Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00572g5.703ON57757728710.0
AFR287W5.703ON6116229471e-120
SAKL0E14938g5.703ON5745889151e-115
YIL150C (MCM10)5.703ON5715858971e-113
KLTH0E01034g5.703ON5835638781e-110
Suva_9.385.703ON5695848741e-109
Skud_9.185.703ON5715858641e-108
Kpol_1043.715.703ON5855918651e-108
Smik_9.195.703ON5725858611e-107
TDEL0B021705.703ON5675878421e-105
KAFR0D022105.703ON5845958411e-104
CAGL0H06589g5.703ON5835948411e-104
ZYRO0G06578g5.703ON5695818331e-103
Kwal_55.196915.703ON4664638161e-102
KNAG0L021505.703ON6166188231e-101
NCAS0G002205.703ON5925658181e-101
TPHA0E002105.703ON5445387658e-94
NDAI0F002805.703ON6106187682e-93
TBLA0G010205.703ON5946087541e-91
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00572g
         (577 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...  1110   0.0  
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   369   e-120
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   357   e-115
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   350   e-113
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   342   e-110
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   341   e-109
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   337   e-108
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   337   e-108
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   336   e-107
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   328   e-105
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   328   e-104
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   328   e-104
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   325   e-103
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   318   e-102
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   321   e-101
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   319   e-101
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   299   8e-94
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   300   2e-93
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   295   1e-91

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score = 1110 bits (2871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/577 (94%), Positives = 546/577 (94%)

Query: 1   MSYDLTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDP 60
           MSYDLTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLT             DP
Sbjct: 1   MSYDLTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDP 60

Query: 61  NFDSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKLGTTSYFTE 120
           NFDSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKLGTTSYFTE
Sbjct: 61  NFDSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKLGTTSYFTE 120

Query: 121 KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180
           KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV
Sbjct: 121 KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180

Query: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240
           LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT
Sbjct: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240

Query: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300
           ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK
Sbjct: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300

Query: 301 DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360
           DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS
Sbjct: 301 DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360

Query: 361 SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420
           SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA
Sbjct: 361 SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420

Query: 421 FFDDDYENPDILANLDNKRRKIQELRNNRNXXXXXXXXXXXXXXXXXXRVNQEAKKTATL 480
           FFDDDYENPDILANLDNKRRKIQELRNNRN                  RVNQEAKKTATL
Sbjct: 421 FFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGLSDKLLSKKEDRVNQEAKKTATL 480

Query: 481 SMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQLAITDICNIKKDNVSLKPSKK 540
           SMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQLAITDICNIKKDNVSLKPSKK
Sbjct: 481 SMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQLAITDICNIKKDNVSLKPSKK 540

Query: 541 QLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577
           QLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII
Sbjct: 541 QLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  369 bits (947), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 228/622 (36%), Positives = 340/622 (54%), Gaps = 58/622 (9%)

Query: 1   MSYDLTDPREITAFDPYEELSDDESEIER----------------------VKRRIVEID 38
           +S  L DPREI     Y+ LSD+E  IE                       VK R+ +I+
Sbjct: 2   LSTTLNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIE 61

Query: 39  TEKRDLTXXXXXXXXXXXXXDPNFDSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATF 98
           +E+ DL                   +++VP SP K+    K +ED     P      +T 
Sbjct: 62  SERSDLLARLEELKHRSKKKAKKSPTVEVPRSPTKA----KCVED----EPAPSTSASTT 113

Query: 99  NVNEDYVREKVKKL-----GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNG-DMF 152
            V E    E  + L      TTSYF EK      +    ++RK+ELL  RVYTF+  D  
Sbjct: 114 YVEEPEENENERYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTA 173

Query: 153 DEYEPITVDEKDDLSGLVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPN 212
            EY    VDE +  S + I++RYVP   L++   +IKVLRLPKLF+KVR PKFSEPDY N
Sbjct: 174 IEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYAN 233

Query: 213 WLVLGIISKKTEPRMTNSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAI 272
           W+ LG IS K++ + T+  KP K+F++ I+DF +++ +  FG+  VEKYYKLR+GD+IAI
Sbjct: 234 WVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAI 293

Query: 273 LNPEIMP----SKKLEAGASPSYATFSLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLC 328
           LNPEI P    +K     A  +  +F L +  + N ILE+GHSKE G C    K KG  C
Sbjct: 294 LNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPC 353

Query: 329 GAPINKLHDNYCAYHKEAKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSI 388
           GAPINKL +  C+YH+E  +R  +++RVE++ ++++RAP   G QQ    +++++G    
Sbjct: 354 GAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHG---T 410

Query: 389 RYQQNPDKPFVREPAAAETNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNN 448
           +    PD    R P A +  R  F+SANA  A+FD DY NPD+L NL++KRRKIQ  + +
Sbjct: 411 KIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKD 470

Query: 449 RNXXXXXXXXXXXXXXXXXXRVNQEA---KKTATLSMFQHGLANQIGYDPTKGKASLEML 505
           +                   RV++E+   ++ AT ++ + G+   IG+DPT G+  +  +
Sbjct: 471 QQINKQLSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGR--MAAV 528

Query: 506 EYSTENKAPKNDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMK------- 558
            Y  ++      ++ +I++I   KK N+ LKPSK+  +++I++RN ++N I K       
Sbjct: 529 LYQGDHGPADTVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATP 588

Query: 559 -GSQE--RLDKDEGSSDDLEII 577
            GS E  +L   + S ++LEI+
Sbjct: 589 QGSCETAQLSSADSSDEELEIV 610

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  357 bits (915), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 213/588 (36%), Positives = 327/588 (55%), Gaps = 29/588 (4%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPRE    D ++ELS DE +   + +R+ E++ EK+DL              DPNF  
Sbjct: 1   MEDPREPREIDIFDELSCDEDD--DLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATF----NVNEDYVREKVKKLG-TTSYFT 119
           ++VP SP KS +       +K  +   D  E+ F    N+NE  V++K      +T YF 
Sbjct: 59  VEVPRSPSKSKHVA-----VKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFA 113

Query: 120 EKLRSINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRYVPL 178
           +   S    +    +RK E+L  RV+TF+G D   EY PI V+E+++ SG  I +RY+  
Sbjct: 114 QNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITA 173

Query: 179 AVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFS 238
              RK  +  KVLRLPKLF+KVR P F+EP Y NW+ +GIIS K+  +MT   KP ++F+
Sbjct: 174 EQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFT 233

Query: 239 LTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSK----KLEAGASPSYATF 294
           LT++DF+  +N+  FG   VEKYY L++GD+IA+LNPEI P +    + E  +     +F
Sbjct: 234 LTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSF 293

Query: 295 SLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSR 354
           +L +  + N+ILE+G S++FG C  Y K +GK CG PINK  ++ C YH+E + RQ +++
Sbjct: 294 NLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAK 353

Query: 355 RVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSS 414
           R+E++ + ++R+P   G +  I+  ++ +GK    Y   PD+   +  +    N   FS+
Sbjct: 354 RLELNGNKSLRSPTKNGVKH-ILYGKNKSGK----YDLLPDRYAPQTQSKDSQNVLYFSN 408

Query: 415 ANASTAFFDDDYENPDILANLDNKRRKIQELRNNR---NXXXXXXXXXXXXXXXXXXRVN 471
            NA+ AFFDDDY+NPD L NLD+KRRK++  +  +                         
Sbjct: 409 PNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTK 468

Query: 472 QEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQLAITDICNIKKD 531
           Q+  + AT +  + GL  +IG+DPT G+ S  +   S   K  +  K  A+ +I  IKK+
Sbjct: 469 QDEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLK--EQAKNSAVEEILQIKKE 526

Query: 532 NVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDD--LEII 577
            + LKPSK+ L++K +KR  ++N   K  +      E S  D  LEI+
Sbjct: 527 KIELKPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  350 bits (897), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/585 (35%), Positives = 328/585 (56%), Gaps = 26/585 (4%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPREI A DPY  ++ DE + + + R +  ++ +++ L              DPNF++
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKK----LGTTSYFTE 120
           I+VP+SP K+      ++   H A     +    N+NE  + +  ++      TT+YF E
Sbjct: 61  IEVPQSPTKNR-----VKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFME 115

Query: 121 KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180
           K ++   NE + I + + ++  RV+TF+ D   +Y PI  +E +  S L + +RY+P   
Sbjct: 116 KFQNAKKNEDKQIAKFESMMNARVHTFSTDE-KKYVPIITNELESFSNLWVKKRYIPEDD 174

Query: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240
           L++    IK+LRL KLF+K+R PKF EP+Y NW  +G+IS K++ + T+S KPVKFF  T
Sbjct: 175 LKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFT 234

Query: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300
           I+DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S 
Sbjct: 235 ITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWR--PSGRGNFIKSFNLRISH 292

Query: 301 DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360
           D   ILE+G S++ G C    K   K CG+PIN      C YH+E + R  S++R+E++ 
Sbjct: 293 DFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNG 352

Query: 361 SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420
             A+ AP     Q ++ K++  NG   I+  +   K    E    + +   F+++N++ A
Sbjct: 353 GYALGAPTKVDSQPSLYKAKGENGFNIIKGTR---KRLSEEEERLKKSSHNFTNSNSAKA 409

Query: 421 FFDDDYENPDILANLDNKRRKIQELRN----NRNXXXXXXXXXXXXXXXXXXRVNQEAKK 476
           FFD+ ++NPD+LANLDNKRRKI E +     +R                      Q+ K+
Sbjct: 410 FFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKR 469

Query: 477 TATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKND----KQLAITDICNIKKDN 532
           T T S  Q GL  ++G+DPT GK S ++L+ S     PKN+    K+  I D+ + KK+ 
Sbjct: 470 T-TESALQTGLIQRLGFDPTHGKIS-QVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEK 527

Query: 533 VSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577
           V L PSK +  +K   R  ++ +   GS+E  +  +GS+ DLEII
Sbjct: 528 VILAPSKNEWFKKRSHREEVWQKHF-GSKETKETSDGSASDLEII 571

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  342 bits (878), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/563 (35%), Positives = 309/563 (54%), Gaps = 25/563 (4%)

Query: 6   TDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDSI 65
           TDPRE+   D ++ ++ DE E  ++K+++ E++ ++RDL                + + +
Sbjct: 5   TDPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERV 64

Query: 66  DVPESPK---KSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKK--LGTTSYFTE 120
           +VP SPK   KS  + +  +  K I   A       N N D +    K     TTSYF E
Sbjct: 65  EVPASPKEERKSKASPQSQKSSKGITLAA-------NSNNDSIEVPWKNGPSNTTSYFVE 117

Query: 121 KLRSINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRYVPLA 179
              +    E + I+ +  LL+ RV+TF G D     +P+ VDEK+  SG  I RRY+  +
Sbjct: 118 NFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTS 177

Query: 180 VLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSL 239
            L +  + IKVLRLPKLFSKVR PKF+EPDY NW+ +GIIS K+E ++T+S KP K+F +
Sbjct: 178 ELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKM 237

Query: 240 TISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAG----ASPSYATFS 295
           T++DF   L++  F    VEKYY LR+GD+IAILNP+I+P +  +      + P   +F+
Sbjct: 238 TLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFN 297

Query: 296 LKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRR 355
           L +  + + +LE+G SK+ G C+   K   K CGAPIN+   + C YH++ + R  +++R
Sbjct: 298 LSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQR 357

Query: 356 VEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSA 415
           VE++ S ++R+PV  G +Q +    +       + Q  PDK   +       N   FS+ 
Sbjct: 358 VELNGSTSLRSPVKNGKKQAL----YGTSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNP 413

Query: 416 NASTAFFDDDYENPDILANLDNKRRKIQELRNNR---NXXXXXXXXXXXXXXXXXXRVNQ 472
           N + AFFDD Y+NPD+L NL+NKRRK+++    R   N                  +  Q
Sbjct: 414 NYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQ 473

Query: 473 EAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQLAITDICNIKKDN 532
           +  K AT  +   GL   IG+DP +GK   E+L++     +  N K   + +I + KK N
Sbjct: 474 KQMKDATEQVLNSGLLRDIGFDPFRGKMR-EVLKFGKNVNSGLNSKSSQVKEIMSFKKSN 532

Query: 533 VSLKPSKKQLKEKIEKRNAIFNE 555
           VSL PSK + K+++ +R  ++ E
Sbjct: 533 VSLAPSKAEQKKRLLRREQVWRE 555

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  341 bits (874), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/584 (35%), Positives = 320/584 (54%), Gaps = 26/584 (4%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPREI A DPY  ++ DE + + + + +  ++ +K+ L              DPNF++
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 65  IDVPESPKKSDNATKGIEDIKH-IAPVADIEEATFNVNEDYVREKVKKL--GTTSYFTEK 121
           ++VP+SP K     K  + +K  I PVA       N+NE  + ++ ++    TT+YF +K
Sbjct: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVAS------NINESMLSQQSQESPSNTTTYFMQK 114

Query: 122 LRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAVL 181
            +    NE + I + + ++  RV+TF  D   EY+PI  +E +  S L + +RY+P   L
Sbjct: 115 FQDAKRNEDKQIAKYEGMMNARVHTFGTDN-KEYKPIITNELESFSNLWVKKRYIPEEDL 173

Query: 182 RKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLTI 241
           ++    IK+LRL KLF+K+R PKF EPDY NW  +G+IS K++ + T+S KPVKFF  TI
Sbjct: 174 KRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTI 233

Query: 242 SDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSKD 301
           +DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S D
Sbjct: 234 TDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWR--PSGRGNFIKSFNLRISHD 291

Query: 302 TNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISSS 361
              ILE+G S++ G C    K   K CG+PIN      C YH+E + R   ++R+E++  
Sbjct: 292 FKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGG 351

Query: 362 VAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTAF 421
            A+ AP     Q ++ +++  N    +R  +   K    E    + N   F+++N++ AF
Sbjct: 352 YALGAPTKVDSQPSLYRAKGENQFNIVRSTR---KGLSEEEERVKRNSHNFTNSNSAKAF 408

Query: 422 FDDDYENPDILANLDNKRRKIQELRN----NRNXXXXXXXXXXXXXXXXXXRVNQEAKKT 477
           FD+ ++NPD+LANLD+KRRKI + +     +R                      Q+ K+T
Sbjct: 409 FDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQT 468

Query: 478 ATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPK----NDKQLAITDICNIKKDNV 533
            T S  Q GL  ++G+DPT GK S ++L+ S           N K+  I D+   KK+ V
Sbjct: 469 -TESALQTGLIQRLGFDPTHGKIS-KVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKV 526

Query: 534 SLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577
            L PSK +  +K   R  ++     GS+E     + S  DLEI+
Sbjct: 527 ILAPSKNEWFKKRSHREEVWQRHF-GSKETEVASDASGSDLEIV 569

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  337 bits (864), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/585 (34%), Positives = 321/585 (54%), Gaps = 26/585 (4%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPRE    DPY  ++ DE + + + + +  ++ +K+ L              DPNF++
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKL----GTTSYFTE 120
           I+VP+SP K+ N  K    +K      D+  A  N+N+  + +  +K      TT YF +
Sbjct: 61  IEVPQSPAKNRNIMKSQNTMKR-----DMRPAASNINDLKLSQLQQKQELPSNTTGYFMQ 115

Query: 121 KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180
           K ++   NE +   + + ++  RV+TF  D   EY     +E ++ S + + +RY+P   
Sbjct: 116 KFQNAKRNEEKQRAKYENMMNARVHTFGTDK-KEYRATIANELEEFSNIWVKKRYIPEDD 174

Query: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240
           L++    IK+LRL KLF+K+R PKF EPDY NW V+G+IS K++ + T+S KP KFF  T
Sbjct: 175 LKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFT 234

Query: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300
           I+DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S 
Sbjct: 235 ITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWR--PSGQGNFIKSFNLRISH 292

Query: 301 DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360
           D   ILE+G S++ G C    + K + CG+PIN      C YH+E + R  S++R+E++ 
Sbjct: 293 DFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNG 352

Query: 361 SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420
             A+ AP     Q T+ +++  N    +R  +   K    E    + N   F ++N++ A
Sbjct: 353 GYALGAPTKVDAQPTLYRAKGENNFNLVRSIR---KTLSEEEERMKKNSHNFRNSNSAKA 409

Query: 421 FFDDDYENPDILANLDNKRRKIQELRN----NRNXXXXXXXXXXXXXXXXXXRVNQEAKK 476
           FFD+ ++NPD+LANLD+KRRKI + +     +R                      Q+ K+
Sbjct: 410 FFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQ 469

Query: 477 TATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKN----DKQLAITDICNIKKDN 532
           T T S  Q GL  ++G+DPT GK S ++L+ S     P+N     K+  I D+ N KK+ 
Sbjct: 470 T-TESALQTGLLQRLGFDPTHGKIS-KVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEK 527

Query: 533 VSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577
           V L PSK +  +K   R  ++ +   GS++  +  + S+ DLEI+
Sbjct: 528 VILAPSKNEWFKKRSHREEVWQKHF-GSKDTDEVSDASTSDLEIV 571

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  337 bits (865), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 211/591 (35%), Positives = 322/591 (54%), Gaps = 36/591 (6%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPRE    D Y  LS DE E + +  ++  I+ +K+DL              DPNF  
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVK---KLGTTSYFTEK 121
           + VP SPKKS      + ++K  +   D  E     N + V    K     GTTSYF EK
Sbjct: 59  VQVPSSPKKS-----RVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEK 113

Query: 122 LRSINTNEHEAIKRKKELLAHRVYTFNGDMFD-EYEPITVDEKDDLSGLVIDRRYVPLAV 180
             +   +    +     +++ RV+TF+G     E++P  VDE D  S L +  RY+P+  
Sbjct: 114 FYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDE 173

Query: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240
           L     +IK+LRLPKLF+KVR PKF+EP Y NW+V GII+ K + + T+S KP K+F  T
Sbjct: 174 LNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFT 233

Query: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLE--AGASPSYATFSLKV 298
           ISDFQ  L+V  FG   VEKYY LR+GD++AILNPEI+P +  E   G+  +  +F+L++
Sbjct: 234 ISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRI 293

Query: 299 SKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEI 358
           S   + ILE+G S++ G C     +K  LC  PINK  ++ C YH+E + R+ +S RVE+
Sbjct: 294 SHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVEL 353

Query: 359 SSSVAMRAPVVKGYQQTIVKSQ--HNNGKTSIRYQQNPDKPFV--REPAAAETNRFLFSS 414
           S + A+ AP     +  + +++   NN +    Y    D  +   ++    ET    FS+
Sbjct: 354 SGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFST 413

Query: 415 ANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNXXXXXXXXXXXXXXXXXXRVNQEA 474
            N++ AFFD+D++NPDIL NLD+KRRKI++ +  RN                   V++E+
Sbjct: 414 MNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNT-----------VDKES 462

Query: 475 K-----KTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAP---KNDKQLAITDIC 526
           K     K AT +  Q G+  ++G+DPT GK S  +   ++E +     + +K+ A+ D+ 
Sbjct: 463 KNFKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLM 522

Query: 527 NIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577
             +KD V+LKPSK  L ++   R   + ++    Q  +D ++ S  DL+I+
Sbjct: 523 TFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKIL 573

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  336 bits (861), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/585 (34%), Positives = 319/585 (54%), Gaps = 25/585 (4%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPREI A DPY  ++ DE + + + + +  ++ +++ L              DPNF++
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKK----LGTTSYFTE 120
           I+VP+SP KS   +     +K +  +      T N NE  + +  K+    + TT+YF +
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLE-----TSNANESNLSQIQKQPELPINTTTYFMQ 115

Query: 121 KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180
           K ++   +E   I + + ++  RV+TF  D   +Y+PI  +E +  S L + +RY+P   
Sbjct: 116 KFQNAKKDEDRQIAKFESMMDARVHTFGTDN-KKYKPIIANELEGFSNLWVKKRYIPEDD 174

Query: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240
           L++    IK+LRL KLF+KVR PKF  P+Y NW  +G+IS K++ + T+S KPVKFF  T
Sbjct: 175 LKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFT 234

Query: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300
           I+DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S 
Sbjct: 235 ITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWR--PSGRGNFIKSFNLRISH 292

Query: 301 DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360
           D   ILE+G S++ G C        K CG+PIN      C YH+E + R  S++R+E++ 
Sbjct: 293 DFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNG 352

Query: 361 SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420
             A+ AP     Q ++ K++  N    IR   +  K    E    + +   F+++N++ A
Sbjct: 353 GYALGAPTKVNSQPSLYKAKGENRFNIIR---DARKGLSEEEERMKKSSHNFTNSNSAKA 409

Query: 421 FFDDDYENPDILANLDNKRRKIQELRN----NRNXXXXXXXXXXXXXXXXXXRVNQEAKK 476
           FFD+ ++NPD+LANLDNKRRKI + +     NR                      Q+ K+
Sbjct: 410 FFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQ 469

Query: 477 TATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKND----KQLAITDICNIKKDN 532
           T T +  Q GL  ++G+DPT G+ S ++L+ S      KN+    K+  I D+ + KK+ 
Sbjct: 470 T-TENALQTGLIQRLGFDPTHGEIS-KVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEK 527

Query: 533 VSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577
           V L PSK +  +K   R  ++        E  +  + S+ DLEII
Sbjct: 528 VILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  328 bits (842), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/587 (34%), Positives = 321/587 (54%), Gaps = 34/587 (5%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPRE+   DP+ EL+ DE +   ++ +IVEI+ +KRDL              DPNFD+
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSK-DPNFDA 59

Query: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVK-KLGTTSYFTEKLR 123
           I V  SP K    +  +E  +    V DIE    N+NE  V  + +    TTSYF +  R
Sbjct: 60  IQVESSPVKKPAESIKVEPSR-TKRVLDIE----NLNEKKVESRSQIPANTTSYFIDNFR 114

Query: 124 SINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRYVPLAVLR 182
           +    E ++ + ++ELL+ RV+TF G D   +++ + V+E ++ S L + +RY+    LR
Sbjct: 115 NSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLR 174

Query: 183 KHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLTIS 242
           K    +K+LRL KLF+K++ PKF+EP Y NW  +GIIS K + + ++S KP+K+F  T++
Sbjct: 175 KVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLT 234

Query: 243 DFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSKDT 302
           DFQ+ L+V  FGK  VE+YY LR+GD++AILNPE++P +  E G      +F+L++S D 
Sbjct: 235 DFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGN--FIKSFNLRISHDF 292

Query: 303 NNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISSSV 362
             ILE+G S++   C+ + K++ K CG PINK  +  C +H+E + R N ++R+E++ S 
Sbjct: 293 PCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSF 352

Query: 363 AMRAP--VVKG---YQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANA 417
           A+ AP  V  G   Y++    +  N       YQ++  K        ++     FS+ NA
Sbjct: 353 ALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGK-------NSDLRGIHFSNGNA 405

Query: 418 STAFFDDDYENPDILANLDNKRRKIQELRNNRNXXXXXXXXXXXXXXXXXXRVNQEAKK- 476
           + AFF+D+++NPDIL NLD+KRRK Q+   ++                    + + +KK 
Sbjct: 406 AKAFFNDEFQNPDILNNLDSKRRKRQD---DKKSLILQQQLKRINSRHAAIEIEKGSKKY 462

Query: 477 ----TATLSMFQHGLANQIGYDPTKGKAS--LEMLEYSTENKAPKNDKQLAITDICNIKK 530
                 T +  Q GL   +G+DPT G+    L+       N    N KQ  ++ +   KK
Sbjct: 463 EEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKK 522

Query: 531 DNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577
           ++V LKP+K+ L ++   R   + E        L  D  S  D+EI+
Sbjct: 523 EHVELKPAKEVLLQRKRDRERAWQENFGDKSVNLSSD--SDSDIEIV 567

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 208/595 (34%), Positives = 324/595 (54%), Gaps = 33/595 (5%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           ++DPREI   D Y+ ++ D+ +  R++  + +I+  KRDL              DPNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKL--------GTTS 116
           + VP SP K        +  + +  +   EE+  N NE  ++++ +K          +T 
Sbjct: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120

Query: 117 YFTEKLRSINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRY 175
           YF EK R     E   I++ + ++  RV+TFNG +  +EY+ + VDE +  S L I++RY
Sbjct: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180

Query: 176 VPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVK 235
            P++ L+     +K+LRL KLF+KVR PKF EP Y NW+V+GI+S K++ + T S KP K
Sbjct: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240

Query: 236 FFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFS 295
           +   T++DF+ +++   FGK  VE+YY LR+GD+IA+LNPEI+P +   +G      +F+
Sbjct: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWR--PSGKQNYIKSFN 298

Query: 296 LKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRR 355
           L++S     ILE+G S++   C   +++  K CG PINK  D  C YH+E ++R+  S+R
Sbjct: 299 LRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKR 358

Query: 356 VEISSSVAMRAP--------VVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAET 407
           +++S   A+ AP        + +G+    VK Q  N K +  Y QN   P + +    E 
Sbjct: 359 LDLSGQYALGAPTKLESQPALYRGHTAQNVKIQ--NFKLTPSYSQN--NPHLID-KYGEK 413

Query: 408 NRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELR-NNRNXXXXXXXXXXXXXXXX 466
           ++F FS+ NA+ AFFDD+++NPD+++NLDNKRRKI E R +N                  
Sbjct: 414 SKF-FSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLEG 472

Query: 467 XXRVNQEAKKTATLSMFQHGLANQIGYDPTKGKAS--LEMLEYSTENKAPK--NDKQLAI 522
             R   E  K  T    Q GL  ++G+DPT GK S  L+  E S + + PK  + K   +
Sbjct: 473 KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGE-PKFLSQKDRTV 531

Query: 523 TDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577
            D+   KK+ + L PSK  L  K  KR  ++ E     Q + + +  S  DLEI+
Sbjct: 532 DDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENF--GQNKSNDNSESDSDLEIV 584

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 204/594 (34%), Positives = 323/594 (54%), Gaps = 41/594 (6%)

Query: 7   DPREITAFDPYEELSDDESEIER-VKRRIVEIDTEKRDLTXXXXXXXXX--XXXXDPNFD 63
           DPRE+   DPY +LS+D+ E E  ++R +  I+ +K+DL                DPN  
Sbjct: 8   DPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNMK 67

Query: 64  SI------DVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVN-----EDYVREKVKKL 112
           +I      +VP SPK+   +    E+++H  P     +A  N       ED VR+++  +
Sbjct: 68  NINSRGRVEVPRSPKRE--SLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRKELDVV 125

Query: 113 GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDM-FDEYEPITVDEKDDLSGLVI 171
            TTSYF  K ++  T+E+  +   +++++ R +TFNG     + + I  DE +  S   I
Sbjct: 126 ATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFHI 185

Query: 172 DRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSV 231
            +RY+P   + K    IK+LRL KLF+KVR P FSEP Y NW+ +G IS K + ++TN+ 
Sbjct: 186 KKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAA 245

Query: 232 KPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSY 291
           KPVK+F  T++DF+  L+V  FGK  VE+YY LR+GD+IA+LNPEI+P +   +G     
Sbjct: 246 KPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWR--PSGCVNGI 303

Query: 292 ATFSLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQN 351
            +F+L++  D N ILE+G S++ G CQ     + K+C +PIN   D  C +H+E +MR  
Sbjct: 304 KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363

Query: 352 SSRRVEISSSVAMRAPVVKGYQQTIVKSQH-----NNGKTSIRYQQNPDKPFVREPAAAE 406
           +S+R+E+S S A+ AP   G Q +I K  +     N  K  +           +E    E
Sbjct: 364 ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKKEQEKEKHE 423

Query: 407 TNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNXXXXXXXXXXXXXXXX 466
                FS+  A+ AFFDD +++P +LANL++KRRKI+  + +RN                
Sbjct: 424 IEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALNGEDASQSK-- 481

Query: 467 XXRVNQEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYS--TENKAPKNDKQLA-IT 523
               N++  K  T    Q G+  ++G+DP+ G+ + ++L+ S  T+   P   K++  I 
Sbjct: 482 ----NKQQVKEITEKTLQTGVIQRLGFDPSGGQIA-KVLDKSRGTKTDDPTISKKMGLIN 536

Query: 524 DICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577
           D+ + KKD + LKPS++   EK  +R AI+ +  + + +       S  DLEI+
Sbjct: 537 DLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTND-------SDSDLEIV 583

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/581 (34%), Positives = 319/581 (54%), Gaps = 21/581 (3%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPRE+   D Y+ L+ +  E   ++ +I EI+ +K+DL              DPN   
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKLGTTSYFTEKLRS 124
           I V  SPKK  N+      ++   P  ++     N  +   +E++    TTS+F EK  +
Sbjct: 61  IQVESSPKKVTNSVLP-PTVQQQEPRGEVRNENLNELKAQSQEQIP-ANTTSFFIEKYST 118

Query: 125 INTNEHEAIKRKKELLAHRVYTFNGDMF-DEYEPITVDEKDDLSGLVIDRRYVPLAVLRK 183
               +   ++ +++LL++RV+TF G    DEY+PI  +E ++ S L I +RY+P    R 
Sbjct: 119 SKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRS 178

Query: 184 HTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLTISD 243
              NIK+LRL KLF+KV+ PKF+EP Y NW V+G+IS K E + T++  P K+F  T+++
Sbjct: 179 IFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTN 238

Query: 244 FQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSKDTN 303
           FQ+ ++   FGK  VE+YY LR+GD+IAILNP+++P +   +G      +F+L++S    
Sbjct: 239 FQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWR--PSGTKAHIKSFNLRISHKFE 296

Query: 304 NILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISSSVA 363
            ILE+G S++ G C  + K+K ++C APINK  ++ C YH+E K R  +++RVE+S + A
Sbjct: 297 CILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYA 356

Query: 364 MRAPVVKGYQQTIVKSQHNNGKTSIRYQ---QNPDKPFVREPAAAETNRFLFSSANASTA 420
           + AP     Q  + +    + + ++ Y       D    +E    + N   FS+ NA+ A
Sbjct: 357 LGAPTRIDAQPALYRG--GSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKA 414

Query: 421 FFDDDYENPDILANLDNKRRKIQELRNNRNXXXXXXXXXXXXXXXXXXRVNQEAK--KTA 478
           FFD+ ++NP+ L NL+NKRRK   LR+NR                   +  +E    K  
Sbjct: 415 FFDERFQNPETLRNLENKRRK---LRDNRKSNILNRELKKNSELDIKHKSAEEIDEIKRT 471

Query: 479 TLSMFQHGLANQIGYDPTKGK-ASLEMLEYSTENKAPKNDKQLAITDICNIKKDNVSLKP 537
           T S    G+   +G+DPT+GK AS+   + S  +K P  +K  ++  + + KKDNV LKP
Sbjct: 472 TESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVASLLSFKKDNVKLKP 531

Query: 538 SKKQLKEKIEKRNAIFNE-IMKGSQERLDKDEGSSDDLEII 577
           SK+ L ++  +R  ++ E    G  E+ D D     DLEI+
Sbjct: 532 SKEILIKQKRRRERVWKEHFGSGGDEKDDSD----SDLEIV 568

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  318 bits (816), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/463 (38%), Positives = 270/463 (58%), Gaps = 21/463 (4%)

Query: 129 EHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRYVPLAVLRKHTKN 187
           E   IK + E+L  RV+TF G       +PI V+EK+  SGL + RRY+    L +  K+
Sbjct: 11  EESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIASDELAEILKD 70

Query: 188 IKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLTISDFQFE 247
           IK+LRLPKLFSKVR PKF+EPDY NW+ +GI+  K+  +MT+S KP K+F +TI+DF   
Sbjct: 71  IKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYFKMTITDFTHS 130

Query: 248 LNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAG----ASPSYATFSLKVSKDTN 303
           L+V  F    VEKYY LR+GD+IAILN +I+P +  + G    +  S  +F+L +  + +
Sbjct: 131 LDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKSFNLSIRGNYD 190

Query: 304 NILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISSSVA 363
            +LE+G S++ G CQ Y K KGK+CGAPIN+   + C YH+E + RQ +++RVE++ S++
Sbjct: 191 CVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNAQRVELNGSMS 250

Query: 364 MRAPVVKGYQQTIVKSQHNNGKTSIRYQQN--PDKPFVREPAAAETNRFLFSSANASTAF 421
           +R+PV  G +Q +       G + ++ + N  PDK   ++      N   FS+ N + AF
Sbjct: 251 LRSPVKNGKKQALY------GSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNPNYAKAF 304

Query: 422 FDDDYENPDILANLDNKRRKIQELRNNRNXXXXXXXXXXXXXXXX-XXRVNQEAK--KTA 478
           FDD Y+NPD+L NLD+KRRK+++  + R                    +  QE K  K A
Sbjct: 305 FDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQKQMKQA 364

Query: 479 TLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQLAITDICNIKKDNVSLKPS 538
           T      GL   IG+DPTKGK   ++L+    +K   + K + + +I   +K NVSL PS
Sbjct: 365 TEQTIHSGLLKNIGFDPTKGKMR-DVLKVGKNSKNSTDTKSIQVREIIETRKTNVSLAPS 423

Query: 539 KKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSD----DLEII 577
           K   K+++ +R  ++ E  +   +    ++  SD    DLEI+
Sbjct: 424 KADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  321 bits (823), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 208/618 (33%), Positives = 325/618 (52%), Gaps = 52/618 (8%)

Query: 7   DPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFD-SI 65
           DPR++   DPY+ ++ DE E  +++R + E++  K+DL              D N    +
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 66  DVPESPKKS-----DNATKGIEDIKHI-----------APVADIEEATF-NVNEDYVREK 108
            VP SP+K      D A K  E+ + I           A   ++ EA F  ++ D  ++ 
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 109 VKKLGTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSG 168
           V    TTSYF EK +     E   I+ ++ +L+ RV+TF G +  E++   V+E +  S 
Sbjct: 124 VN--ATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQG-VDKEFQLEAVNELEQFSD 180

Query: 169 LVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMT 228
           L I +RY+P   L +  +++K+LRL KLF+KVR PKF EP Y NW VL IISKK+E + T
Sbjct: 181 LWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFT 240

Query: 229 NSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGAS 288
            S  P KF   T+++FQ +L++  FG + V++YY LR GD++A+LNPEI+P +   +G S
Sbjct: 241 TSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWR--PSGGS 298

Query: 289 ---PSYATFSLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKE 345
               S  +F+LK++     ILE+G S++ G C    K   + CG+ IN   D  C YH+E
Sbjct: 299 QQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRE 358

Query: 346 AKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIR-YQQNPDKPFVREPA- 403
            +MRQNSS+R++++   A+ AP   G Q  + +      K S R   ++  K F  EP+ 
Sbjct: 359 LQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSW 418

Query: 404 --------AAETNRFL----FSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNX 451
                   ++E N  L    F+S+NA+ AFFDD+++NPD+L NLD KRRK+Q+ + +R  
Sbjct: 419 NSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQL 478

Query: 452 XXXXXXXXXXXXXXXXXRVN---QEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYS 508
                              N     A K  T +    GL  ++G+DPT G+A+  M +  
Sbjct: 479 DRKLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRD 538

Query: 509 TENKAPKND------KQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQE 562
           +E  +  N+      K+  + ++   K+D  +L PS+ QL  + + R  ++ E       
Sbjct: 539 SERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGT 598

Query: 563 RLDK---DEGSSDDLEII 577
            +D    D   SDDLEI+
Sbjct: 599 PVDSQPVDNDDSDDLEIV 616

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 199/565 (35%), Positives = 306/565 (54%), Gaps = 46/565 (8%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPRE+   DPY+ +S DE + E + R +  ++ +++DL              DPNF  
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 65  IDVPESPKKSDNATKGIEDIKHIAPVA------DIEEATFNVNEDYVREKVKKL--GTTS 116
           + VP SP K               PVA      ++E    N NE  +REK  +L   TT+
Sbjct: 61  LQVPCSPVKKTETN---------VPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTT 111

Query: 117 YFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDMF-DEYEPITVDEKDDLSGLVIDRRY 175
           YF EK +     E   I++ + ++  RV+TF       E++PI V+E ++ S + + +RY
Sbjct: 112 YFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRY 171

Query: 176 VPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVK 235
           +P + LRK   NIK+LRL KLF+KVR PKFSEP Y NW  LGIIS K + + T + KP K
Sbjct: 172 IPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKK 231

Query: 236 FFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFS 295
           +   T++DFQ +L+V  FGK  VE+YY LR+GD+IAILNPE+ P +   +G      +F+
Sbjct: 232 YLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWR--PSGKGQFIKSFN 289

Query: 296 LKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRR 355
           L+++ D   ILE+G SK+ G C+   +N G LC  PIN   ++ C YH+E + R N+S+R
Sbjct: 290 LRINHDFKCILEIGSSKDLGFCKVTSRN-GTLCNTPINMSKEDRCDYHQEIRFRDNNSKR 348

Query: 356 VEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNR------ 409
           +E++ S A+ AP       T+ + ++   + S + +QN    F    +    N+      
Sbjct: 349 IELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQN----FSVSASFGSINKDQFDLR 404

Query: 410 -FLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRN-NRNXXXXXXXXXXXXXXXXX 467
              FS+ N++ AFFD+ ++NPD+L NL++KRRKIQ+ +   R                  
Sbjct: 405 NRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLG 464

Query: 468 XRVNQEAK--KTATLSMFQHGLANQIGYDPTKGK-ASLEMLEYSTENK-------APKND 517
            R   E K  K AT +  Q G+  ++G+DPT GK A++    +S E K       + K D
Sbjct: 465 ERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKD 524

Query: 518 KQLAITDICNIKKDNVSLKPSKKQL 542
           K   + D+ + +K +V L P++ +L
Sbjct: 525 K---VNDLLHFRKSHVILAPTRNEL 546

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  299 bits (765), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 192/538 (35%), Positives = 296/538 (55%), Gaps = 27/538 (5%)

Query: 59  DPNFDSIDVPESP-KKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVK-KLGTTS 116
           DPNF  I +  SP KK  N    +  I     V D+     N NE  V         TTS
Sbjct: 15  DPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV-----NPNEAKVVSNANLPANTTS 69

Query: 117 YFTEKLRSINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRY 175
           YF +        E + +K  ++ ++ RV++F G ++  +Y+ I V+E ++ S   I +RY
Sbjct: 70  YFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEYSRFNISKRY 129

Query: 176 VPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVK 235
           +P   + K   NIK+LRL KLF+K+R PKFSEPDY NW V GII  K + ++T+S  PVK
Sbjct: 130 LPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIKLTSSKTPVK 189

Query: 236 FFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFS 295
           FF  TI++FQ  L++  FG + VEKYY LR+GD+I ILNPE++P +    G   S  +F+
Sbjct: 190 FFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEFKGN--SIKSFN 247

Query: 296 LKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRR 355
           L++S   + ILE+  SK+   CQ   +  G  C  PINK   + C YHKE + R  +++R
Sbjct: 248 LRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQFRSANAKR 307

Query: 356 VEISSSVAMRAPVVKGYQQTIVKSQH-NNGKTSIRYQQNPDKPFV--REPAAAETNRFLF 412
           VE+S + A+ AP     +  + +S++ +N K    +    D+ ++  +E     + R  F
Sbjct: 308 VELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKENDPINSKRHHF 367

Query: 413 SSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNXXXXXXXXXXXXXXXXXXRVNQ 472
           SS+N++ AFFD+D++NPD+L NL+NKRRKI++ + +                    + NQ
Sbjct: 368 SSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRESVGNSKLLLKDKSNQ 427

Query: 473 EAK--KTATLSMFQHGLANQIGYDPTKGKASLEM---LEYSTENKAPKNDKQLAITDICN 527
           E +  +  T +  Q+G   ++G+DPT G+  + +    + ST++K  K  K  A+ ++  
Sbjct: 428 EIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADKSTQSKLQK-QKSNAMENLVT 486

Query: 528 IKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKG--SQERLDKDEGS------SDDLEII 577
            KK +V+LKPS++ L EK+  R   F +  K   + E  D+   S      SDDLEII
Sbjct: 487 FKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDTDSDDLEII 544

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  300 bits (768), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 204/618 (33%), Positives = 317/618 (51%), Gaps = 53/618 (8%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPRE +  DP+ +LSD E   + V   + ++D  K DL              DPNFD 
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 65  IDVPESPKK-------SDNATKGIEDIKHIAPVADI--EEATFNVNEDYVREKVKKL--- 112
           + +P +P++       S+       D K      +    E   N NE  VRE+ + L   
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 113 --GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDMFD------EYEPITVDEKD 164
              TTSYF EK + +   E     R +++L  RV+ F G          EY+P   +E +
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 165 DLSGLVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTE 224
           + S L I +RY+P   L    +NIK+LRL KLF+KVR PKF EP Y NW+ LGII++K  
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 225 PRMTNSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLE 284
            + T+S KP K+F  TISDF++ +++  F K  VE+YY LR+GD+IAILNPE++P +   
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 285 AGASPSYATFSLKVSKDTNNILELGHSKEFGLCQFYMK-NKGKLCGAPINKLHDNYCAYH 343
                   +F+L+++ + + I+E+G SK+ G C    K N+   C  PI+   ++ C+YH
Sbjct: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360

Query: 344 KEAKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQ--------HNNGKTSIR---YQQ 392
           +E + R N S+R+E++ S A+ APV  G Q  + ++         H N    ++    ++
Sbjct: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420

Query: 393 NPDKPFVREPAAAETNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNXX 452
           N  K         E  R  FSS N++ AFFD+ ++NPD+L NLD KRRKI + + + N  
Sbjct: 421 NESK------LMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRS-NYL 473

Query: 453 XXXXXXXXXXXXXXXXRVNQEAK-----KTATLSMFQHGLANQIGYDPTKGKAS--LEML 505
                             N+  K     K+AT +  Q G+  ++G+DPT GK +  L+  
Sbjct: 474 DQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTG 533

Query: 506 EYSTENKAPKNDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERL- 564
           + S ++      K   + D+   KK  V L P+K++L ++  +R  ++ +   GS +RL 
Sbjct: 534 KDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHF-GSGKRLA 592

Query: 565 -----DKDEGSSDDLEII 577
                D  + S  DLEI+
Sbjct: 593 EQPLNDDVDTSESDLEIV 610

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  295 bits (754), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 195/608 (32%), Positives = 315/608 (51%), Gaps = 49/608 (8%)

Query: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTXXXXXXXXXXXXXDPNFDS 64
           + DPRE+   D ++ +S DE E   ++++I  I+ +KRDL              DPNF S
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 65  ------------IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKL 112
                       I VP SP+K       +           I++   N NE  ++ +++  
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQD---NPNELKLKNQIEPA 117

Query: 113 ----GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNG--DMFDEYEPITVDEKDDL 166
               G+T+YF     S    E + I+  + L++ RV++F    ++  E + I V+EK+  
Sbjct: 118 SVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKY 177

Query: 167 SGLVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPR 226
           SGL I RRY+    + +  ++IK+LRL KLF+K+R PKF  P Y NW+ +G+I++K+  +
Sbjct: 178 SGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFK 237

Query: 227 MTNSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAG 286
           +T+S  P K+F  TI DFQ  +++  F +  + KYY LR+GD+I ILNP I P +  E  
Sbjct: 238 LTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEEN 297

Query: 287 ASPSYATFSLKVSKDTNNILELGHSKEFGLCQFYMKNK-GKLCGAPINKLHDNYCAYHKE 345
                 +F+L +    + I+E+G S++ G C   +K+K GK CG PINK  D  C +H+E
Sbjct: 298 G--YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRE 355

Query: 346 AKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAA 405
            + R  +++R+E++ S A+ AP       ++ K + NN      Y +N      R  A  
Sbjct: 356 TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNN-----IYSKNQFNVVRRRNARK 410

Query: 406 ETNRFL----FSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNXXXXXXXXXXX 461
           E +  L    F S N + AFF+D+++NPDI++NLD+KRRK+++ + +             
Sbjct: 411 EGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTK 470

Query: 462 XXXXXXXRVNQEAK--------KTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKA 513
                    N E K        +  T ++ Q G+   IGYDPT GK    M + + ++ +
Sbjct: 471 EDNVSK---NLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPS 527

Query: 514 PKNDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKD----EG 569
             +++  A+ D+ + KKD V+LKP K  L  K  KR+ I+NE   G Q + ++D     G
Sbjct: 528 YTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYF-GDQSKSNRDIILSSG 586

Query: 570 SSDDLEII 577
              DLEI+
Sbjct: 587 DDSDLEIV 594

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,082,384
Number of extensions: 2897830
Number of successful extensions: 9102
Number of sequences better than 10.0: 51
Number of HSP's gapped: 9292
Number of HSP's successfully gapped: 51
Length of query: 577
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 462
Effective length of database: 40,294,809
Effective search space: 18616201758
Effective search space used: 18616201758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)