Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00539g5.705ON87874492e-59
TDEL0B021505.705ON91802922e-35
Kpol_YGOB_1043.725.705ON88802713e-32
KAFR0H001905.705ON82812661e-31
NCAS0A031805.705ON88852662e-31
SAKL0E14982g5.705ON89852652e-31
TBLA0G010305.705ON89882643e-31
YKR095W-A (PCC1)5.705ON88862574e-30
KLTH0E00990g5.705ON89772565e-30
Suva_11.3325.705ON111802579e-30
ZYRO0B16368g5.705ON85792541e-29
Skud_11.3355.705ON94922481e-28
Smik_11.3595.705ON88862462e-28
Kwal_YGOB_Anc_5.7055.705ON88802443e-28
TPHA0E002005.705ON85742444e-28
Ecym_40165.705ON125732431e-27
KNAG0C066205.705ON101802291e-25
NDAI0E050605.705ON86842244e-25
AFR289W5.705ON81782201e-24
CAGL0G02535g5.705ON140721521e-13
KNAG0K026003.9ON102543670.39
KLLA0A08734g4.128ON116282650.85
KNAG0C003401.25ON44766595.0
TBLA0C019405.581ON16836586.1
NCAS0J018704.310ON231449587.6
TPHA0F004704.65ON47432578.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00539g
         (87 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   177   2e-59
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   117   2e-35
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   108   3e-32
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   107   1e-31
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   107   2e-31
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   106   2e-31
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   106   3e-31
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   103   4e-30
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   103   5e-30
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   103   9e-30
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   102   1e-29
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   100   1e-28
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...    99   2e-28
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...    99   3e-28
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...    99   4e-28
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    98   1e-27
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...    93   1e-25
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...    91   4e-25
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    89   1e-24
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    63   1e-13
KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3...    30   0.39 
KLLA0A08734g Chr1 (763946..767434) [3489 bp, 1162 aa] {ON} simil...    30   0.85 
KNAG0C00340 Chr3 (58096..59439) [1344 bp, 447 aa] {ON} Anc_1.25 ...    27   5.0  
TBLA0C01940 Chr3 complement(456759..456824,456946..457386) [507 ...    27   6.1  
NCAS0J01870 Chr10 (352527..359471) [6945 bp, 2314 aa] {ON} Anc_4...    27   7.6  
TPHA0F00470 Chr6 complement(114697..116121) [1425 bp, 474 aa] {O...    27   8.6  

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  177 bits (449), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 87/87 (100%), Positives = 87/87 (100%)

Query: 1  MNKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESV 60
          MNKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESV
Sbjct: 1  MNKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESV 60

Query: 61 DERILRVGVNSVIESIKTIVETIDELC 87
          DERILRVGVNSVIESIKTIVETIDELC
Sbjct: 61 DERILRVGVNSVIESIKTIVETIDELC 87

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%)

Query: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILR 66
          S  HSL LEIPF++  QA++A++VLLPDPI+KP+DFQV Y+T D  L+  F+S+D+R+LR
Sbjct: 2  SLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLR 61

Query: 67 VGVNSVIESIKTIVETIDEL 86
          VGV+SVI+SIKTIVETIDEL
Sbjct: 62 VGVSSVIDSIKTIVETIDEL 81

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  108 bits (271), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 68/80 (85%)

Query: 8  FEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRV 67
           +H+L  EIPFE+ +QA++A +VL PDPI+KP+DFQV+YS+ D  LI  F+S+D+R+LRV
Sbjct: 9  MDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLRV 68

Query: 68 GVNSVIESIKTIVETIDELC 87
          GV+SVI+S+KTI+ET+DEL 
Sbjct: 69 GVSSVIDSVKTIIETMDELS 88

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  107 bits (266), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 46/81 (56%), Positives = 67/81 (82%)

Query: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILR 66
          + +H+L LEIPFE  KQA++A  VL PDPI++P+DFQV+Y  +D   + +FES+D+R+LR
Sbjct: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLR 61

Query: 67 VGVNSVIESIKTIVETIDELC 87
          VGV++VI+S+KTI+ET+DEL 
Sbjct: 62 VGVSNVIDSLKTIIETMDELS 82

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  107 bits (266), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 50/85 (58%), Positives = 67/85 (78%)

Query: 2  NKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVD 61
          N  + S ++ L+LEIPF + +QA +A KVL+PDPI+KP+DFQV Y +QD  L   F  +D
Sbjct: 3  NGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGID 62

Query: 62 ERILRVGVNSVIESIKTIVETIDEL 86
          +R+LRVGV+SVI+SIKTI+ETIDEL
Sbjct: 63 DRVLRVGVSSVIDSIKTIIETIDEL 87

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  106 bits (265), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 50/85 (58%), Positives = 64/85 (75%)

Query: 2  NKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVD 61
          N    S +H L+LEIP E+  QA +A K L PDP++KPEDFQV YS  D KL   F+S+D
Sbjct: 3  NTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSID 62

Query: 62 ERILRVGVNSVIESIKTIVETIDEL 86
          +R+LRVGV+SVIES+KTI+ET+DE 
Sbjct: 63 DRVLRVGVSSVIESVKTIIETMDEF 87

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  106 bits (264), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 49/88 (55%), Positives = 72/88 (81%), Gaps = 2/88 (2%)

Query: 1  MNKGDTSF--EHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFE 58
          M+K D +   EH+L L IPF + KQAD+A +VL PDPI++P+DFQV Y+++  +L+ +F+
Sbjct: 1  MSKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQ 60

Query: 59 SVDERILRVGVNSVIESIKTIVETIDEL 86
          S+D+R+LRVGV+SVI+S+KTI+ET DEL
Sbjct: 61 SIDDRVLRVGVSSVIDSVKTIIETFDEL 88

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  103 bits (257), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 68/86 (79%)

Query: 2  NKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVD 61
          +K + S +H+L L+IPFE+ +QA +A KVL PDPI+KP+DFQV YS++   ++  F S+D
Sbjct: 3  SKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSID 62

Query: 62 ERILRVGVNSVIESIKTIVETIDELC 87
          +R+LRVGV+S+I+SIKTIVE +D L 
Sbjct: 63 DRVLRVGVSSIIDSIKTIVEAMDVLS 88

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  103 bits (256), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (81%)

Query: 10 HSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVGV 69
          ++L+LE+PF++ KQA+ A KVL PDPI+KP+DF V YS++   L   FE VD+R+LRVGV
Sbjct: 11 YTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGV 70

Query: 70 NSVIESIKTIVETIDEL 86
          +SVIESIKTI+ETIDE 
Sbjct: 71 SSVIESIKTIIETIDEF 87

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  103 bits (257), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 67/80 (83%)

Query: 8   FEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRV 67
           F+++  L+IPFE+ KQA++A +VL PDPI+KP+DFQ  YS+++  ++  F S+D+R+LRV
Sbjct: 32  FQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRV 91

Query: 68  GVNSVIESIKTIVETIDELC 87
           GV+SVI+SIKTI+ET+DEL 
Sbjct: 92  GVSSVIDSIKTIIETMDELS 111

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  102 bits (254), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 65/79 (82%)

Query: 8  FEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRV 67
           +H+LHL IPF + + ++VA KVL PDPI++PEDFQV Y ++   L  DF+SVD+R+LRV
Sbjct: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63

Query: 68 GVNSVIESIKTIVETIDEL 86
          GV+SVI+S+KTIVETIDEL
Sbjct: 64 GVSSVIDSVKTIVETIDEL 82

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  100 bits (248), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 6/92 (6%)

Query: 2  NKGDTSFEHSL------HLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLIC 55
          +K + S +++L       L+IPFE+  QA +A KVL PDPI+KP+DFQV YS++   ++ 
Sbjct: 3  SKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLV 62

Query: 56 DFESVDERILRVGVNSVIESIKTIVETIDELC 87
           F S+D+R+LRVGV+SVI+SIKTIVETIDEL 
Sbjct: 63 RFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score = 99.4 bits (246), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 67/86 (77%)

Query: 2  NKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVD 61
          +K +    H+L L++PF++ +QA +A +VL PDPI+KP+DFQ+ YS++   ++  F S+D
Sbjct: 3  SKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSID 62

Query: 62 ERILRVGVNSVIESIKTIVETIDELC 87
          +R+LRVGV+SVI+SIKT+VE +DEL 
Sbjct: 63 DRVLRVGVSSVIDSIKTVVEAMDELS 88

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score = 98.6 bits (244), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 62/80 (77%)

Query: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILR 66
          +  ++L+LE+PF++ KQA  A +VL PDPI+KP+DF V Y++    L   FE VD+R+LR
Sbjct: 8  NLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLR 67

Query: 67 VGVNSVIESIKTIVETIDEL 86
          VGV+SVIESIKTIVETIDE 
Sbjct: 68 VGVSSVIESIKTIVETIDEF 87

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 98.6 bits (244), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 63/74 (85%)

Query: 13 HLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVGVNSV 72
           L IPFE+ KQA +A +VL PDP ++PE+F+V YS+Q + L+ +F+SVD+R+LRVGV++V
Sbjct: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68

Query: 73 IESIKTIVETIDEL 86
          I+SIKTI+ETIDEL
Sbjct: 69 IDSIKTIIETIDEL 82

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 98.2 bits (243), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 61/73 (83%)

Query: 14  LEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVGVNSVI 73
           LE+PFE+ KQA++AR+VL  DP+++PEDF+V Y+ Q  KL+ +F S+D R LRVGV+SVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 74  ESIKTIVETIDEL 86
           ESIKT+VET+DE 
Sbjct: 111 ESIKTVVETMDEF 123

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score = 92.8 bits (229), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 61/80 (76%)

Query: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILR 66
          + +H+L L +PFE+ +QA +A +VL PDPI+KP+DF V+Y+ Q   L   F   D R+LR
Sbjct: 10 ALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLR 69

Query: 67 VGVNSVIESIKTIVETIDEL 86
          VGV+SVI+S+KTI+E++DEL
Sbjct: 70 VGVSSVIDSLKTIIESLDEL 89

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score = 90.9 bits (224), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 66/84 (78%), Gaps = 4/84 (4%)

Query: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTY---STQ-DTKLICDFESVDE 62
          + +++L + IPF   + A +A++VL PDPI+KPEDFQV Y   +TQ +  L+  F+S+DE
Sbjct: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62

Query: 63 RILRVGVNSVIESIKTIVETIDEL 86
          R+LRVGV+SV++SIKTI+ET+DEL
Sbjct: 63 RVLRVGVSSVLDSIKTILETMDEL 86

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 89.4 bits (220), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 56/78 (71%)

Query: 9  EHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVG 68
          +H+LHL +PFES + AD+A + L PDP+++PE+  V++++    L     ++D R+LRV 
Sbjct: 2  DHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRVA 61

Query: 69 VNSVIESIKTIVETIDEL 86
           NS+ E++KT+VET DEL
Sbjct: 62 TNSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
           [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
           Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
           unknown function
          Length = 140

 Score = 63.2 bits (152), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 46/72 (63%)

Query: 14  LEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVGVNSVI 73
           L +PFE+ + A +A++VL PDPI++PEDFQV Y  + T L   F+++D+R+LR       
Sbjct: 31  LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRTYAYQGS 90

Query: 74  ESIKTIVETIDE 85
            SI  ++ T D 
Sbjct: 91  MSIFHLLGTDDS 102

>KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3.9
           YNL329C
          Length = 1025

 Score = 30.4 bits (67), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 30/43 (69%), Gaps = 1/43 (2%)

Query: 9   EHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDT 51
           E++ + ++PFES+++  V+R++L+P+P    +D    ++T DT
Sbjct: 190 ENADYGKLPFESLREK-VSREMLVPEPCNSDDDSLYVFATMDT 231

>KLLA0A08734g Chr1 (763946..767434) [3489 bp, 1162 aa] {ON} similar
           to uniprot|P34111 Saccharomyces cerevisiae YAL001C TFC3
           Largest of six subunits of the RNA polymerase III
           transcription initiation factor complex (TFIIIC); part
           of the TauB domain of TFIIIC that binds DNA at the BoxB
           promoter sites of tRNA and similar genes; cooperates
           with Tfc6p in DNA binding
          Length = 1162

 Score = 29.6 bits (65), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 4/82 (4%)

Query: 1   MNKGDTS--FEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFE 58
           MN GD    F H   L+IP  +       +++ LPD   KP+  +V   T D K+  D  
Sbjct: 472 MNDGDKDVFFWHG-ELDIPASTKTSVRGRKRITLPDAAAKPKRIKVANPTVDMKIEHDEP 530

Query: 59  SVDERILRVGVNSVI-ESIKTI 79
            +      + VN     S+K+I
Sbjct: 531 QIARNGTSITVNGFTGSSLKSI 552

>KNAG0C00340 Chr3 (58096..59439) [1344 bp, 447 aa] {ON} Anc_1.25
           YCL048W
          Length = 447

 Score = 27.3 bits (59), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 13/66 (19%)

Query: 21  IKQADVARKVLLPDPIMKPEDFQVTYSTQDTKL--ICDFESV-DERILRVGVNSVIESIK 77
           + QAD+ + +++   I+            DT L  I DF+S+ D  I  V  N  +E+IK
Sbjct: 164 LSQADLPKDIIVDKNII----------ISDTSLSNINDFQSIKDVEIFNVNNNRFLETIK 213

Query: 78  TIVETI 83
           T VET+
Sbjct: 214 TNVETV 219

>TBLA0C01940 Chr3 complement(456759..456824,456946..457386) [507
          bp, 168 aa] {ON} Anc_5.581 YML036W
          Length = 168

 Score = 26.9 bits (58), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 17/36 (47%)

Query: 43 QVTYSTQDTKLICDFESVDERILRVGVNSVIESIKT 78
           + YS  DT LIC  E +   I RV V      IKT
Sbjct: 34 NIPYSLIDTTLICSVEQIYSAIYRVLVEYKFNRIKT 69

>NCAS0J01870 Chr10 (352527..359471) [6945 bp, 2314 aa] {ON} Anc_4.310
          Length = 2314

 Score = 26.9 bits (58), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 11   SLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFES 59
            +LH + P + + Q +VAR+ LL + I+ P    V ++T+ T+ +   ES
Sbjct: 973  NLHHQKPTKPVSQMEVARRQLLKNRIVHPPSESV-FNTKPTRRVKHEES 1020

>TPHA0F00470 Chr6 complement(114697..116121) [1425 bp, 474 aa] {ON}
           Anc_4.65 YGR156W
          Length = 474

 Score = 26.6 bits (57), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 14  LEIPFESIKQADVARKVLLPDPIMKPEDFQVT 45
           LE+PFE I +  ++R+ L P P M   +  VT
Sbjct: 160 LELPFEMITEVPLSRRPLQPKPQMPVSNENVT 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,943,403
Number of extensions: 318546
Number of successful extensions: 893
Number of sequences better than 10.0: 27
Number of HSP's gapped: 892
Number of HSP's successfully gapped: 27
Length of query: 87
Length of database: 53,481,399
Length adjustment: 59
Effective length of query: 28
Effective length of database: 46,716,105
Effective search space: 1308050940
Effective search space used: 1308050940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)