANK-----ELRQKVVNTETELQTQQALELRSKSEILRMEQEITLLRENNDWLTNQL 204
           EAQ  N       +  +++  + EL+  ++  L S+SE  R  ++  L+RE+N WL   L
Sbjct: 86  EAQAPNNATSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHL 145

Query: 205 NTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSEN 264
              T +L   ++S I ++++   ++ N+  E+ I + +N  L      L E +++KL E 
Sbjct: 146 VKTTEELMTQKQS-ILKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEI 204

Query: 265 KEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFTEKERDELI 324
           K+  D+Y+  +QE   E+ LK R+  +LE  ++ +++E   +  N D++   E ++  ++
Sbjct: 205 KQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQE--KSIQNEDNTSRAESQK--IM 260

Query: 325 EELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLG 384
           E+L   + +L  S + C +LK  ++E  +++  E S   +        V           
Sbjct: 261 EQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYSSSSSLLKKELLKVK---------- 310

Query: 385 MLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGK 444
                      QKD L+ QVE F+ ELE K+PV++S +++++ LE+EL++VT L++    
Sbjct: 311 ----------EQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISI 360

Query: 445 DRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQ 504
           +R+    +    K   +  +  I +L+ QR DLAHQIQ+LL+    ++     LS +E  
Sbjct: 361 ERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETD 420

Query: 505 FVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENK 564
           F++ LT +    + +D+Q II++RL++F  + ELQ++N ++L+T+R+LA +LE +E   +
Sbjct: 421 FIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQ 480

Query: 565 SQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERDAYKALSVNASSGTNTP 620
           +    +E +T+ EAK+ +L L ++  +LE +L    KERD YK LS   S  +N P
Sbjct: 481 ADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKP 536

 Score =  176 bits (445), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 171/588 (29%), Positives = 297/588 (50%), Gaps = 72/588 (12%)

Query: 1096 EYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDSSDLLISLRRERDMLETKL 1155
            E ED L +  +R+ +L TQN LL++Q+      ED  N  D  D+++ ++RERD L+ KL
Sbjct: 978  ELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIKDIIVCMKRERDTLQKKL 1037

Query: 1156 EVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRE 1215
             +   E  VL++R    KSE+ D  ++  Q  N     ++LL   E I+ EL ++HLLRE
Sbjct: 1038 AIVEREGEVLRERCAGLKSEL-DAVSKGQQWHNLPL--SNLLTGHEKILDELKEVHLLRE 1094

Query: 1216 SNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAER 1275
            +NV+L +E +  K +   L  +L +      PLQ   ++ +   K K+QE+   K+E ER
Sbjct: 1095 NNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIER 1154

Query: 1276 WKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRL 1335
            WK R Q ++H+ +         L  E N  KNE+ + K  ++    EK+    KFQ ++ 
Sbjct: 1155 WKKRWQQMVHRQD-------DTLGLEAN-FKNEIDSLKGLIEERTKEKEKLSEKFQLLKK 1206

Query: 1336 QARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQ 1395
            QA ++L+A+K   Q+L++++++I  +  Q+E          KE +++++ +       E 
Sbjct: 1207 QAHEKLDANKIHIQTLNNDLSEIKASNLQLEE-------VMKEKDKKIREI-------EL 1252

Query: 1396 TFNSQLSKLQEDLHSIQVQMENASKT-EQNNADSDEKIKSLTETVEMLNSKIQELEAEAS 1454
            T    L K  +D   +      + KT ++N A  ++ I  L +  E LN ++  L  E +
Sbjct: 1253 TLKENLEKFDKDEKLV------SEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEIN 1306

Query: 1455 NAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSXX 1514
              +K          +++T  ++  +K +FE EK++LI++K +EL  KFE+ +    +   
Sbjct: 1307 VLRKK---------DDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQS 1357

Query: 1515 XXXXXXXXXXXXXXXXXXXXTTVQSPSQPTLDIDIDALKNEWEKEYEKQTXXXXXXXXXX 1574
                                   ++ +      ++D LK E  K++E+QT          
Sbjct: 1358 -----------------------ENVTNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKEN 1394

Query: 1575 XXXRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLA----GEIGNDAITLEKHRAE 1630
                IRLP+++KI +I+E R+A LE  F+++V EKA  +A     ++  D +  +K R E
Sbjct: 1395 LKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELK-QKVRRE 1453

Query: 1631 LNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQ 1678
               L+ ++ +  +A L  I+ K+FEEGK+Q  +K   LE K+  LE Q
Sbjct: 1454 ---LEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQ 1498

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  116 bits (290), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 188/749 (25%), Positives = 368/749 (49%), Gaps = 149/749 (19%)

Query: 203 QLNTKTVQLNEF-REST-----ISELQDS--QLKVSNMESELEIARTSNQKLKQSVHSLH 254
           QLN  T++ N    E T     ISEL+    Q K +N+ ++LE+ + S      S+ S +
Sbjct: 62  QLNNITLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMS--ITYNSLESKN 119

Query: 255 EQLEQKLSENKE----IKDEYNFSKQELTKE-MSLKQRMIDALEKHMESLKKEMDATKNN 309
            +LE  LS   +    + DE  +  Q L +E ++LK  ++  LE   + L K  + TK+N
Sbjct: 120 RELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDIL-ILETKYDKLLKGYNDTKDN 178

Query: 310 M----------DSSYFTE-KERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLE 358
           +          D+S+ +E K +DE+IEE + +   L  +E   +K +E I+E +S+I +E
Sbjct: 179 LKEKISELLALDTSFKSETKLKDEIIEEKDYLIANL-TNEIESLKNRE-INEHSSDINIE 236

Query: 359 -------------------------------DSEVGNTTAS-----SEKSVSVIPKL-YG 381
                                          D +V   TA+     S+  ++ +    + 
Sbjct: 237 YGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTDDFC 296

Query: 382 DLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLES 441
           D  +LKK++   + Q+D L+ ++E  + ELE+  P LN+  ++       +NE+ +LL  
Sbjct: 297 DFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDK-------INELELLLS- 348

Query: 442 TGKDRDQKSSQLDYLKATVKSYETQ--------------IASLSKQRVDLAHQIQYLLVN 487
               +++ +S+  + K T+K  E +              I +L ++  DL +QIQ++L++
Sbjct: 349 ----KEKNTSE--HFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLIS 402

Query: 488 ESIKSEDGGPLSAEELQFVKNLTNSQEITKTS-----DTQGIITDRLVEFRSVVELQQKN 542
            SI+++  G L+  E++F+K L   ++ T+TS     ++Q II+DRL+ F SV+ LQQKN
Sbjct: 403 NSIQNDKYGELTENEIKFIKAL--REKGTETSFNELYNSQDIISDRLIRFESVISLQQKN 460

Query: 543 SELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKE 602
            EL+ T+R +  +L+ +E E +++ +   D+ + EAKE IL +   +  L+ ++  L ++
Sbjct: 461 MELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQ 520

Query: 603 RDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENSNL 662
            +A + +S +  +G  +  A        ++K+     RL  ++ E +NN  E++ + SN+
Sbjct: 521 LNANRPVS-HEKNGHESVLA--------ENKLYTEGDRL--ILDELKNNIPEFTKQASNI 569

Query: 663 RKKLYEISLNFESEKT-----------------SRTLAEDRLNLLQSTLELSKRQCEELQ 705
                 IS+NF+   +                 SR + + +L+LLQ   +      E+L+
Sbjct: 570 ------ISMNFDQLTSLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLK 623

Query: 706 KRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKS---EKQFM----AKVQK 758
           +    ++D + ++D+    T+ + +  K++L S+ ++++ L +   E +++    +++  
Sbjct: 624 EHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITN 683

Query: 759 ELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLE 818
           ELK E E+        K+ +  ++T+Q + ++   E + S   K+  LEI  S   + L 
Sbjct: 684 ELKMEREQL-------KMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLR 736

Query: 819 EIEKNTTGIASNKEHQYNWFQEKIDKLTS 847
             E+      S K  + +W+Q+K D  ++
Sbjct: 737 TKEQELQDFISTKNRELDWYQKKFDIFST 765

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 125/217 (57%), Gaps = 11/217 (5%)

Query: 386 LKKQLVIEKRQKDELKMQVEAFVVELEHKIPVL-NSFKERSEMLERELNEVTILLESTGK 444
           +K +L+ EK +K  L+ +   F+ ++E K+P L N+  E       ++ E  I+ E    
Sbjct: 286 IKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNKIEEQKIIHEHDSL 345

Query: 445 DRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAE-EL 503
             + +S     LK  +  +E+ + +L +QR DL HQI YLL+ +S  +ED   +  E EL
Sbjct: 346 KLENQS-----LKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENEL 400

Query: 504 QFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAEN 563
            F++NL      T +++TQ II++RL++F +V +L  KN +L+S +R L +++E  E +N
Sbjct: 401 NFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQN 460

Query: 564 KSQIQVLEDE--TVREAKETILTLHDHAQNLENQLVI 598
             +   LE +  ++ EAK+ ++ L +  +N++N+ +I
Sbjct: 461 SQKFGDLEMDFKSIDEAKQRMIVLKE--ENVKNKDII 495

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 115/488 (23%), Positives = 210/488 (43%), Gaps = 72/488 (14%)

Query: 381 GDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTI--- 437
            D  +LKK LV EK    +L+ ++ + ++EL  K+P L S KE++  L+     +     
Sbjct: 207 NDNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNE 266

Query: 438 -LLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGG 496
            LL+    + D+ +S    +   +  YE  +  L  QR +L   I Y+L   ++ + +  
Sbjct: 267 ELLQQFHSNTDKIAS----MNNKIVDYEQSLKQLLSQRTNL---ISYILNLLNVINLNSK 319

Query: 497 --PLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLAD 554
              LS  E   ++NL N++ I +                    LQ+KN  L     NL  
Sbjct: 320 YLNLSESEGCLIQNLFNNERIQRF-------------------LQEKNLTLTEIFDNLNT 360

Query: 555 ELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERDAYKALSVNAS 614
                   N+S I+VL   T   +KE I+       N +N++++L    DAYK +  N  
Sbjct: 361 VDITFNNFNRSDIKVLP-PTESASKEEII-------NYKNEIILLENNCDAYKMILYN-- 410

Query: 615 SGTNTPKAITYPSPDNDDKVK-DLETRLTAV------IQEAENNAKEWSSENSNLRKKLY 667
                   IT    D D+K+K +  +R+T +      IQ  E+   E +S  + L +K  
Sbjct: 411 ------NGIT---EDLDEKLKIESSSRMTELNEKNSRIQMLESKIDELNSIVTKLNEKNS 461

Query: 668 EISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQD-ILTKQDKRTQETV 726
               +     +S +   ++ NLL  + +      + L+  ++D +  +LT     T++ V
Sbjct: 462 RFMASINKNNSSESTILEKYNLLNQSYKTLLEAYKSLKSNATDNKKAVLTSTLDDTKKIV 521

Query: 727 D---SLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQLQT 783
           +   ++    ST+ S+ ++L  ++     +A   +++K EN   S          + L  
Sbjct: 522 EFKSTINYLNSTIKSLSAKLVSIQESNDLLADENQKIKMENSNLS----------SLLNK 571

Query: 784 LQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKID 843
           +  ++  +  E  + + +++ +LE E +  LE+LEE E+           Q  WFQ KID
Sbjct: 572 INTDKNSISNELSDLHSKEILELETEKTKLLEQLEEGERKLKETNEKHNEQIKWFQNKID 631

Query: 844 KLTSEAAQ 851
               E  +
Sbjct: 632 NFNEETTK 639

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 118/256 (46%), Gaps = 31/256 (12%)

Query: 1213 LRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNG----IKIKEQELIQ 1268
            ++ESN  L  EN   K E  NL S L + N     + + +S L +     ++ ++ +L++
Sbjct: 544  IQESNDLLADENQKIKMENSNLSSLLNKINTDKNSISNELSDLHSKEILELETEKTKLLE 603

Query: 1269 SKEEAERW-----KSRSQDILHKYERIDPEEHGKLKEEIND-VKNELQTTKDTLQSVIAE 1322
              EE ER      +  ++ I     +ID       K + N+ +KN+ +  K + +    E
Sbjct: 604  QLEEGERKLKETNEKHNEQIKWFQNKIDNFNEETTKNQFNNALKNDYENLKKSFEEKSKE 663

Query: 1323 KDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAK-------SQVEADLGKCKTA 1375
             ++   KF R++ QA +RLNASK  ++ LS  +  + + +       S++E D+     A
Sbjct: 664  VEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNA 723

Query: 1376 CKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSL 1435
              E E++L     + ET+ QT     S L+  +  +Q+  +N            EK+K+L
Sbjct: 724  LVEAEKKLSEENLKYETERQTG----STLRLKIDDLQLNEDNLK----------EKVKNL 769

Query: 1436 TETVEMLNSKIQELEA 1451
             E    L  KI+ +E 
Sbjct: 770  EENESTLKDKIKMIEG 785

>NCAS0G02830 Chr7 complement(520473..521126) [654 bp, 217 aa] {ON}
            Anc_2.215 YIL138C
          Length = 217

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 62/104 (59%)

Query: 1184 SQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECND 1243
            +QVK+ + ++  L ++ E +  EL++   L E +  L+S N +F K+ D L+ +L+E N 
Sbjct: 97   NQVKSLTVKNQQLEDEVEKLESELEECKRLNEEDSNLKSNNENFTKKIDQLEEELEESNT 156

Query: 1244 RLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKY 1287
            +L   + S+++ +   +  E++L   +EE + W+ R++++  KY
Sbjct: 157  KLQETKESLNNAELKAEELERKLKAIEEEKDDWERRNEELATKY 200

>Suva_11.248 Chr11 (453665..455284) [1620 bp, 539 aa] {ON} YKR016W
            (REAL)
          Length = 539

 Score = 37.4 bits (85), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 86/168 (51%), Gaps = 18/168 (10%)

Query: 892  NVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQK 951
            N+  A +LV+T     ++ +L L DS+ +++   +     + S +   ++ +E   E +K
Sbjct: 69   NIPFADDLVQTYEHYHDRPSLFLKDSWDELKGKSSGLVYGLASGSSRGKSIKE-DVEVKK 127

Query: 952  TI------ITLENERNQLQSTVNILNDQVKDLNNE-IFHQKSEYQTERNATMEEISKLQM 1004
             +      I ++N   QL+  ++ LND +++LN+  I   ++++ + + ++   ++ L  
Sbjct: 128  ILSLKPLDIEVDNSDPQLKEIISSLNDLIRNLNDSGISVPETKFNSMKKSSENMLANLSQ 187

Query: 1005 VKESVDRTKADYEEKIAMIQKD----LEMQTQYANESQRSYELELQKH 1048
            + E++    + Y     MIQ+      E+ TQY N S+R +E  LQK+
Sbjct: 188  LNETLKEALSKY-----MIQRTSEVITELNTQYEN-SKREFETNLQKN 229

>NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {ON}
           Anc_8.604 YOR195W
          Length = 791

 Score = 37.0 bits (84), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 105/209 (50%), Gaps = 26/209 (12%)

Query: 179 SKSEILRMEQEITLLRENNDWLTNQLNT-----KTVQL--NEFRESTISELQDSQLKVSN 231
           SK EIL + Q   +L+E  D L+N+ +T     +T++L  ++ +ES   EL ++  K+  
Sbjct: 352 SKDEILMLNQNQKILQEKYDNLSNENDTWRNNYETLELEISKQKESHAIELNETSTKLET 411

Query: 232 MESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDA 291
           ++SEL  +   +Q L +  + +HE+L+  + ++ + K+E   S +   KE    Q +   
Sbjct: 412 LKSELAESMAKSQSLTEKNNDMHEELDT-IQQSLQTKNELISSLEATIKEQQNTQDLTKE 470

Query: 292 LEKH---MESLKKEMDATKNN---MDSSYFTEKE---------RDELI---EELNAVKYR 333
            EK+    ESL KE D   N    M+  Y T+ E           ELI   E+ NAV   
Sbjct: 471 NEKYREQFESLFKEKDELTNKFNAMNEEYLTKIEEYQQKVIEAETELINIREKYNAVTVE 530

Query: 334 LDASESNCIKLKETIDELTSNIKLEDSEV 362
           L+A   +   LK+T +EL    K++ +EV
Sbjct: 531 LEAKNGSMASLKKTSEELDDANKIKAAEV 559

>Kwal_47.16674 s47 complement(57126..59048) [1923 bp, 640 aa] {ON}
           YJR134C (SGM1) - Product of gene unknown [contig 376]
           FULL
          Length = 640

 Score = 36.6 bits (83), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 10/74 (13%)

Query: 627 SPDN-----DDKVKDLETRLTAVIQEAENNAK----EWSSENSNLRKKLYEISLNFESEK 677
           SPDN     DDK ++ + +L +  +  EN  K     WSS  S+LR+++YE+  N +SE+
Sbjct: 289 SPDNVENGNDDKARE-QLKLKSHCKNLENELKTSKENWSSIESSLRQRMYELEQNLQSEQ 347

Query: 678 TSRTLAEDRLNLLQ 691
            +   + DRL +++
Sbjct: 348 VALKASNDRLMIVR 361

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 62/112 (55%), Gaps = 8/112 (7%)

Query: 1220 LRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSR 1279
            L  E +  K + +  + QLQE + +L+  QS ++ +++ +K  E +LI S++EAE+ K +
Sbjct: 1036 LFQERAELKDKLNTSEKQLQESSQKLSNAQSELNEIRSRLKANEHDLITSRQEAEKLKKQ 1095

Query: 1280 SQ------DILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDD 1325
            +Q      DI HK + +  +E    K +++ +  EL++T   LQ    E+ D
Sbjct: 1096 NQQQSSKKDI-HKLDELS-KEADSYKAQVSKLSAELESTMGQLQKSSVEQTD 1145

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
           YOL034W
          Length = 1103

 Score = 35.0 bits (79), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 78/163 (47%), Gaps = 20/163 (12%)

Query: 722 TQETVDSLIK-------TKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEY 774
           TQ+ +DSL         T ST  + Q +L  +   K+ +  VQ  LK   E+  +   EY
Sbjct: 236 TQKRIDSLKNDCERLRITVSTFRAYQKKLKEIDEYKKLLPYVQ--LKGLEEKLRQYRAEY 293

Query: 775 KVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIA------ 828
           +     L+TL +E+  L  ETQ  ++  L++   ++     + E++ +++T +       
Sbjct: 294 EQAKTNLKTLLQEKRKLF-ETQKKFESTLKEANNKVHSIKAKFEKLSRDSTRLTKDLKTM 352

Query: 829 ----SNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQ 867
               ++K+     ++EKI  L +  A++K  LE+K  QL  ++
Sbjct: 353 RTDIASKKQDIQRYREKIGGLRNNVAEKKKELEDKRVQLTSIE 395

>TPHA0G01850 Chr7 complement(383439..385028) [1590 bp, 529 aa] {ON}
            Anc_8.630 YPL128C
          Length = 529

 Score = 34.7 bits (78), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%)

Query: 1221 RSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAE 1274
            R  N  F  + +N   +L +C + + P +S    ++  + IK +EL Q K EAE
Sbjct: 321  RGVNPLFDYKLENFNPKLLQCGEPVIPFKSEDDGIEQDLHIKREELHQPKNEAE 374

>Ecym_3486 Chr3 complement(907305..910319) [3015 bp, 1004 aa] {ON}
           similar to Ashbya gossypii ADL317C
          Length = 1004

 Score = 34.7 bits (78), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 656 SSENSNLRKKLYEISL-NFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDI 714
           SS NS   KKL  + L + E  K +  +  D  + + S  E+  R C E   +S     +
Sbjct: 656 SSANSRFNKKLVAVWLEDTELIKITEKILCDEDSYVPSETEIMVRYCPEFDAKSG----V 711

Query: 715 LTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSE 749
           +TK D  +  T+D++     TL+ I+  L  LK E
Sbjct: 712 VTKNDFFSNTTIDTITYFLGTLTWIREWLPQLKQE 746

>CAGL0F01749g Chr6 (172820..174229) [1410 bp, 469 aa] {ON} highly
           similar to uniprot|P37291 Saccharomyces cerevisiae
           YLR058c SHM2 serine hydroxymethyltransferase
          Length = 469

 Score = 34.3 bits (77), Expect = 3.5,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 78/168 (46%), Gaps = 32/168 (19%)

Query: 847 SEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQE 906
           + A +Q  T E KE Q Q +++      AK  E E +   Y ++SN  D+  ++ +LR++
Sbjct: 304 ATALKQAATPEFKEYQTQVLKN------AKALENEFQTLGYRLVSNGTDSHMVLVSLREK 357

Query: 907 ----------LEKVNLQLS------DSYSQIEHHKTLAEQSV-------QSVNEVSQAFE 943
                      EK+N+ L+      D  + +     +   ++       +  + + +  +
Sbjct: 358 GVDGARVEYVCEKINIALNKNSIPGDKSALVPGGVRIGAPAMTTRGMGEEDFHRIVRYID 417

Query: 944 EAQKESQKTIITLENERNQL---QSTVNILNDQVKDLNNEIFHQKSEY 988
           +A K +++T  +L  E N+L   ++ V+ + DQ+  L  EI+   +EY
Sbjct: 418 QAVKFAEQTQSSLPKEANKLKDFKAKVDEIADQLAPLKKEIYDWTAEY 465

>NDAI0H03160 Chr8 complement(753702..754112) [411 bp, 136 aa] {ON}
           Anc_2.354 YMR159C
          Length = 136

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 68/140 (48%), Gaps = 23/140 (16%)

Query: 637 LETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLEL 696
           +E+R + + QE + +A  W  + +N++    +++     E     +++ R  L++  +EL
Sbjct: 15  IESRFSELFQEVDGDAL-WKQQQNNVQTAGKDVT-----ENNRLIISKLRDELMEKEVEL 68

Query: 697 SKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSE-----KQ 751
            +            LQ+++  QDK  ++  D LI      + +Q +LS L  E     ++
Sbjct: 69  KR------------LQEVINVQDKNNEKLNDELITVNIENNILQEKLSSLNKEHNKLVQR 116

Query: 752 FMAKVQKELKAENERFSKES 771
           ++AKVQ E+   N  F ++S
Sbjct: 117 WLAKVQHEVDTMNAHFERDS 136

>YKR016W Chr11 (469717..471339) [1623 bp, 540 aa] {ON}
            FCJ1Mitochondrial inner membrane protein, ortholog of
            mammalian mitofilin; involved in import of intermembrane
            space (IMS) proteins, probably by positioning Mia40p
            relative to the TOM complex to receive incoming proteins;
            also has an essential role in the maintenance of crista
            junctions and inner membrane architecture, as a component
            of the mitochondrial inner membrane organizing system
            (MICOS, MitOS or MINOS), a scaffold-like structure on the
            IMS side of the inner membrane
          Length = 540

 Score = 34.3 bits (77), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 83/172 (48%), Gaps = 24/172 (13%)

Query: 891  SNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKES- 949
            +NV  A++L+ET     ++  L L DS+  +   K  +   +  +   SQ    + +E+ 
Sbjct: 69   NNVPFAEDLLETYEHYHDRPTLFLEDSWDGL---KAKSNDLLSGLTGSSQT-RRSNRENI 124

Query: 950  -QKTIITL-------ENERNQLQSTVNILNDQVKDLNNE-IFHQKSEYQTERNATMEEIS 1000
              K I++L       EN   QL+  +  LND +  LN+  +   +SE+ + + +    ++
Sbjct: 125  EVKKILSLEPLNIETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNMLT 184

Query: 1001 KLQMVKESVDRTKADYEEKIAMIQKD----LEMQTQYANESQRSYELELQKH 1048
             L  + E++    ++Y     MIQ+      E+ TQY N S+R +E  LQK+
Sbjct: 185  NLSQLNETLKEALSNY-----MIQRTSEVITELNTQYEN-SKREFEKNLQKN 230

>TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.414
           YDR356W
          Length = 970

 Score = 33.9 bits (76), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 124/272 (45%), Gaps = 56/272 (20%)

Query: 168 ELQTQQALELRSKSE-ILRMEQEITLLRENNDWLTNQLN---TKTVQLNEFRESTISELQ 223
           +L+TQQ   + +  E I +++Q+I  L + N    NQL       ++LNE        LQ
Sbjct: 325 QLKTQQNENINNNDEQIEKLKQDIAELSKKNLDFQNQLKKSQNDRIRLNEL-------LQ 377

Query: 224 DSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIK----------DEYNF 273
           DS+    N  S+L++ +     +++  HSL  +L +KLSE  E+K          D  N+
Sbjct: 378 DSKKTEINFYSDLDLIKEQKNDIEKKNHSLDNELRKKLSEIDELKDSIEECKNQMDNLNY 437

Query: 274 S-KQELTKEMSLKQRMI----------DALEKHMESLKKEMD-------ATKNNMDSSYF 315
           + K E  K  +L +++           D L +  E+LK E D        TK  +D+  F
Sbjct: 438 ALKDEKKKNKTLTEKITEQQNKLIATDDQLNEKHEALKSEYDIITSELKITKKKLDTVNF 497

Query: 316 TEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVGN-------TTAS 368
             K+  EL + +N  K RL+          + +  LT  I  + SE+ +        T++
Sbjct: 498 ELKKELELKKRINNSKQRLE----------DQVKSLTLEISDKHSEISDLQEKLLEYTSN 547

Query: 369 SEKSVSVIPKLYGDLGMLKKQLVIEKRQKDEL 400
           S+ S S I  +   +  L+K+LV  K+ KD L
Sbjct: 548 SDNSRSKISGMELKIKALQKELVEIKKNKDIL 579

>TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8.604
            YOR195W
          Length = 804

 Score = 33.9 bits (76), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 50/177 (28%)

Query: 1227 FKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHK 1286
            F+K+ D L+ ++   ND L  L+ S   + +  +IK  E+IQ  EE +    RS +I   
Sbjct: 534  FEKKIDELQGKINNQNDELLKLKESYDKINDNFEIKNAEVIQLNEEIKEL--RSNEI--- 588

Query: 1287 YERIDPEEHGKLKEEI-NDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASK 1345
                       LKE+I ND KN                +DW++K++  +++    L    
Sbjct: 589  ----------NLKEKISNDEKN---------------SNDWKAKYESSKIENEKIL---I 620

Query: 1346 EKEQSLSSEINQINEAKSQVEADLGKCKTACKELE---ERLQVVTQEAETKEQTFNS 1399
            EK ++ S +IN++NE                KELE   E ++++ Q+ +T  +T N+
Sbjct: 621  EKSENHSMKINELNE-------------DHLKELENIHETMKILQQDLKTNIETLNN 664

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..67336)
            [1461 nt, 487 aa]
          Length = 486

 Score = 33.9 bits (76), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 12/115 (10%)

Query: 931  SVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQT 990
            S Q  N++   +E  +KESQ  +       NQ  +  NI N+Q+   N+ I+ Q     T
Sbjct: 234  SSQITNQLGSPYEAFRKESQFPVFAT----NQW-TGANIPNNQISSANHSIYSQ-----T 283

Query: 991  ERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELEL 1045
              NA  E ++  + + ESV+ T  +       I ++   QTQ  N     Y   L
Sbjct: 284  HPNA--EGLNSEKSMIESVNTTSNNQHPNSGAINQNYFHQTQVPNYQNMEYRNSL 336

>Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {ON}
            complement(71225..74242) [3018 nt, 1006 aa]
          Length = 1005

 Score = 33.9 bits (76), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 63/120 (52%), Gaps = 13/120 (10%)

Query: 1153 TKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHL 1212
            T L++   E   LK ++D+ K +  +L  Q+S  KN+ S  +++ E      K  ++L +
Sbjct: 626  TSLDIMQKETEQLKNKIDLMKKQNNEL--QISATKNNDSFESYIKENG----KLSERLSV 679

Query: 1213 LRESNVTLRSENS-------SFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQE 1265
            L+E   TL+S  S       S +++C+ L  +L+E N R+  L+  +S   N I+ K +E
Sbjct: 680  LQEKYDTLQSLKSNSNDQVESIQRQCEELTVKLKEANKRILSLEDELSEYANAIQEKTRE 739

>KLTH0H09658g Chr8 (831223..833400) [2178 bp, 725 aa] {ON} similar
           to uniprot|P36114 Saccharomyces cerevisiae YKR018C
           Hypothetical ORF
          Length = 725

 Score = 33.5 bits (75), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 12/123 (9%)

Query: 863 LQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQ-I 921
           ++ +++T+  +++ +K+A A          + +AQ L    RQ+ +K+ L+ S  Y    
Sbjct: 78  IEFLEATLGFEASVMKKAAA---------TLSEAQQLSAKRRQQFQKMGLKTSSLYPPGT 128

Query: 922 EHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEI 981
           E+  T AE  +  ++ +   F E+  ES K +  L    + L+  +N +N   K   + +
Sbjct: 129 EYAVTFAEACL--LHALLMLFSESMVESAKALFKLRKAYHMLREILNDINAAKKKKGSAM 186

Query: 982 FHQ 984
           + Q
Sbjct: 187 YAQ 189

>Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 498 LSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTI 549
           L  E    V N+T+ ++   T D  G +TD++ E R V+EL  KN E+   I
Sbjct: 159 LPRETDPLVYNMTSFEQGEITFDGIGGLTDQIRELREVIELPLKNPEIFQRI 210

>KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some
           similarities with uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport coiled-coil protein necessary for protein
           transport from ER to Golgi Integrin analogue gene
          Length = 950

 Score = 33.5 bits (75), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 12/164 (7%)

Query: 127 KQD-IAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALEL-RSKSEIL 184
           KQD  A++L EK++EL   + ++ E+  A K + Q    +E E   + A EL + K +I 
Sbjct: 238 KQDQTAQALREKLQEL---QDQVEESAQALK-VAQDDRRSEFEGHQRVAEELAKCKGQIR 293

Query: 185 RMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQ 244
             E EI  + EN D     L T    L++      S L +S+L V  ++S++++ +  N 
Sbjct: 294 LKEDEIVTVTENADKACQDLRTDNAGLHKKAIEIQSALTESELYVQQLKSKVDLMKKHND 353

Query: 245 KLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRM 288
            L Q+VH   E+L +    N  I + Y   K+ + +E SL+ R+
Sbjct: 354 DLSQTVHDKIEELNEC---NTRIDELY---KENIAQENSLRSRV 391

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1223

 Score = 33.1 bits (74), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 765 ERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNT 824
           E  SKE V YK+ +A LQ  +++R++LL + + S+ + + +    + G L  L E   NT
Sbjct: 359 ESLSKEEVSYKLELAGLQ--EKQRDLLLMKGKYSHFQTVEERNEWIEGELRSLNETLANT 416

Query: 825 TGIASNKEHQYNWFQEKID 843
           T + S  +++ N   EK++
Sbjct: 417 THLKSQIDNERNELHEKLN 435

>NDAI0A00690 Chr1 (126791..130999) [4209 bp, 1402 aa] {ON} Anc_1.134
            YCR038C
          Length = 1402

 Score = 33.1 bits (74), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 2/49 (4%)

Query: 1244 RLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQD-ILHKYERID 1291
            R + ++S I++L N       +LIQ++EE ER KS S+D I +KY +ID
Sbjct: 750  RFSTIRSGINNLTNSGTRLINDLIQTQEEGERTKSFSKDPIFNKY-KID 797

>KLLA0D07326g Chr4 (625107..625838) [732 bp, 243 aa] {ON} similar to
           uniprot|P38523 YOR232W Saccharomyces cerevisiae MGE1
           Protein of the mitochondrial matrix involved in protein
           import into mitochondria
          Length = 243

 Score = 32.3 bits (72), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 66/142 (46%), Gaps = 8/142 (5%)

Query: 841 KIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLV 900
           K+D  T EA++ K  L    A  + +Q    +   K K+   +  +  +L +VD+  + +
Sbjct: 88  KLDAKTKEASEFKDRLLRSVADFRNLQEVTKKDIQKAKDFALQKFAKDLLESVDNFGHAL 147

Query: 901 ETLRQELEKVNLQLSDSYSQIE-----HHKTLAEQSVQSVNEVSQAFEEAQKESQKTIIT 955
              + E  + + +LSD Y+ ++       KTL +  ++ +N + ++F+  + E+   +  
Sbjct: 148 NAFKPETLEQSQELSDLYTGVKMTRDVFEKTLKKHGIEQLNPIGESFDPNKHEATFELPQ 207

Query: 956 LENERN---QLQSTVNILNDQV 974
            + E      +Q     LND+V
Sbjct: 208 PDKEPGTVFHVQQIGYTLNDRV 229

>Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score = 32.7 bits (73), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 498 LSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSELL 546
           L  E    V N+T+ ++   T D  G +TD++ E R V+EL  KN E+ 
Sbjct: 159 LPRETDPLVYNMTSFEQGEITFDGIGGLTDQIRELREVIELPLKNPEIF 207

>Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score = 32.7 bits (73), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 498 LSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSELL 546
           L  E    V N+T+ ++   T D  G +TD++ E R V+EL  KN E+ 
Sbjct: 159 LPRETDPLVYNMTSFEQGEITFDGIGGLTDQIRELREVIELPLKNPEIF 207

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.121    0.303 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 166,042,633
Number of extensions: 7429969
Number of successful extensions: 82110
Number of sequences better than 10.0: 4550
Number of HSP's gapped: 65016
Number of HSP's successfully gapped: 11778
Length of query: 1748
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1624
Effective length of database: 39,262,815
Effective search space: 63762811560
Effective search space used: 63762811560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)