Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00550g5.704ON38038020160.0
SAKL0E14960g5.704ON3843037981e-103
TDEL0B021605.704ON3753197615e-98
NCAS0A031905.704ON3983737105e-90
ZYRO0G06556g5.704ON3793676991e-88
Kwal_55.196885.704ON3933156941e-87
KLTH0E01012g5.704ON3863186922e-87
AFR288C5.704ON4653036749e-84
KAFR0H002005.704ON3893656662e-83
KNAG0C066105.704ON3863216364e-79
TPHA0D046205.704ON4063236254e-77
CAGL0G02519g5.704ON3783575772e-70
NDAI0E050505.704ON4513705562e-66
Kpol_YGOB_Anc_5.7045.704ON2071903291e-35
KNAG0E027306.48ON748106780.38
KNAG0M011106.48ON598114770.53
ABR231W8.14ON88193750.97
SAKL0A01452g6.333ON99093703.8
NCAS0E028907.344ON31557693.9
NDAI0K028706.48ON66277695.5
KAFR0C003603.296ON827159687.6
ACR142W8.676ON83782678.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00550g
         (380 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   781   0.0  
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   311   e-103
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    297   5e-98
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    278   5e-90
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   273   1e-88
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   271   1e-87
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   271   2e-87
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   264   9e-84
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      261   2e-83
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   249   4e-79
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   245   4e-77
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   226   2e-70
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   218   2e-66
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   131   1e-35
KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {O...    35   0.38 
KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {...    34   0.53 
ABR231W Chr2 (836764..839409) [2646 bp, 881 aa] {ON} Syntenic ho...    33   0.97 
SAKL0A01452g Chr1 (137799..140771) [2973 bp, 990 aa] {ON} simila...    32   3.8  
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...    31   3.9  
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    31   5.5  
KAFR0C00360 Chr3 (73892..76375) [2484 bp, 827 aa] {ON} Anc_3.296       31   7.6  
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    30   8.9  

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/380 (100%), Positives = 380/380 (100%)

Query: 1   MARMPDESNVTKQELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLDDEKLLANKKFEYSGE 60
           MARMPDESNVTKQELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLDDEKLLANKKFEYSGE
Sbjct: 1   MARMPDESNVTKQELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLDDEKLLANKKFEYSGE 60

Query: 61  LLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYT 120
           LLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYT
Sbjct: 61  LLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYT 120

Query: 121 VLFLSGDTSISEFVNNLPLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLSC 180
           VLFLSGDTSISEFVNNLPLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLSC
Sbjct: 121 VLFLSGDTSISEFVNNLPLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLSC 180

Query: 181 NDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKL 240
           NDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKL
Sbjct: 181 NDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKL 240

Query: 241 ESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQKRV 300
           ESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQKRV
Sbjct: 241 ESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQKRV 300

Query: 301 FMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPSQKSNFEVCCDGQLLNLLELEGKNTP 360
           FMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPSQKSNFEVCCDGQLLNLLELEGKNTP
Sbjct: 301 FMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPSQKSNFEVCCDGQLLNLLELEGKNTP 360

Query: 361 PSTIRIETCTEPSLKVLHSL 380
           PSTIRIETCTEPSLKVLHSL
Sbjct: 361 PSTIRIETCTEPSLKVLHSL 380

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  311 bits (798), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 151/303 (49%), Positives = 205/303 (67%), Gaps = 6/303 (1%)

Query: 60  ELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQY 119
           EL+I+DSV SG GR    DF+T VI    E++   +++IKT S +S+ E A  I+ ++ Y
Sbjct: 54  ELIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSY 113

Query: 120 TVLFLSGDTSISEFVNNLPLNHD----CISVLPFPMGTGNAWASSLKLMDPAVIFSQFVN 175
           T++FLSGDTSISEF+N++P  +      +++ P PMGTGNAWASSL L  P   F +F+ 
Sbjct: 114 TIIFLSGDTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLK 173

Query: 176 GKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRIL 235
             L  + FPLYRA+F NGY   FFIILS+GFHANLLHLC   +Y+ MG+ERF+ AS +I 
Sbjct: 174 NDLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIF 233

Query: 236 REYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVE 295
           + Y L+ +VSIP+ + G ++YFA+INT NLEPTY PSP SDPL S LH+L ++SSL   E
Sbjct: 234 KNYDLKYKVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSE 293

Query: 296 FQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDP--SQKSNFEVCCDGQLLNLLE 353
             KR+  G +  K  +I+  G  Y  L   F++ V   P  S +  FE+CCDGQLLNLL+
Sbjct: 294 LIKRITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLD 353

Query: 354 LEG 356
           ++G
Sbjct: 354 MQG 356

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  297 bits (761), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 215/319 (67%), Gaps = 15/319 (4%)

Query: 45  DDEKLLANKKFEYSGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKS 104
           +D++ + N+       L+++DSV SG GR    D  T V+   FE V + +RLIKTTS+ 
Sbjct: 38  EDDRTVQNQP-----NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRD 92

Query: 105 SVIELASSIDSTRQYTVLFLSGDTSISEFVNNLPLNHDC--ISVLPFPMGTGNAWASSLK 162
           ++   AS++D ++ +TVLFLSGDTSISEF+NNLP       +S+L FPMG+GNAWASSL 
Sbjct: 93  TIASYASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSANLSILSFPMGSGNAWASSLG 152

Query: 163 LMDPAVIFSQFVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKM 222
           +M P   F QF+ G++S + FPLY+A F NGY + FFIILS+GFHANL+H CE  EYQ+M
Sbjct: 153 IMCPVKTFGQFIRGEMSHSPFPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRM 212

Query: 223 GIERFRVASQRILREYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQL 282
           GIE+F++A   IL+EY+L+ ++++ + L  S+SYFALINT NLEP Y PSP+SDPL+ +L
Sbjct: 213 GIEKFQLAGSVILKEYELDLKITV-NSLAASYSYFALINTPNLEPAYRPSPESDPLKEEL 271

Query: 283 HVLAYQSSLDRVEFQKRVFMGYSNTKHSNI-LQNGTFYRPLPFCFNVE----VLDDPSQK 337
           ++L Y S L + +F  +V  GY       + L + T Y P    F+V     +L+ P  K
Sbjct: 272 YLLGYSSGLSKDQFLTKVMKGYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYK 331

Query: 338 SNFEVCCDGQLLNLLELEG 356
           S  E+CCDG LLNL +L+ 
Sbjct: 332 S--EICCDGVLLNLQDLQA 348

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  278 bits (710), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 218/373 (58%), Gaps = 25/373 (6%)

Query: 8   SNVTKQELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLDDEKLLA-NKKFEY-----SGEL 61
           S   KQ L   +   + + T L     KS+ L   L++D   L+ ++K ++     + +L
Sbjct: 2   SKSIKQYLLTIDHDHYYVETVLEGSAYKSFNL---LIEDSTPLSVDRKLQFVPLKDTAQL 58

Query: 62  LIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYTV 121
           +++DS+ SG GR  D DF  NV+   F ++ + + L+KTTSK SV   AS +D T+ Y +
Sbjct: 59  IVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEI 118

Query: 122 LFLSGDTSISEFVNNLPLN-------HDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFV 174
            FLSGDT+ISEF+N LP          + +S+LPFP GTGNA A+SL L  P  IFS ++
Sbjct: 119 FFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYL 178

Query: 175 NGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRI 234
               S N+FPLY+A F NG  + FF+ILSLGFHANLLH CE   Y+K+G+ERFR+AS+ I
Sbjct: 179 TSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDI 238

Query: 235 LREYKLESRVSI-------PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAY 287
           L  Y L+  +SI       P +    +SYF ++NT  LE  Y+PSP S+PL SQLH++AY
Sbjct: 239 LANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAY 298

Query: 288 QSSLDRVEFQKRVFMGYSNTKHSNILQNGTFYRPLP--FCFNVEVLDDPSQKSNFEVCCD 345
            SSL + E   R+  GY N     +   G  Y P+   F   +    + S  S F++CCD
Sbjct: 299 SSSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCD 358

Query: 346 GQLLNLLELEGKN 358
           G L NL +   KN
Sbjct: 359 GLLFNLNDFIHKN 371

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  273 bits (699), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 153/367 (41%), Positives = 218/367 (59%), Gaps = 13/367 (3%)

Query: 10  VTKQELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLDDEKLLANKKFEYSGELLIVDSVFS 69
            +K+ LGI+    + +          S+QL           + +  +    L+++DS+ S
Sbjct: 2   ASKESLGIFGEFEYYVTFAKDGSKYTSFQLEKSHAKQSSRASTRSDD--STLIVLDSLKS 59

Query: 70  GSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYTVLFLSGDTS 129
           G GR ++ DF + VIA   E++   +  IKTTS  SV + A S+D  + Y +  +SGDT+
Sbjct: 60  GIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTT 119

Query: 130 ISEFVNNLP---LNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLSCNDFPLY 186
           ISEF NNLP   +  + + +LP PMGTGNAWA+SL    P   F  ++N  L   D PLY
Sbjct: 120 ISEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLY 179

Query: 187 RATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKLESRVSI 246
           RA   NGY + FF+I SLGFHANLLH CE+ +Y KMG ERF++A+Q IL  Y L+  +S+
Sbjct: 180 RAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISL 239

Query: 247 PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQKRVFMGYSN 306
            D L  S++YFALINT NLE TY PSP S+PLE +L +L Y SSL R E  +++  GY N
Sbjct: 240 -DGLRRSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQN 298

Query: 307 TKHSNILQN-GTFYRPLPFCFNVEVLDDPSQKSN---FEVCCDGQLLNLLELEG--KNTP 360
             + ++  N    Y+ +   F + VL+D  + S+   FE+CCDG LLNLL+ +   K+ P
Sbjct: 299 KPNGDLPTNEDMIYKSITHDFTL-VLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKP 357

Query: 361 PSTIRIE 367
            + IR +
Sbjct: 358 SNEIRFQ 364

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  271 bits (694), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 144/315 (45%), Positives = 201/315 (63%), Gaps = 12/315 (3%)

Query: 46  DEKLLANKKFEYSGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSS 105
           D +L++ KK    G++L+VDS+ SG+GRD   DF TNVI   F ++ + YR++KT +++S
Sbjct: 46  DPELVSRKK----GDILVVDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENS 101

Query: 106 VIELASSIDSTRQ-YTVLFLSGDTSISEFVNNLPLNHD-----CISVLPFPMGTGNAWAS 159
           V EL  +     Q  TV+FLSGDTSISEFVNNL           +++L  P+GTGNAWA+
Sbjct: 102 VAELGRNFRPCGQNTTVIFLSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWAN 161

Query: 160 SLKLMDPAVIFSQFVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEY 219
           SL     A   ++F+ G L   +FPLY+A F NGY + FFIILS+GFHANLLHLC++  +
Sbjct: 162 SLGFRTAATALAEFLQGFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRF 221

Query: 220 QKMGIERFRVASQRILREYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLE 279
           +K+G+ERFR+AS+ I  +Y L+  + +       +SYFALINT NLE  Y PSP S+PL 
Sbjct: 222 KKLGVERFRLASKEIFEDYILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLT 281

Query: 280 SQLHVLAYQSSLDRVEFQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPS--QK 337
           S+LH+L Y S L +     R+  GYSN   ++I + G  Y+      +V    DP    +
Sbjct: 282 SELHLLGYSSGLPQPMLINRIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPR 341

Query: 338 SNFEVCCDGQLLNLL 352
           S F++CCDG LLN+L
Sbjct: 342 SAFDICCDGHLLNML 356

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  271 bits (692), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 200/318 (62%), Gaps = 11/318 (3%)

Query: 60  ELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQY 119
           ++LIVDS+ SG+GRD   +F  NV+   F  + +P+++++T    +  +L  +   + + 
Sbjct: 55  DILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTEN 114

Query: 120 TVL-FLSGDTSISEFVNNL------PLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQ 172
           T+L FLSGDT+ISEF+N L       L H  +S++P P+GTGNAWA+SL L  PA   S 
Sbjct: 115 TILIFLSGDTTISEFLNGLNRRVFEGLRH-TLSLVPLPLGTGNAWANSLGLRCPAASLSC 173

Query: 173 FVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQ 232
           F+ G+L+   FPLY+ATF NG+ + FFIILS+GFHANLLHLC++  +Q +G+ERF++AS 
Sbjct: 174 FLQGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASL 233

Query: 233 RILREYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLD 292
            IL++Y LE R+ +  +    +SYFALINT NLE +Y PSP S+ L  QLHVL Y S L 
Sbjct: 234 EILQKYPLEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQ 293

Query: 293 RVEFQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPSQKSN--FEVCCDGQLLN 350
           +     ++  GYSN    +I  +G  Y P      V     P   SN  FE+CCDG LLN
Sbjct: 294 QASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLN 353

Query: 351 LLELEGKNTP-PSTIRIE 367
           +L L+ ++      IRI+
Sbjct: 354 MLSLQPQDQKFDGRIRIQ 371

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  264 bits (674), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 189/303 (62%), Gaps = 6/303 (1%)

Query: 58  SGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTR 117
            G L+++DSV SG+GR+   DF   V+      + V +  ++T+S +SV ELA +   T 
Sbjct: 134 GGPLVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTS 193

Query: 118 QYTVLFLSGDTSISEFVNNLPLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGK 177
           + TVL +SGDT+ISEFVN L  +   ++V   P+GT NAWA S+ L  PA     FV G+
Sbjct: 194 ETTVLVMSGDTTISEFVNALG-SGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGR 252

Query: 178 LSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILRE 237
           +    FPLYRA F +GY ++FFI+LS GFHANLLHLC ++ YQ++G+ERFR AS  IL  
Sbjct: 253 VHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDR 312

Query: 238 YKLESRVSI-----PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLD 292
           Y L   V +      + L G ++YFAL+NT +LE TY+PSP SDPL  QLHVLA+++ L 
Sbjct: 313 YALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELS 372

Query: 293 RVEFQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPSQKSNFEVCCDGQLLNLL 352
           R +  + +  GYS  + S +   G  YR L   F + + +  S +   E+C DG LLNL+
Sbjct: 373 RDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVANELCVDGHLLNLV 432

Query: 353 ELE 355
           +L+
Sbjct: 433 DLQ 435

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  261 bits (666), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 152/365 (41%), Positives = 224/365 (61%), Gaps = 23/365 (6%)

Query: 10  VTKQELGIYNGVSFTIVTKLLAEGAK--SYQLGSKLLDDEKLLANKKFEYSGELLIVDSV 67
            T + L   NG S +   K+  +G+K  +++L +K + D+K  +   +E    ++++DSV
Sbjct: 6   TTIEPLCTVNG-SQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHYE---NVVVIDSV 61

Query: 68  FSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYTVLFLSGD 127
            SG+GR+K+  F   VI   F+   + +   KTT   S+   A S+D ++ YTV+F+SGD
Sbjct: 62  SSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGD 121

Query: 128 TSISEFVNNLP--------LNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLS 179
           TSISEF+NNLP        L H  IS+LP PMGTGNA++SS+    P    S F++ +  
Sbjct: 122 TSISEFINNLPPLLETSNGLKH-TISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQ 180

Query: 180 CNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEED-EYQKMGIERFRVASQRILREY 238
            + FPLY   F NG  + FFIILSLG HAN+LHLCE D +Y+K G ERF++A ++++  Y
Sbjct: 181 PSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTY 240

Query: 239 KLESRVSIPDI-LEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQ 297
            L  R+ IP++ L G+FSYF LINT NLE +Y+PSP SDP   QLHVL Y SSL+  +  
Sbjct: 241 DLNVRLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLL 300

Query: 298 KRVFMGYSNTKHSNILQNGTF-YRPLPFCFNVEVL---DDPSQKSNFEVCCDGQLLNLLE 353
             V  GYSN     ++++    Y+P+    NV ++   D+ S+K  +++CCDG L NL +
Sbjct: 301 NYVTQGYSNKLGDELVESSNMVYKPI--SRNVSIVLTEDEESEKYKYDICCDGLLFNLRD 358

Query: 354 LEGKN 358
           +  +N
Sbjct: 359 MLPEN 363

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  249 bits (636), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 133/321 (41%), Positives = 203/321 (63%), Gaps = 18/321 (5%)

Query: 61  LLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYT 120
           L+++DSV SG+GR    D   NVI     ++   Y+++K+ +  SV E  + +D T+ YT
Sbjct: 53  LIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYT 112

Query: 121 VLFLSGDTSISEFVNNL----PLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNG 176
           +LF+SGDTS+SEF N +    P     +++LP  MGTGNA A+SL L  P   F+ F+ G
Sbjct: 113 ILFVSGDTSVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG 172

Query: 177 KLSCNDFPLYRATFDNGYV-LKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRIL 235
           +L   +FPLYRA   +G   + FFI+LSLGFHANLLH  E ++Y+ MG+ERF+ AS  IL
Sbjct: 173 ELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDIL 232

Query: 236 REYKLESRVSI-PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRV 294
           + YKL+ ++++    + GS++YFAL+N  NLE +Y+PSP SDP + +LH+LAY SSL+R 
Sbjct: 233 QNYKLQEQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRK 292

Query: 295 EFQKRVFMGYSNTKHSNILQNG-TFYRPLPFCFNVEVL------DDPSQKSNFEVCCDGQ 347
           +  +R+  GY N +   +  +  T Y+ +   F +++       +DP+    FE+C DGQ
Sbjct: 293 QLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPA----FELCLDGQ 348

Query: 348 LLNLLELEG-KNTPPSTIRIE 367
           L NLL+ +  ++    TI++E
Sbjct: 349 LYNLLQYKSDQHQEELTIQVE 369

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  245 bits (625), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 128/323 (39%), Positives = 194/323 (60%), Gaps = 22/323 (6%)

Query: 58  SGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTR 117
           S EL+++DS+ SG GR    DF  NV+   F++    ++ I+T  + S+ +LA+  ++++
Sbjct: 57  SSELVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASK 116

Query: 118 QYTVLFLSGDTSISEFVNNLPL-----------NHDCISVLPFPMGTGNAWASSLKLMDP 166
            YT++FLSGDTS+SEF+NNL             N   +++   P+GTGNA ASS+ L  P
Sbjct: 117 DYTIIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSP 176

Query: 167 AVIFSQFVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIER 226
             +F +F+N +L   DFPLY  T  N   + FFII S+GFHANLLH C+ DEYQKMG ER
Sbjct: 177 HQVFQKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTER 236

Query: 227 FRVASQRILREYKLESRVSIPDILEG---SFSYFALINTTNLEPTYMPSPDSDPLESQLH 283
           F  AS+ I + Y L   ++  +  E    +++YFA+INT NLE  YMPSPDSD  +++LH
Sbjct: 237 FAKASENIFKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELH 296

Query: 284 VLAYQSSLDRVEFQKRVFMGYSNTKHSNI--LQNGTFYRPLPFC-FNVEVL-----DDPS 335
           +L Y +SL   +   ++  GYS  +   I    N T+Y P+      ++++     D   
Sbjct: 297 LLGYDASLSTEKLVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKL 356

Query: 336 QKSNFEVCCDGQLLNLLELEGKN 358
           +K  +++CCDG LLNL ++  ++
Sbjct: 357 EKYKYDICCDGLLLNLDDINNQH 379

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  226 bits (577), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 134/357 (37%), Positives = 202/357 (56%), Gaps = 18/357 (5%)

Query: 14  ELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLDDEKLLANKKFEYSGELLIVDSVFSGSGR 73
           EL   NG+ +++    +    +SY+L     +D       KF+   +++++DSV SG+ R
Sbjct: 6   ELCRNNGIKYSVEIVEVKGKVESYKLIKA--NDRSTDCFLKFDRDTQIIVIDSVKSGTSR 63

Query: 74  DKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELA--SSIDSTRQYTVLFLSGDTSIS 131
           +   D    VI   F+ + V Y+ IKT S++S+ + A  +S  S  +Y +LFLSGDTSIS
Sbjct: 64  NDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSIS 123

Query: 132 EFVNNLPLN-----HDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLSCNDFPLY 186
           EF+N L           IS+LP P+G+GNA A+SL    P      ++N    C+  PLY
Sbjct: 124 EFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLY 183

Query: 187 RATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKLESRVSI 246
            A   N   + FFIILSLGFHANLLH  E+ +Y+ MG+ERF+VAS+ +   Y L   +++
Sbjct: 184 DAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAV 243

Query: 247 PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQKRVFMGYSN 306
             +   S+SYFA+I   NLEPTY PSP S  L+ +LH+L Y++ +   + Q ++  GY N
Sbjct: 244 NGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRGYHN 303

Query: 307 TKHSNILQNGTFYRPLPFCF--NVEV---LDDPSQKSNFEVCCDGQLLNLLELEGKN 358
               +I + GT Y+    CF  N+E+       + K  +++C DG LLNL +   K+
Sbjct: 304 KDGEDIQEIGTIYQ----CFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLEDCNSKD 356

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  218 bits (556), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 142/370 (38%), Positives = 200/370 (54%), Gaps = 45/370 (12%)

Query: 43  LLDDEKLLANKKFEYSG-ELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTT 101
           L   + L+ N  +E +  +L+I+DS  SG GR+K+ DF   ++     ++ + + L KTT
Sbjct: 65  LTTSKDLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTT 124

Query: 102 SKSSVIELASSI-----DSTR-QYTVLFLSGDTSISEFVNNLPLNHDCIS-----VLPFP 150
           SK S+   A++      D+T+  Y ++FLSGDT+ISEF NNLP      S     +L  P
Sbjct: 125 SKDSIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIP 184

Query: 151 MGTGNAWASSLKLMDPAVIFSQFVNGKLSCNDFPLYRATFDNGY-------------VLK 197
           MGT NAW++SL L  P  IF +F+  KL+ + FPLY     +                + 
Sbjct: 185 MGTANAWSNSLNLNCPIDIFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIY 244

Query: 198 FFIILSLGFHANLLHLCEEDE-YQKMGIERFRVASQRILREYKLESRVSIPD-------I 249
           FFI+LS+GFHANLLHLC  DE Y  +G+ERF++AS  IL  Y L   ++I         I
Sbjct: 245 FFIVLSMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHII 304

Query: 250 LEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSS-LDRVEFQKRVFMGYSN-- 306
           L  SFSYF L+NT  LE  Y+PSP SDPL++ LHVLAY+S   ++ +  K +  GYSN  
Sbjct: 305 LNDSFSYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNEL 364

Query: 307 --TKHSNILQNGTFYRPL-PFCFNVEVLDDPSQKS------NFEVCCDGQLLNLLELEGK 357
                 NI ++G  Y P+    F + + +     S      N+E+CCDG L NLL  +  
Sbjct: 365 GQKNIQNIDEDGIIYFPINDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQTN 424

Query: 358 NTPPSTIRIE 367
                 I  E
Sbjct: 425 QGKQDKISFE 434

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  131 bits (329), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 106/190 (55%), Gaps = 7/190 (3%)

Query: 188 ATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKLESRVSIP 247
           ATF +   + FFIILSLGFHA LLH C   E  KMG ERF++A++ IL  Y L+  + + 
Sbjct: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61

Query: 248 DILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQKRVFMGYSNT 307
                 ++YFA+INT+NLE TY PSP S+ LE+ L +L Y S L R E   ++  GY   
Sbjct: 62  KSTR-RYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120

Query: 308 KHSNILQNG-TFYRPLPFC-FNVEVLDDP----SQKSNFEVCCDGQLLNLLELEGKNTPP 361
           K   I  +  T+Y  L      ++++ D     S    FE+CCDG LL+L+E     T  
Sbjct: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEKSKGRTDN 180

Query: 362 STIRIETCTE 371
            TI I +  +
Sbjct: 181 LTIHINSVKD 190

>KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {ON}
           Anc_6.48 YOR171C
          Length = 748

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 43/106 (40%), Gaps = 12/106 (11%)

Query: 95  YRLIKTTSKSSVIELASSIDSTRQYTVLFLSGDTSISEFVNNLPLNHDCI------SVLP 148
           + L+ T      IE+A ++D  +  T+   SGD    E +N L   HD +      ++  
Sbjct: 388 FDLVYTKYSGHAIEIAKNMDIEKYDTIACASGDGIPHEVINGLYRRHDRVRAFNKLAITE 447

Query: 149 FPMGTGNA------WASSLKLMDPAVIFSQFVNGKLSCNDFPLYRA 188
            P G+GNA      W ++       +I S      + C   P Y A
Sbjct: 448 IPCGSGNAMSVSCNWTNNPSYATLFIIKSVETRSDIMCLSQPSYEA 493

>KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {ON}
           Anc_6.48 YOR171C
          Length = 598

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 50/114 (43%), Gaps = 8/114 (7%)

Query: 53  KKFEYSGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASS 112
           K    + ++L++ + F G G+ K+  F     A   +     Y +  T      +E+A S
Sbjct: 184 KNARRNKKMLVIINPFGGKGQAKNLFFQR--AAPILDASGSDYDIAYTERSRHAVEIAES 241

Query: 113 IDSTRQYTVLFLSGDTSISEFVNNLPLNHDCIS------VLPFPMGTGNAWASS 160
           +D  +  T++  SGD    E +N L    D ++      V   P G+GNA + S
Sbjct: 242 LDIDKYDTIVCASGDGIPYEVLNGLYRRIDRVAAFNKIVVTQLPCGSGNAMSIS 295

>ABR231W Chr2 (836764..839409) [2646 bp, 881 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL042C and YLR072W
          Length = 881

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 15/93 (16%)

Query: 42  KLLDDEKLLANKKFEYSGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTT 101
           +LLDD     +++F Y G L + +S          C F +N++  +   ++VP R I + 
Sbjct: 295 RLLDDFSCALSREFLYQGRLYVSESYI--------C-FNSNILG-WVTNLVVPIRDILSF 344

Query: 102 SKSSVIEL-----ASSIDSTRQYTVLFLSGDTS 129
            K++   L     A ++DST+ Y   FLS D++
Sbjct: 345 EKTTTAGLFPNGIALTMDSTKHYFASFLSRDST 377

>SAKL0A01452g Chr1 (137799..140771) [2973 bp, 990 aa] {ON} similar
           to uniprot|P11655 Saccharomyces cerevisiae YNR026C SEC12
           Guanine nucleotide exchange factor (GEF) glycosylated
           integral membrane protein of the endoplasmic reticulum
           important for the initiation of transport vesicle
           budding from the endoplasmic reticulum through
           activation of the GTPase Sar1p
          Length = 990

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 10/93 (10%)

Query: 248 DILEGSFSYFALINTTNLEPTY---MPSPDSDPLESQLHVLAYQSSLDRVEFQKRVF-MG 303
           D +E SFS FA I + NLE T    +P P ++ LE ++ V    S L  +E + R    G
Sbjct: 461 DPVESSFSEFANITSANLETTSTTEVPIPSANELEVEISV----SILSFIESEARTASSG 516

Query: 304 YSNTKHSNILQNGTFYRPLPF--CFNVEVLDDP 334
            + T+H   L       P       N+E+L +P
Sbjct: 517 LTETEHITSLTATQNSEPKETIESQNLEILAEP 549

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 185 LYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKLE 241
           LY A F  G +++  I  +LGF  N  HL  ++ ++K G   F+  S  ++ E KL+
Sbjct: 160 LYLALFAGGKIIRSKIYKNLGFLPNFNHLSSKEVFEK-GTNFFKFGSDGVIEETKLK 215

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 95  YRLIKTTSKSSVIELASSIDSTRQYTVLFLSGDTSISEFVNNLPLNHDCI------SVLP 148
           + +I TT  S   ++A S+D ++   +   SGD    E +N L    D +      ++  
Sbjct: 295 FEIINTTYSSHATDIAKSLDISKYDIIACASGDGIPYEVINGLYQRPDRVDAFNKLTITQ 354

Query: 149 FPMGTGNAWASSLKLMD 165
            P G+GNA + S    D
Sbjct: 355 IPCGSGNAMSISCHWTD 371

>KAFR0C00360 Chr3 (73892..76375) [2484 bp, 827 aa] {ON} Anc_3.296
          Length = 827

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 57/159 (35%), Gaps = 47/159 (29%)

Query: 236 REYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVE 295
           REY   SR+   DI      +F L    N   T    P       Q   L YQS LDR+E
Sbjct: 588 REYTDTSRIKTNDI------HFTL----NYSSTIQAPP-------QTGGLLYQSHLDRLE 630

Query: 296 FQKRVFMGYSN---------------TKHSNILQNGTFYRPLPFCFN-VEVLDDPSQK-- 337
            QK  +  YS+               T+ SN+    T Y   PF FN    L+  SQ+  
Sbjct: 631 RQKASYPDYSSNSNTRSPFTHQNHPFTEQSNVQTKQTPYAG-PFTFNPSHSLNHSSQQPI 689

Query: 338 -----------SNFEVCCDGQLLNLLELEGKNTPPSTIR 365
                      +NF      + LN   +   N P S + 
Sbjct: 690 PPIVSNENTLSNNFNSHMQMEALNSTSIRAANYPQSNVH 728

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 237 EYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEF 296
           E +LE   ++   LEGS       +T+N++    P+  +D L   LH LA  S   R+  
Sbjct: 583 ERQLEDNTAL---LEGSVDSHTTYSTSNMQQKRKPTRAADGLFLTLHPLANSSVRKRIYV 639

Query: 297 QKRV---FMGYSNTKHSNILQN 315
            + +   F+G S+  H  I  N
Sbjct: 640 NQGINPFFIGRSDECHYKIPDN 661

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,934,772
Number of extensions: 1899978
Number of successful extensions: 4554
Number of sequences better than 10.0: 27
Number of HSP's gapped: 4648
Number of HSP's successfully gapped: 27
Length of query: 380
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 269
Effective length of database: 40,753,473
Effective search space: 10962684237
Effective search space used: 10962684237
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)