Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00528g5.706ON1229122960430.0
AFR290W5.706ON121795530190.0
Ecym_40155.706ON125796628840.0
SAKL0E15004g5.706ON119696528090.0
KLTH0E00968g5.706ON114895826700.0
Kwal_55.196785.706ON117896426650.0
ZYRO0B16412g5.706ON137297825190.0
TDEL0B021405.706ON114796524540.0
Smik_11.3605.706ON118098224140.0
KAFR0H001805.706ON124198323810.0
KNAG0C066305.706ON1281101323800.0
Suva_11.3335.706ON118797723560.0
Skud_11.3365.706ON118898523260.0
Kpol_1043.735.706ON126097123210.0
YKR096W5.706ON119598022840.0
CAGL0G02541g5.706ON129596722680.0
CAGL0H06611g5.706ON1282102622520.0
Suva_9.375.706ON111797921870.0
YIL151C5.706ON111897521840.0
TPHA0E001905.706ON136199022050.0
Skud_9.175.706ON111897721660.0
Smik_9.185.706ON111897721500.0
NCAS0A031705.706ON131934712561e-150
NDAI0E050705.706ON155637412171e-143
TBLA0E017105.706ON152640610721e-123
TPHA0D046405.706ON9628713402e-31
KNAG0A022608.486ON20280751.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00528g
         (1229 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...  2332   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...  1167   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...  1115   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1086   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...  1033   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1031   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...   974   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...   949   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   934   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   921   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   921   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   912   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   900   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   898   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   884   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   878   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   872   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   847   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   845   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   853   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   838   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   832   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   488   e-150
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   473   e-143
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   417   e-123
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   135   2e-31
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    33   1.9  

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score = 2332 bits (6043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1149/1229 (93%), Positives = 1149/1229 (93%)

Query: 1    MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD 60
            MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD
Sbjct: 1    MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD 60

Query: 61   TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA 120
            TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA
Sbjct: 61   TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA 120

Query: 121  TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG 180
            TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG
Sbjct: 121  TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG 180

Query: 181  QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQXXXXXXXXXXXXXXXXXX 240
            QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQ                  
Sbjct: 181  QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD 240

Query: 241  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKASSQQQLVEKLQEIYKSIVKQET 300
                                                KASSQQQLVEKLQEIYKSIVKQET
Sbjct: 241  DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET 300

Query: 301  ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV 360
            ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV
Sbjct: 301  ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV 360

Query: 361  YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER 420
            YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER
Sbjct: 361  YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER 420

Query: 421  LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK 480
            LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK
Sbjct: 421  LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK 480

Query: 481  SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE 540
            SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE
Sbjct: 481  SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE 540

Query: 541  LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK 600
            LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK
Sbjct: 541  LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK 600

Query: 601  NPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDPVEFSSQQQASTEDFFSTIDSPKVP 660
            NPFAMLFE                          DPVEFSSQQQASTEDFFSTIDSPKVP
Sbjct: 601  NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP 660

Query: 661  YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ 720
            YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ
Sbjct: 661  YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ 720

Query: 721  VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL 780
            VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL
Sbjct: 721  VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL 780

Query: 781  TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE 840
            TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE
Sbjct: 781  TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE 840

Query: 841  FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE 900
            FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE
Sbjct: 841  FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE 900

Query: 901  LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD 960
            LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD
Sbjct: 901  LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD 960

Query: 961  LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP 1020
            LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP
Sbjct: 961  LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP 1020

Query: 1021 DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ 1080
            DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ
Sbjct: 1021 DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ 1080

Query: 1081 ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS 1140
            ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS
Sbjct: 1081 ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS 1140

Query: 1141 HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA 1200
            HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA
Sbjct: 1141 HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA 1200

Query: 1201 QQLGIRTFSTRFVFAICRELGRETGVCTN 1229
            QQLGIRTFSTRFVFAICRELGRETGVCTN
Sbjct: 1201 QQLGIRTFSTRFVFAICRELGRETGVCTN 1229

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 1167 bits (3019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/955 (59%), Positives = 720/955 (75%), Gaps = 23/955 (2%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            S Q L+EKLQEIY++IV+QETELQ+RCS LTT QTTDLKNLW+ YK+NAELIDNY +FIT
Sbjct: 281  SSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFIT 340

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TALLP+Q E+ L IG+EI++VYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI YVF
Sbjct: 341  TALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVF 400

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            I++SNML D+PPK+SI WLERLGDLSRMAIALYPSGF+DWKLSAEHWY E+LK+TFGHGK
Sbjct: 401  ISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGK 460

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH 519
            LYYHMSTVQQNTL AFVNLGKSVFC D F+PS QYMQLVIDNIYQRAFAER+S  +R  H
Sbjct: 461  LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRNAH 520

Query: 520  IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFF 579
            +V+YLKHTEVMLLPSFLESSELQ+VV+ +F+ KFGV+S+ +FFDP L+F+QD+ERLKHFF
Sbjct: 521  LVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNVDFFDPRLVFVQDSERLKHFF 580

Query: 580  RHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDPVEF 639
            RH+SL+++SH+LQL GFGDP+NPFA+LFE                            ++ 
Sbjct: 581  RHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSSTSTQYDTSIDD 640

Query: 640  SSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVT 699
                 A +E FF TIDS K  Y+FP D+ +WK SL Y NVT+MKC MIVLR+FL+GP++T
Sbjct: 641  DCAFAAPSE-FFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLLT 699

Query: 700  ALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGT 759
            ALPH+LPW  F+ +   R+  +    +++FW+  +R++FP++++ITF+N L+ Y      
Sbjct: 700  ALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYMNNQTQ 759

Query: 760  KNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTG 819
             NF  D +   ++ M+  +L+   CENE LPE W CWG+LWF+ ++ K   ++T + STG
Sbjct: 760  ANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNLTDINSTG 819

Query: 820  LSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEA 879
            + D +F+DSP +GI FD +DE G K+W+R  R +LLF  +     C     G ++++   
Sbjct: 820  VKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALA--LECPV---GLREIS-GG 873

Query: 880  TSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSI 939
             +W++LVF+F +  ++   + L P    +  F+ FE IS +N  D        M P + I
Sbjct: 874  RNWRSLVFKFEEPPSEWCDMYLEP---FTLVFDTFEQISPVNL-DQRATPYCGMTPDIDI 929

Query: 940  ENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDR 999
              LQG++++ PDY+CFN+NGD+IT SLYT G LE++ I GGDDFN  ++L+NG LV  +R
Sbjct: 930  RTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTER 989

Query: 1000 LEYSSAIDKLEQPWLEAFMNP-----DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTW 1054
             +Y+S ID+ EQP ++ F+       D R  ++L R   G+L+C ADT+VT+FVLDATTW
Sbjct: 990  RDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPR---GDLHCFADTHVTYFVLDATTW 1046

Query: 1055 LRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLL 1114
            LRHF H+YKLA +++LKFAICLTTFQELRFLRKSKDESVLEAATRAVI VRQLYYERKLL
Sbjct: 1047 LRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLL 1106

Query: 1115 ALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPL 1174
             LRFTGNVAGHLEEHLEIEEQMTW+SHVDEFVI+AI KAQDKFN LN+DA    +DCIP 
Sbjct: 1107 PLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPT 1166

Query: 1175 SEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN 1229
              D    QRFNF++LVTDD NMRNKA    I+ FSTRF+F++C ELG    VCTN
Sbjct: 1167 GAD----QRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 8/52 (15%)

Query: 93  PRG--------VDTSGEFPQSPFYLPTTSQTNFEAATTVNENSSIRRSDSVT 136
           PRG        VD  G  P SP YLPTTS +N +AA    +NSS+R+  S T
Sbjct: 41  PRGGLTACGLVVDAIGAEPGSPSYLPTTSSSNLDAAARAIDNSSLRQVSSTT 92

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score = 1115 bits (2884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/966 (59%), Positives = 700/966 (72%), Gaps = 43/966 (4%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            S Q LVEKLQEIYK+IVKQETELQERCS LTT QTTDLKNLW+ YK+NAELIDNY  FIT
Sbjct: 319  SSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFIT 378

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TALLP+Q ++ L IGQEI++VYRIERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI YVF
Sbjct: 379  TALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVF 438

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            I++SN+L ++PP +S+ WLERLGDLSRMAIALYPSGF+DWKLSAEHWY+E+LK+ FGHGK
Sbjct: 439  ISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGK 498

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH 519
            LYYHMSTVQQNTL AFVNLGKSVFC D F+PS QYMQLVIDNIYQRAFAER+S  +R +H
Sbjct: 499  LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSH 558

Query: 520  IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFF 579
            IV+YLKHTEVMLLPSFLE+ E Q VV+ +F  KFG + S NFFDP+LIF+QD ERLKHFF
Sbjct: 559  IVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSANFFDPSLIFVQDCERLKHFF 618

Query: 580  RHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDPVEF 639
            RH+SL+++SHILQL GFGDP+NPFA+LFE                               
Sbjct: 619  RHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTA---------- 668

Query: 640  SSQQQASTED--------FFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRR 691
            S+Q   S +D        FF T++S K  Y F  DL +WK SL+Y+N TSM+C M+VLR+
Sbjct: 669  SNQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRK 728

Query: 692  FLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLI 751
            FL   ++TALPH+LPW  F++++ +RLD + +   K+FWIVFIR+IFPW+S+  F+N L+
Sbjct: 729  FLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLL 788

Query: 752  HYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLD 811
             Y        F ID +M+ Y+ M   ELL   CENE+LPE W+CWG+LWF+ I+ K   +
Sbjct: 789  LYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSN 848

Query: 812  VTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHG 871
            +  + STG+ D +FLD+P +GI FD  DE G K+W+R  R +LLF  I        +  G
Sbjct: 849  LVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAY-----QFPFG 903

Query: 872  CKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSK 931
              + N  +  WK+LVF+FN+   +     L     E   + +FE IS +N +D      K
Sbjct: 904  FTEFNG-SDDWKSLVFKFNEPPAEWKEQYLGSFSKE---YGEFESISFVN-TDLQSPPHK 958

Query: 932  SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGD--DFNANK-I 988
             M+ G  I  LQG+K + PDY CFNKNGDLIT SLYT G  E  +    D  DF + K +
Sbjct: 959  GMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRL 1018

Query: 989  LDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDF-----RQRELLNRSFLGNLNCQADTN 1043
            L+N  LV  +R +Y++ +DK E P ++ F+   +     R  + L R   G+L    DT+
Sbjct: 1019 LENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPR---GDLQYFTDTH 1075

Query: 1044 VTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIA 1103
            VT+FVLDATTWLRHF H+YKLATS++LKFAICLTTFQELRFLRKSKDESVLEAATRAVI 
Sbjct: 1076 VTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVIT 1135

Query: 1104 VRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNND 1163
            VRQLYYERKLL LRFTGNVAGHLEEHLEIEEQMTW+SHVDEFVI+AI KAQ KFN LN D
Sbjct: 1136 VRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKD 1195

Query: 1164 AIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRE 1223
            A   G++ I   +DG    +FNF++LVTDD NMRNKA+   IR FST+F+FAIC E+G  
Sbjct: 1196 AKASGRESITTIDDG----KFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLS 1251

Query: 1224 TGVCTN 1229
              VCT+
Sbjct: 1252 KKVCTD 1257

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 71/162 (43%), Gaps = 29/162 (17%)

Query: 2   DPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAE-----IPQEPC 56
           DP + S+   S LHQKR  S + D Y+ NI+KRR  +    +  ++ AE      P +  
Sbjct: 3   DPSTTSL--QSQLHQKRQYSTNFDCYNHNIVKRRLAEHGIASPSLNEAEANDIDTPVDLI 60

Query: 57  QYLDTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQ-----PRGVDTSGEF--------- 102
            +   +++  P   +   +  ++  P +  +    +     PR  D   +          
Sbjct: 61  SHSQDTVVIQPDHHQISSRLHNVVLPQSCFLGSGGEGAAALPRIKDQGQQVTLENPSKLA 120

Query: 103 --------PQSPFYLPTTSQTNFEAATTVNENSSIRRSDSVT 136
                   P+SP+YLPTTS +N EAA    ++SSI++    T
Sbjct: 121 QQPPYECTPRSPYYLPTTSSSNMEAAAKAIDSSSIKQVSGTT 162

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/965 (56%), Positives = 696/965 (72%), Gaps = 25/965 (2%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            + Q LV+KLQ+IY+SIVKQE ELQERCS LT  QTTD+KNLW+ YK+NAELI+NYI FIT
Sbjct: 242  TSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFIT 301

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TALLPSQ E  L IGQEIV++YR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI++VF
Sbjct: 302  TALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVF 361

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            +++SNML D+PP+YSIPWLERLGDLSRMAIALYPSGF+DWKLSAEHWY ++L +T+GHGK
Sbjct: 362  MSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGK 421

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH 519
            LYYHMSTVQQNTLEAFVNLGKSVFC+D F+PS QYMQLVIDNIYQRAFAER    +R   
Sbjct: 422  LYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFP 481

Query: 520  IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGV-SSSGNFFDPNLIFIQDAERLKHF 578
            IV+YLKH+EVMLLPSFLES ELQ VV+ +FQ +FGV  ++ +FFD   IFIQD E+L++F
Sbjct: 482  IVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYF 541

Query: 579  FRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDPVE 638
            F H+  F++SHILQL GFGDP+NPFA+LFE                          +  +
Sbjct: 542  FSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPT-NLDD 600

Query: 639  FSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIV 698
             +     S + +F  IDS +VPY FP D+ +W++SL Y+N+TSM+C M VL++FL+ P++
Sbjct: 601  GNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLL 660

Query: 699  TALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTG 758
            TALPH+LPW  F++S+ IR+  ++   LKKFW+VF+RRIFPW+SL++F+NTL+ + +   
Sbjct: 661  TALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNS 720

Query: 759  TKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLEST 818
                 ++     Y  M+   L+     +E LPE W CWG+LWF+TIS KS+L  ++++ST
Sbjct: 721  RNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQST 780

Query: 819  GLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPE 878
            G+ D LFLD+P +GICFD DDE G K+W+R CR + +F  + +      + +G  +++  
Sbjct: 781  GIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAK-----EFHYGI-RVSDT 834

Query: 879  ATSWKNLVFRFNDDTNDQLSVELYPEE--NESFP-----FEKFEIISNLNCSDNLQDGSK 931
              S +  V   +         E  P+E  NE F       + FE IS +N S+     S 
Sbjct: 835  PISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPIN-SNFEAVPSL 893

Query: 932  SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDN 991
            SMI G SI   QG++ MYPDY+CFNKNGDLIT SLYT G LE   IQGGDDFN  + ++N
Sbjct: 894  SMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVEN 953

Query: 992  GRLVVQ-------DRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNV 1044
            G L+         +     + ++  E+ WL   M+P F +    +R   G+L C AD+NV
Sbjct: 954  GVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNV 1013

Query: 1045 TFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAV 1104
            T+FVLDAT+WLRHFAH+YKLAT++VLKFAICLTTFQELRFLRKSKDESV+EAATRAVI  
Sbjct: 1014 TYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITA 1073

Query: 1105 RQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDA 1164
            RQLYYERKLL LRFTGN+A HLEEHLE EEQ+TW+SHVDEFVI+A+ K+Q KF  LN  A
Sbjct: 1074 RQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQA 1133

Query: 1165 IEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRET 1224
             ++G++ IP   D +   +FNFV LVTDD NMR KA+   I  FS+RF+FA C +LG   
Sbjct: 1134 RDQGQEYIP--TDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQ 1191

Query: 1225 GVCTN 1229
             VC N
Sbjct: 1192 KVCIN 1196

 Score = 95.9 bits (237), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 113/220 (51%), Gaps = 30/220 (13%)

Query: 8   MAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSP 67
           MA H  LHQKRHNSNS DYYDS   KRR  + + +NV  +  E+      +LD++L  +P
Sbjct: 24  MASHPTLHQKRHNSNSYDYYDSGYAKRRP-NTLSQNVSQN-DELAASAACFLDSNL--TP 79

Query: 68  SKIRHHEKTPSITKPHTLQMEQTPQP-RGVDTSGEFPQSPFYLPTTSQTNFEAATTV--N 124
           SK  H E TPS  +  T   ++TPQP    DT    PQSPFYLPTTS +N EAA+ V  N
Sbjct: 80  SK--HQECTPSSFQRAT---DETPQPFYPADT----PQSPFYLPTTSSSNLEAASKVITN 130

Query: 125 ENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLGQPDN 184
           +NSS++  D       + N  Q        ++ +   +D     +K+T N  +   +   
Sbjct: 131 DNSSVQLPD-----ICIDNKQQPERRQQQRLEKRVNHDD-----KKITRNAANGEQKESI 180

Query: 185 RQQMAFGSN----QSSNNHSPAKNNSDNEMNLPSGSNAGS 220
             ++    N    QSSN H+     SD   ++  GS+ GS
Sbjct: 181 TDELQGTDNTPHEQSSNTHADTNQQSDQHNSVQQGSSGGS 220

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/958 (54%), Positives = 667/958 (69%), Gaps = 23/958 (2%)

Query: 278  ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF 337
            + + Q LV+KLQ+IY++IVKQE ELQERCS LT  QTTDLKNLW+ YK+N ELI+NY+ F
Sbjct: 208  SQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAF 267

Query: 338  ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY 397
            ITTALLPSQ E  L IGQEIV++YRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI +
Sbjct: 268  ITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITH 327

Query: 398  VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH 457
            VFI++SNML D+P K++ PWLERLGDLSRMAIALYPSGF+DWKLSAEHWY ++L   FGH
Sbjct: 328  VFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGH 387

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRT 517
            GKLYYHMSTVQQNTLEAFVNLGKSVFC D F+PS QYMQLVIDNIYQRAFAER+    R 
Sbjct: 388  GKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRN 447

Query: 518  NHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLK 576
            + +V+YLKH+EVMLL SFLES ELQ VV+ +FQ+KFG+SS+  ++F    IF+QD ER K
Sbjct: 448  SLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTK 507

Query: 577  HFFRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDP 636
            +FFRH+  F++SHILQ+ GFG+PKNPFA+LFE                          + 
Sbjct: 508  YFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSME- 566

Query: 637  VEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGP 696
                +    S  ++  ++DSP+  YEFP DL +W++SL +IN TS+KC  +VL++FL+GP
Sbjct: 567  ----APSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGP 622

Query: 697  IVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMV 756
            +V+A  H+LPW  F++S+ IR+D++    LK FWI   R++FPW+S++ F+N +I + + 
Sbjct: 623  LVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALD 682

Query: 757  TGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLE 816
               K   ID     +  ++   L+    +NE+LPE W CWG+LWF+ IS KSD+      
Sbjct: 683  NAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGAT 742

Query: 817  STGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLN 876
               + D +F D P +GICFD+DDE G ++W+R CR + +F  I + E   G       L 
Sbjct: 743  YNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQ-EFNMGLTLASVPLQ 801

Query: 877  PEAT-----SWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSK 931
               +       +N  F+F D   D  S  L   +        FE IS  N   N   G +
Sbjct: 802  SRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQ-----MPAFENISERNLDPNAPPG-Q 855

Query: 932  SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDN 991
            SM+ G S+  L G++ ++ D+ CFNK G LIT SLYT G LE   I GGDDFN  +   +
Sbjct: 856  SMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRS 915

Query: 992  GRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDA 1051
              L   D  +    +DK+E+ WL+  MNP+F ++    +   G+L+C  D+ V++FV DA
Sbjct: 916  DELNKADNPQIKE-LDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDA 974

Query: 1052 TTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYER 1111
            T+WLRHFAH+YKLAT+ VL+FAICLTTFQELRFLRKSKDESV+EAATRAVI VRQLY E+
Sbjct: 975  TSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEK 1034

Query: 1112 KLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDC 1171
            +LL LRFTGNVA HLEEHLE EEQ+TW+SHVDEFVI+A+ KAQ+KF  LN  A E G D 
Sbjct: 1035 RLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDF 1094

Query: 1172 IPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN 1229
            IP +E+    + F+F++LV+DD NMR KA    IRTFS+RF+FA+C ++G     CTN
Sbjct: 1095 IPTTEE----EPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 50/122 (40%), Gaps = 39/122 (31%)

Query: 12  SGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIR 71
           S   QKR +S S DY  S + KRR G G+      + A        +LD+      S +R
Sbjct: 19  SPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAA-------LFLDSG----GSPVR 67

Query: 72  HHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVNENSSIRR 131
             +                             QSP Y+PTTS +N EAA   NENSS+R 
Sbjct: 68  RKDA----------------------------QSPSYMPTTSSSNLEAAAVENENSSVRL 99

Query: 132 SD 133
           SD
Sbjct: 100 SD 101

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1031 bits (2665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/964 (53%), Positives = 674/964 (69%), Gaps = 35/964 (3%)

Query: 278  ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF 337
            + + Q LV+KLQ+IY++IVKQE ELQERC+ LTT QTTDLKNLW+ YKIN ELI+NY+ F
Sbjct: 238  SPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAF 297

Query: 338  ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY 397
            ITTALLPSQ E  L IGQEIV++YRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI +
Sbjct: 298  ITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITH 357

Query: 398  VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH 457
            VFI++S ML D+P K+S PW ERLGDLSRMAIALYPSGF+DWKLSAEHWY ++L   FGH
Sbjct: 358  VFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGH 417

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRT 517
            GKLYYHMSTVQQNTLEAFVNLGKSVFC D F+PSPQYMQLVIDNIYQRAFAER+   +R 
Sbjct: 418  GKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRN 477

Query: 518  NHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLK 576
            + +V+YLKH+EVMLL SFLES ELQ VV+ +FQHKFGVS+S  +FF+P  +F+QD ER+K
Sbjct: 478  SLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVK 537

Query: 577  HFFRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDP 636
            +FFRH+  F++SHILQ  GFGDPKNPFA+LFE                          + 
Sbjct: 538  YFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSFTSIE- 596

Query: 637  VEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGP 696
                +    S  ++   +DSP+  YEFP DL +W+ SL +IN+TS +C  IV ++FL GP
Sbjct: 597  ----TTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGP 652

Query: 697  IVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMV 756
            +V A+ H+LPW  F++S+ +++D +  + LK FWI  +R+IFPW+S++ F+N L+ + + 
Sbjct: 653  LVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLD 712

Query: 757  TGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLE 816
               K   ID        ++   L+    E+E+LPE W CWG+LWF+ I+ KS+ +   + 
Sbjct: 713  NNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVI 772

Query: 817  STGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE----WEACDGYGHGC 872
            ++G  D  F D P +GICFD+DDE G K+W+R CR + +F  I +          +    
Sbjct: 773  NSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQS 832

Query: 873  KKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEK-----FEIISNLNCSDNLQ 927
            ++        +N  F F          E  P +++   F +     FE I+  N   N++
Sbjct: 833  RRPMTAGHPLQNFSFNF----------EEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIR 882

Query: 928  DGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANK 987
             G +SM+ G SI +  G++ MY DY CFNK+G LI+ SLYT G LE   IQGGDDFN  +
Sbjct: 883  PG-QSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTER 941

Query: 988  ILDNGRLVVQDRLEYS--SAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVT 1045
                GR    ++ E +  + +++LE+ WL+  MNP+F ++    +   G+L+C  D+ V+
Sbjct: 942  Y---GRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVS 998

Query: 1046 FFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVR 1105
            +FVLDAT+WLRHFAH++KLAT++VL+F ICLTTFQELRFLRKSKDESV+EAATRAVI VR
Sbjct: 999  YFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVR 1058

Query: 1106 QLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAI 1165
            QLY ++KLL LRFTGNVA HLEEHLE EEQ+TW+SHVDEFVI+A+ KAQ KF  +N  A 
Sbjct: 1059 QLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAK 1118

Query: 1166 EKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETG 1225
            E G D I  +++    + F+FV+LV+DD NMR KA    I+TFSTRF+FA+C ++G    
Sbjct: 1119 EAGHDFIATTDE----EPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQ 1174

Query: 1226 VCTN 1229
             CTN
Sbjct: 1175 ACTN 1178

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 92/209 (44%), Gaps = 21/209 (10%)

Query: 5   SASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLL 64
           S S+ G + + QKR +S S +Y  S + KRR G GV      + A        +LD    
Sbjct: 12  SGSVFGANTVQQKRQHSRSYEYMGSGVSKRRVGSGVSGTTAAAAAS-------FLDCE-- 62

Query: 65  TSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVN 124
              S +R  E TP++ +  T+ M     P  V  S +   SP YLPTTS +N EAA T N
Sbjct: 63  --GSPLRRREVTPTLGRGPTIGM-----PHSV-MSADNAYSPSYLPTTSSSNLEAAVTEN 114

Query: 125 ENSSIRRSD-SVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKV---TYNGQSSLG 180
           EN S+   D  + R  T  ++ +        ++PQ ++     +   +      G SS G
Sbjct: 115 ENGSVNFPDICIERQRTDPHSVRYTRTEQGNVRPQSHESLSNHQHHTLPNSIQGGSSSAG 174

Query: 181 QPDNRQQMAFGSNQSSNNHSPAKNNSDNE 209
            P   Q    GS   +++ S      DN+
Sbjct: 175 LPTGDQDFREGSTPENSSRSSRHGPHDNQ 203

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/978 (51%), Positives = 655/978 (66%), Gaps = 46/978 (4%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            S Q LV+KLQ+IYK IVKQE ELQERCS LTT QTT+LKNLW  YKIN++LI+NY+ F+T
Sbjct: 413  SSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLT 472

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TALLPSQ+E  + IG+EIV++YRIERRLWVYGTITFLD+ KNFSNFMDPEVCCQFI +VF
Sbjct: 473  TALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVF 532

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            I++SNML D+PPKY IPWL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HGK
Sbjct: 533  ISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGK 592

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH 519
            LYYHMSTVQQNTLEAFVNLGKSVFC+D F+PS QYMQLVIDNIYQRAF ER++  +R   
Sbjct: 593  LYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQ 652

Query: 520  IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHF 578
            +++YLKH+EVMLLPSFLES++LQ VV+ YF+ KFG  S+  N FD   +F Q+ + L++F
Sbjct: 653  LIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYF 712

Query: 579  FRHSSLFSQSHILQLCGFGDPKNPFAMLFE------XXXXXXXXXXXXXXXXXXXXXXXX 632
            FRH+  F++SHILQL GFGDPKNPFA+LFE                              
Sbjct: 713  FRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSSTMA 772

Query: 633  XXDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRF 692
              D  +  S + ++ E FF  I++ + PY  P +L +W  SL+YIN+TS+KC M+VL++F
Sbjct: 773  IDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKF 832

Query: 693  LYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIH 752
            L GP+V ALPH +PW  FIIS+  ++  +N  + +KFW+ F+ RIFPW+++++F+N LI 
Sbjct: 833  LKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIA 892

Query: 753  YCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDV 812
            Y +    K+  +D+    Y  M  E+LL     NE LPE W CWG+LWF+TI  K    V
Sbjct: 893  YMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHV 952

Query: 813  TTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGC 872
              LES G+ + +FLD+P +GI FD +DE G  +W+R CR + LF  + E      +  G 
Sbjct: 953  EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAE-----NFPIGI 1007

Query: 873  KKLNPEATSW------------KNLVFRFNDDTNDQLSVELYPEENESFPFE------KF 914
              L+P A  +            K+  F+    ++ +L V + P +  +   +        
Sbjct: 1008 -TLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSEL-VPMNPPQPSTTAIDLDHLKNTL 1065

Query: 915  EIISNLNCSDNLQDGSK--SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPL 972
            EI    +  +   D     S+I G SI +  G++ ++PDYF ++KNG+ ++ASLYT    
Sbjct: 1066 EIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYA 1125

Query: 973  ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSF 1032
                   G        +D+ R  VQ   E       +E  +   F + D   R+ L ++ 
Sbjct: 1126 NNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFAD-DLFLRDALYQT- 1183

Query: 1033 LGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDES 1092
                   A ++ T+FVLD TTWLRHF HIYKLA+S VLKFAICLTTF ELRFLRK KDE+
Sbjct: 1184 -------AHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDEN 1236

Query: 1093 VLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAK 1152
            V+EAATRA+I VRQLY E KLL LRFTGNVA H+EEHLE EE++TW+SHVDEFVI+A+ K
Sbjct: 1237 VVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYK 1296

Query: 1153 AQDKFNVLNNDAIEKGKDCIPL-SEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTR 1211
            AQ KF  +N   +E+ +    L + D +S  +  FV LVTDD NMR KAQ   +RTFST+
Sbjct: 1297 AQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLK--FVVLVTDDSNMRKKAQDQDVRTFSTK 1354

Query: 1212 FVFAICRELGRETGVCTN 1229
            FVF++C  +G  + +CTN
Sbjct: 1355 FVFSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/965 (50%), Positives = 624/965 (64%), Gaps = 68/965 (7%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            S Q LV+KLQ+IYK IVKQE ELQERCS LT  QTT+LK LW+ YK+N++LI+NY+ FIT
Sbjct: 236  SSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFIT 295

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TALLP QS+  LAIGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFI +VF
Sbjct: 296  TALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVF 355

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            I++SNML D+P +Y+IPW +RLGDLSRMAIALYPSGF+DWKLSAEHWY E++K+ +GHGK
Sbjct: 356  ISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGK 415

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH 519
            LYYHMSTVQQNTLEAFVNLGKSVFC+D F PS QYMQLVIDNIYQRAF ER++  +R + 
Sbjct: 416  LYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQ 475

Query: 520  IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGV-SSSGNFFDPNLIFIQDAERLKHF 578
            +++YLKH+EVMLLPSFLES++LQ VV+ YF+ KFG+ ++  N FD   +F Q+ ++LK+F
Sbjct: 476  LIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYF 535

Query: 579  FRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDPVE 638
            FRH+  F++SHILQL GFGDPKNPFA+LFE                            + 
Sbjct: 536  FRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTETSSAMA 595

Query: 639  FSSQQQ--------ASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLR 690
               ++         A  + FF  IDS   PY FP  L VW  SL Y+N+TS+ C MIVL+
Sbjct: 596  IDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLK 655

Query: 691  RFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTL 750
            +FL GP+V ALPH+LPW  FII++  ++  + D   ++FW+  + RIFPW++++ F+N L
Sbjct: 656  KFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVL 715

Query: 751  IHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDL 810
            I Y +     +  ID        M  ++L+     NE+LPE W CWG LWF+ I  K  +
Sbjct: 716  IAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKV 775

Query: 811  DVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE------WEA 864
             + + ES G+ D +FLD P +GI FD DDE G K+W+R CR + LF  I E        +
Sbjct: 776  QMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVS 835

Query: 865  CDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSD 924
                 H C++ +P     K+  F+  D   +  SV            E FE  S+ N  D
Sbjct: 836  SQAQVH-CRRTDPMNHVLKSFCFKLRDTFYNSNSV-------LQNTIEVFEEGSDAN-KD 886

Query: 925  NLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFN 984
                   S++   SI    G+K +  D  C+++ G+ ++ SLYT           G++ +
Sbjct: 887  MQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTS---------WGNETS 937

Query: 985  ANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNV 1044
             N+I  +     Q   E    I+ +     E   N DF +             C+ +   
Sbjct: 938  KNEIPQSEPTQQQTANEADLFIEGINTSLTE--FNIDFPE-------------CKMNGKD 982

Query: 1045 TFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAV 1104
            TFFVLDAT+WLRHFAH+YKLA++ VL+FAICLTTFQELRFLRKSKDE+V+EAATRAVI V
Sbjct: 983  TFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITV 1042

Query: 1105 RQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDA 1164
            RQLY E ++L LRFTGNVA H+EEHLE EEQ+TW+SHVDEFV +AI KAQ + +  N D 
Sbjct: 1043 RQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENRD- 1101

Query: 1165 IEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRET 1224
                               F+ V LVTDD NMR KAQQ  I T STRFVFA C  +G   
Sbjct: 1102 -------------------FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRL 1142

Query: 1225 GVCTN 1229
             +CTN
Sbjct: 1143 KICTN 1147

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/982 (50%), Positives = 641/982 (65%), Gaps = 93/982 (9%)

Query: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343
            L++KLQE+Y+ IVKQE ELQERCS LT  QTT+LK+LW  YKIN EL++NY+ FITTALL
Sbjct: 256  LIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTALL 315

Query: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403
            PSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VFI+LS
Sbjct: 316  PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLS 375

Query: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463
             M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+T+ HGKLYYH
Sbjct: 376  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYYH 435

Query: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523
            MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct: 436  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 495

Query: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582
            LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +FIQ+ +  K+FFRH 
Sbjct: 496  LKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFKYFFRHG 555

Query: 583  SLFSQSHILQLCGFGDPKNPFAMLFE------------XXXXXXXXXXXXXXXXXXXXXX 630
              F+QSHILQ+ GFG+PKNPFA+LFE                                  
Sbjct: 556  PSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTESSTGNSRN 615

Query: 631  XXXXDPVEFSSQQQASTED----FFSTIDSPKVPYEFP--LDLGVWKRSLHYINVTSMKC 684
                D    SS    S  D    FF+ ID+ + P   P  L    W  +L ++N+TS+KC
Sbjct: 616  GNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKC 674

Query: 685  GMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLI 744
            GMIVLR+FL+GP+  ALPHVLPW+ FIISI ++ +Q+ND   K+FWIV I+R+FPWD+++
Sbjct: 675  GMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTMV 734

Query: 745  TFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTI 804
            TFMN LI Y +   T N  I    + Y  +N  ELL S  ENE+LPE W CWG+LWF+ I
Sbjct: 735  TFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGTLWFDAI 794

Query: 805  SKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE 861
             +K+   +++    +  G+ D + LDSPT+GI FDD DE G K+W+R CR + LF     
Sbjct: 795  CQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFR---- 850

Query: 862  WEACDGYGHG----------CKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPF 911
             E    +  G          C  L       ++LV++    TN + SV +       F  
Sbjct: 851  -EVSRSFPLGVIVRHDPLVNCSSLQSNNI-LRDLVYKLEPLTNIRSSVPVLSTLESIFDI 908

Query: 912  E--KFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTK 969
               + EI ++L+    L     S+I G +I +  G+K + PDY CF+KNG+ ++ASLYT 
Sbjct: 909  SEARSEINTDLHAVPEL-----SVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTS 963

Query: 970  GPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAF--MNPDFRQREL 1027
              +   N    ++   N    N R              + E  +LE    ++P+    E+
Sbjct: 964  WYVPNCN----NNLETNISYANER--------------ENEALFLECMKSVHPEIAYPEI 1005

Query: 1028 LNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRK 1087
                         D   T+FV DAT+WLRH A I+KLA + +L+FAICLTTFQELRFLRK
Sbjct: 1006 -------------DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRK 1052

Query: 1088 SKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVI 1147
            SKDE+V+EAATR +I +RQLY E K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI
Sbjct: 1053 SKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1112

Query: 1148 DAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRT 1207
            ++I KAQ+K        +E  K      +   S+ RFN+V L++DD  M+ KA++  IRT
Sbjct: 1113 ESIMKAQEK--------LENAK------QPNISSHRFNYVVLISDDDTMKKKAEEKKIRT 1158

Query: 1208 FSTRFVFAICRELGRETGVCTN 1229
             STRFVF++C +LG +  +CT+
Sbjct: 1159 LSTRFVFSLCTKLGEQRHLCTD 1180

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score =  921 bits (2381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/983 (49%), Positives = 638/983 (64%), Gaps = 62/983 (6%)

Query: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343
            L+EKLQ IYK IVKQE ELQ+RCS LTT QTT+LKNLW  YK+N +LI+NYI FITTALL
Sbjct: 284  LIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTALL 343

Query: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403
            PSQS   + IG+EIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFI +VFI+LS
Sbjct: 344  PSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLS 403

Query: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463
             ML DLPPK+SIPWL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HGKLYYH
Sbjct: 404  TMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 463

Query: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGN-RTNHIVD 522
            MSTVQQNTLEAFVNLGKSVFC+D F PS QYMQLVIDNIYQR F +R+ +GN R + ++D
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSDLID 523

Query: 523  YLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVS-SSGNFFDPNLIFIQDAERLKHFFRH 581
            YLKH+EVMLLPSFLE+ +LQ VV++YF  +FGV  +  N F+   +F Q    L+ +FRH
Sbjct: 524  YLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLRFYFRH 583

Query: 582  SSLFSQSHILQLCGFGDPKNPFAMLFE--------XXXXXXXXXXXXXXXXXXXXXXXXX 633
            +  F++SHILQL GFG+PKNPFA+LF+                                 
Sbjct: 584  APAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTMSIDTNDS 643

Query: 634  XDPV----EFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVL 689
              P+     + ++    TE +F  IDS ++P + P ++ VW +SL ++N+TS+KC +IVL
Sbjct: 644  RGPILNTSAYVNEGNIVTE-YFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLKCSVIVL 701

Query: 690  RRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNT 749
            R+FL GP++ ALPHVLPW  FII+  ++     + +  KFW + +RRI PW++L +F+N 
Sbjct: 702  RKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNV 761

Query: 750  LIHYCMVTGTKNFDIDAHMSTYLPM-NREELLTSICENENLPECWSCWGSLWFNTISKKS 808
            L+ Y +    +   I     TY    N  ELL     NENLPE W CWG+LWF+ IS K 
Sbjct: 762  LLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKR 821

Query: 809  DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLF-----NIITEWE 863
             L+  T    G+ D +FLD P +GI FD+ DE G  +W R  R + LF     N+ T   
Sbjct: 822  ALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQTGLR 881

Query: 864  ACDGYGHGCKK--LNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLN 921
                    C++  ++P     K+  F+         S + +   N+  P   FE I    
Sbjct: 882  VSRTAPVHCRRDDIDPNHI-LKSFSFKMEGFDESSYSGQPFSTINKLLPL--FENID--- 935

Query: 922  CSDNLQDGSKSMIPGVSIENL---QGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQ 978
               NL   ++ M+  V  EN+    G+K ++ +   F++NG+L+++S+YT   ++  N  
Sbjct: 936  -ETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDNDN-- 992

Query: 979  GGDDFNANKILDNGRLVVQDR------------LEYSSAIDKLEQPWLEAFMNPDFRQRE 1026
              ++   N+   N ++  Q R              ++S  D  +    E +MNP+   + 
Sbjct: 993  SLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPEKLNKN 1052

Query: 1027 LLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLR 1086
            +   S     N + + N+T+FV DAT+WLRHFAHIYKL+T++VL FA+CLTTFQELRFLR
Sbjct: 1053 MDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLR 1112

Query: 1087 KSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFV 1146
            KSKDE+V+ AA RA+I +RQLY E KLL LRFTGNVA  +EEHLE EEQ+TW+SHVDEFV
Sbjct: 1113 KSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFV 1172

Query: 1147 IDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIR 1206
            I+A+ KAQ+KF              I  +E     + FN V LVTDD NM+ KAQ+ GI+
Sbjct: 1173 IEAVVKAQNKF--------------ISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIK 1218

Query: 1207 TFSTRFVFAICRELGRETGVCTN 1229
            TF+T F+F++CR+LG +  VCTN
Sbjct: 1219 TFTTHFIFSVCRKLGIQDNVCTN 1241

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 20/117 (17%)

Query: 8   MAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLT-- 65
           ++  + L QKRH SNS  Y +   I R     +  N++I+          Y+D + +   
Sbjct: 38  ISPSAALRQKRHGSNSYIYKNQKRIARPDDKILNANININ----------YIDHNSIVNE 87

Query: 66  --SPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA 120
             +P K     + PS++K        TPQP  + T  E P+SPFY+   S TN + A
Sbjct: 88  NATPVK-SVLSRRPSLSKKSN---NVTPQPSFLVT--EPPKSPFYVTNQSYTNIDVA 138

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1013 (47%), Positives = 640/1013 (63%), Gaps = 81/1013 (7%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            S Q LV+KLQ+IYK IVKQE ELQERCS LTT QTT+LKNLW  YKIN +LI+NY  FIT
Sbjct: 287  SSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFIT 346

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TALLPSQ    + IG+EIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFI +VF
Sbjct: 347  TALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVF 406

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            I+LS +L D+PPK++IPWL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HGK
Sbjct: 407  ISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGK 466

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGN-RTN 518
            LYYHMSTVQQNTLEAFVNLGKSVFC+D F PS QYMQLVIDNIYQR F +R++ GN R  
Sbjct: 467  LYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNP 526

Query: 519  HIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVS-SSGNFFDPNLIFIQDAERLKH 577
             ++DYLKH+EVMLLPSFL S +LQ VV++YFQ +FG+  S  N FD   +F Q    L+ 
Sbjct: 527  DLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRF 586

Query: 578  FFRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDPV 637
            FFRH+  F++SHILQL GFG+PKNPFA+LFE                             
Sbjct: 587  FFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSSTA 646

Query: 638  EFSSQQQA------------------STEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINV 679
              +   QA                  S  ++   I++ K   E P D+  W +SL +IN+
Sbjct: 647  PKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDFINM 705

Query: 680  TSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFP 739
            TS+KC MIVL++FL+GP++ ALPH LPW +FII+  I+++++ +    KFW + ++RIFP
Sbjct: 706  TSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFP 765

Query: 740  WDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSL 799
            WD++ +F+N L+ Y +        I+     Y  M+ +++L    ++E+LPE W CWG+L
Sbjct: 766  WDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTL 825

Query: 800  WFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNII 859
            W++ I  K+ +D  T    G+ D +FLD P +GI FD +DE G K+W+R  R + LF  I
Sbjct: 826  WYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGI 885

Query: 860  TE-----WEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKF 914
            ++      +     G  C+      +  +   F+          +E Y E   S  F +F
Sbjct: 886  SKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFK----------LESYDEPTSS-KFNEF 934

Query: 915  ----EIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKG 970
                E +S +N +D L   S S++ G +I    G++ +  D   F+KNG+++++S+YT  
Sbjct: 935  IPLCEEVSAIN-NDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSW 993

Query: 971  PLET--------------ANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKL-----EQ 1011
             ++T              A  +G  D  AN    +  L    +   S   D       E 
Sbjct: 994  MIDTGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNEN 1053

Query: 1012 PWLEAFMN-PDFRQRELLNRSFLGNLNC----------QADTNVTFFVLDATTWLRHFAH 1060
               + FM+  D R R + +    G              + D   TFF+ DAT+WLRHFAH
Sbjct: 1054 DLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAH 1113

Query: 1061 IYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTG 1120
            IYK+AT+ VLKF +CLTTFQELRFLRKSKDE+V+EAA RA+I +RQLY E +LL LRFTG
Sbjct: 1114 IYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTG 1173

Query: 1121 NVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNN----DAIEKGKDCIPLSE 1176
            NVA  +EEHLE EEQ+TW+SHVDEFVI+A+ KAQDKF         +    G   +PL  
Sbjct: 1174 NVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPL-- 1231

Query: 1177 DGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN 1229
                 +RF++V+LVT+D NM+ KAQ  GI+TFST FVF++C +LG    +CTN
Sbjct: 1232 ---GGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/977 (49%), Positives = 635/977 (64%), Gaps = 88/977 (9%)

Query: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343
            L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  Y+IN EL++NY+ FITTALL
Sbjct: 268  LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTALL 327

Query: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403
            PSQ +  L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF++LS
Sbjct: 328  PSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 387

Query: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463
             M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+ + HGKLYYH
Sbjct: 388  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYH 447

Query: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523
            MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct: 448  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 507

Query: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582
            LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+P  +FIQ+ +  K+FFRH+
Sbjct: 508  LKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHA 567

Query: 583  SLFSQSHILQLCGFGDPKNPFAMLFE-----------XXXXXXXXXXXXXXXXXXXXXXX 631
              F+QSHILQ+ GFG+PKNPFA+LFE                                  
Sbjct: 568  PSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESSTSNSRN 627

Query: 632  XXXDPVEFSSQQQASTE-----DFFSTIDSPKVP-YEFPLDLGVWKRSLHYINVTSMKCG 685
               D  E  S   + +E     +FF+ ID+ + P     L    W  SL ++N+TS+KCG
Sbjct: 628  ENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCG 687

Query: 686  MIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLIT 745
            MIVLR+FL+GP+  ALPH LPW+ FIISI ++  Q++D   K+FWIV ++RIFPWD+++T
Sbjct: 688  MIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVT 747

Query: 746  FMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTIS 805
            FMN LI   +     +  I +    Y  +N  ELL    E E LPE W CWG+LWF+TI 
Sbjct: 748  FMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTIC 807

Query: 806  KKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEW 862
            +K+   +++    E  G+ D + LDSP +GI FD +DE G K+W+R CRT+ LF  ++  
Sbjct: 808  QKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRS 867

Query: 863  EACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEE--NESFP--------FE 912
                   +    +N  +    N++          LS +L P      S P         +
Sbjct: 868  FQIGVIINNESSINRSSLQSNNIL--------GNLSYKLEPLSTLGSSIPTLNTLEGIID 919

Query: 913  KFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPL 972
             FE  S  N  D       S+I G SI N  G+K + P+Y CF+KNG+ ++ASLYT   +
Sbjct: 920  VFETRSENNI-DLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYV 978

Query: 973  ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSF 1032
               +     + N+N   +N                  E  +LE   + D   RE+     
Sbjct: 979  PNGSNNPETNINSNCEKEN------------------EGQFLECLKSDD---REI----- 1012

Query: 1033 LGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDES 1092
                    D N T+FV DAT+WLRH A I+KLA + +LKFAICLTTFQELRFLRKSKDE+
Sbjct: 1013 --------DLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1064

Query: 1093 VLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAK 1152
            V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI++I K
Sbjct: 1065 VMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1124

Query: 1153 AQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRF 1212
            AQ+K    N          +P+     S+ RFN+V L++DD  M+ KA++  I+T STRF
Sbjct: 1125 AQEKLENANQ---------LPV-----SSCRFNYVILISDDDTMKKKAEEKKIKTLSTRF 1170

Query: 1213 VFAICRELGRETGVCTN 1229
            VF++C +LG +  +CT+
Sbjct: 1171 VFSLCTKLGEQRHLCTD 1187

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/985 (48%), Positives = 633/985 (64%), Gaps = 96/985 (9%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            S   L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  Y+IN ELI+NY+ FIT
Sbjct: 265  SSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFIT 324

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TALLPSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF
Sbjct: 325  TALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVF 384

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            ++LS M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+ + HGK
Sbjct: 385  VSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGK 444

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH 519
            LYYHMSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + 
Sbjct: 445  LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSL 504

Query: 520  IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHF 578
            +++YLKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+P  +FIQ+ +  K+F
Sbjct: 505  LIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYF 564

Query: 579  FRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDPVE 638
            FRH+  F+QSHILQ+ GFG+PKNPFA+LFE                              
Sbjct: 565  FRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTG 624

Query: 639  ------------FSSQQQASTED----FFSTIDSPKVPYEFP--LDLGVWKRSLHYINVT 680
                         SS    S  D    FF+ ID+ + P   P  L    W  +L ++N+T
Sbjct: 625  NSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNMT 683

Query: 681  SMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPW 740
            S+KCGMIVLR+FL+GP+  ALPH+LPW+ FII+  ++ +Q++D T K FW++ ++R+FPW
Sbjct: 684  SLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPW 743

Query: 741  DSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLW 800
            D+++TFMN LI Y +     N  I    S Y  +N   LL S  E+E LPE W+CWG+LW
Sbjct: 744  DTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLW 803

Query: 801  FNTISKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFN 857
            F+TI +K+   +++    +  G+ D + LD+PT+GI FDD DE G K+W+R CR + LF 
Sbjct: 804  FDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFR 863

Query: 858  IITEWEACDGYGHGCKKLN---------PEATSWKNLVFRFNDDTNDQLSVELYPEENES 908
                 E    +  G    N           +   +NLV++    +N + +  +      S
Sbjct: 864  -----ELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENS 918

Query: 909  FPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYT 968
                +    +N+   D       S+  G +I +  G+K + PDY CF++NG+ ++ASLYT
Sbjct: 919  VDISEARSKNNI---DLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYT 975

Query: 969  KGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELL 1028
            +  L   N       N ++ L N            S I+K ++      M PD       
Sbjct: 976  RWYLPNGN-------NISEALVN------------SDIEKGDEDLFLECMKPD------- 1009

Query: 1029 NRSFLGNLNCQA-DTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRK 1087
                     C   D   T+FV DAT+WLRH A I+KLA + +LKFAICLTTFQELRFLRK
Sbjct: 1010 ---------CPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRK 1060

Query: 1088 SKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVI 1147
            SKDE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI
Sbjct: 1061 SKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1120

Query: 1148 DAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQ---STQRFNFVSLVTDDFNMRNKAQQLG 1204
            ++I KAQ+K                 L   GQ   + +  N+V L++DD  M+ KA++  
Sbjct: 1121 ESIKKAQEK-----------------LENAGQPHVTPRHSNYVVLISDDDTMKKKAEEKE 1163

Query: 1205 IRTFSTRFVFAICRELGRETGVCTN 1229
            I+T ST+FVF++C +LG +  +CT+
Sbjct: 1164 IKTLSTKFVFSLCTKLGEKRHLCTD 1188

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/971 (48%), Positives = 635/971 (65%), Gaps = 67/971 (6%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            S Q LV+KLQ+IYK I+KQE ELQERCS LT  QTT++KNLW+ YK+NA+LI+NY+ FIT
Sbjct: 314  SSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFIT 373

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TAL PSQS+S L IG+EIVD+Y+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF
Sbjct: 374  TALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVF 433

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            I++S+ML+D+P KY+IPWL++LGDLSRMA+AL+PSGF+DWKLSAE WY  ++++++G+GK
Sbjct: 434  ISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGK 493

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTN- 518
            LYYHMSTVQQNTLEAFVNLGKSVFC++ FVPS QY+QLVIDNIYQRAFA+R+SS N  N 
Sbjct: 494  LYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNC 553

Query: 519  -HIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN---FFDPNLIFIQDAER 574
              +VDYLKH+EVMLLP+F+ES +LQ VV+ YF  KFG+  + N    F P  +FIQ+ ++
Sbjct: 554  QLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQ 613

Query: 575  LKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXX 634
            LK +FRH++ F+++ ILQL G+G+PKNPFA+LF                           
Sbjct: 614  LKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGEDG 673

Query: 635  DPVEFSSQQQA------------STEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSM 682
                FSS                 +EDFF+ ID   +    P  + +W  SL Y N T+ 
Sbjct: 674  SSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTAT 733

Query: 683  KCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDS 742
            KC MIVL++FL GP++ ALPH+LPW+ F+ISI +++++  D  + +FW  FI+RIFPW+S
Sbjct: 734  KCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNS 793

Query: 743  LITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFN 802
            ++ F+N L+ Y +     N  ++     Y  +N EELL +   NE+LPE W C GSLWF+
Sbjct: 794  MVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFD 853

Query: 803  TI-SKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE 861
             I  K++  +  +    G+ D  FLD P +GI FD++DE G K+W+R  R + LF  I  
Sbjct: 854  IIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIV- 912

Query: 862  WEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQL---SVELYPEEN----ESFPFEKF 914
             E  +G+G+     N    + + L        N  L   S +L  + +    +      F
Sbjct: 913  -ERFNGFGNLAISYNAPVINRRGL------GVNSHLVGYSFKLMAKSDDIMFDDMLVSNF 965

Query: 915  EIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLET 974
            E I + N SD       SMI G +I    G+K ++ DY+ F+KNGDLI+ S Y    +  
Sbjct: 966  EEIDS-NNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSI-- 1022

Query: 975  ANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKL-EQPWLEAFMNPDFRQ-RELLNRSF 1032
                     N +  ++ G L        +++ D + E+       +P++    E  N+  
Sbjct: 1023 ---------NQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDSVDEFWNKEI 1073

Query: 1033 LGNLNCQADTNV---TFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSK 1089
              ++  +    +   T+F+LDAT+WLRHFAH+YK+AT+S+LKF+ICLTTFQELRFLRKSK
Sbjct: 1074 YDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSK 1133

Query: 1090 DESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDA 1149
            DE+V+EAATRA+I +RQL+ E KLL LRFTGNVA H+EEHLE EEQ+TW+SHVDEFVI+A
Sbjct: 1134 DENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEA 1193

Query: 1150 IAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFS 1209
            + KA+ K                   ++  + + F  V LVTDD NM+NKA + G +TFS
Sbjct: 1194 VIKAETKRK----------------EQEMHNMKGFQIV-LVTDDSNMKNKALEKGSKTFS 1236

Query: 1210 TRFVFAICREL 1220
            TRFVFAI   L
Sbjct: 1237 TRFVFAISNYL 1247

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 51/125 (40%), Gaps = 5/125 (4%)

Query: 14  LHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIRHH 73
           L QKRH S+S  Y   N IK+R       +   +  +         D S  TS       
Sbjct: 63  LGQKRHGSSSY-YITPNYIKKRVAKNSYNSATGNFLDSGSNGGG--DISNQTSLQNTPLA 119

Query: 74  EKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVNENSSIRRSD 133
              PSI K + +    TPQP  +  + +   SPF L +   +N +  +  N   SIR+  
Sbjct: 120 SPKPSIAKNNIINTSTTPQPTYI--TQDSMTSPFVLNSNLPSNLDIVSNENLEDSIRKDQ 177

Query: 134 SVTRL 138
             +++
Sbjct: 178 DFSQI 182

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/980 (48%), Positives = 634/980 (64%), Gaps = 93/980 (9%)

Query: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343
            L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN +L++NY+ FITTALL
Sbjct: 275  LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTALL 334

Query: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403
            PSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF++LS
Sbjct: 335  PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 394

Query: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463
             M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+ + HGKLYYH
Sbjct: 395  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYH 454

Query: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523
            MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct: 455  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 514

Query: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582
            LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +F+Q+ +  K+FFRH 
Sbjct: 515  LKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHG 574

Query: 583  SLFSQSHILQLCGFGDPKNPFAMLFE------------XXXXXXXXXXXXXXXXXXXXXX 630
              F+QSHILQ+ GFG+PKNPFA+LFE                                  
Sbjct: 575  PSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSRN 634

Query: 631  XXXXDPVEFSSQQQASTED----FFSTIDSPKVPYEFP--LDLGVWKRSLHYINVTSMKC 684
                D    SS    S  D    FF+ ID+ + P   P  L    W  +L ++N+TS+KC
Sbjct: 635  DNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKC 693

Query: 685  GMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLI 744
            G+IVLR+FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+FW++ ++R FPWD+++
Sbjct: 694  GIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMV 753

Query: 745  TFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTI 804
            TFMN LI Y +   T N  I      Y  ++  ELL    E E LPE   CWG+LWF+TI
Sbjct: 754  TFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTLWFDTI 813

Query: 805  SKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE 861
             +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W+R CRT+ LF     
Sbjct: 814  CEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFR---- 869

Query: 862  WEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYPEEN--ESFP-FEKFE 915
             E    +  G    N        L++R    N +    L  +L P  N   + P     E
Sbjct: 870  -ELSRSFPIGVIIRNDP------LIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALE 922

Query: 916  IISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFCFNKNGDLITASLYTK 969
             I +++ + +  +     +P +S+       +  G+K +  DY CF+KNG+ ++ASLYT 
Sbjct: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982

Query: 970  GPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLN 1029
              +  +N       N N         ++D + Y+S  +  E  +LE  +  D+       
Sbjct: 983  WYVPNSN-------NTN---------IEDNINYNSEKEN-EGLFLEC-IKSDYP------ 1018

Query: 1030 RSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSK 1089
                     + D   T+FV DAT+WLRH A I+KLA + +L+FAICLTTFQELRFLRKSK
Sbjct: 1019 ---------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSK 1069

Query: 1090 DESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDA 1149
            DE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI++
Sbjct: 1070 DENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES 1129

Query: 1150 IAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFS 1209
            + KAQ+K                  SE   S +RFN+V L++DD  M+ KA++  I+T S
Sbjct: 1130 VMKAQEKLE--------------SASEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLS 1175

Query: 1210 TRFVFAICRELGRETGVCTN 1229
            TRFVF++C +LG +  +CT+
Sbjct: 1176 TRFVFSLCTKLGEQRHLCTD 1195

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/967 (47%), Positives = 630/967 (65%), Gaps = 58/967 (5%)

Query: 282  QQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTA 341
            Q LV+KLQ+IYK+IV+QE ELQE+C+ LT+ QTTDL ++W  Y+IN EL+ NY+ FI+TA
Sbjct: 368  QALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTA 427

Query: 342  LLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIA 401
            LL SQS+  L IGQEIV+ YRI RRLWVYGTITFLDVLKNFS+FMDPEVC QFI +VFI+
Sbjct: 428  LLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFIS 487

Query: 402  LSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLY 461
            +S ML D+P KYSIPW++RLGDLSRMAIALYPSGF+DWKLS+E+WY ++LK+T+G+GKLY
Sbjct: 488  ISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKLY 547

Query: 462  YHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIV 521
            YHMST+QQNTLEAFVNLGKSVFC+D F+PSPQYMQLVIDNIYQRAF ER S+  R + ++
Sbjct: 548  YHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLI 607

Query: 522  DYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFR 580
            +YLKH+EVMLLP+F+ +  LQ VV+ YF+HKFG      N F P  IF+Q+ E LK+FFR
Sbjct: 608  EYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFFR 667

Query: 581  HSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDPV--- 637
            H+  F++SHILQ  GFGD KNPFA+LF+                          + V   
Sbjct: 668  HAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTSNESVMSL 727

Query: 638  -EFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGP 696
               S+    S++ +FS ++S + PY  P    +W +SL Y+N+T+++CG+IVLR+FL+GP
Sbjct: 728  DNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGP 787

Query: 697  IVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMV 756
             V ALPH++ W  FIIS+ ++ + + D   + FW  F+RR+ P +S+++F+N LI Y + 
Sbjct: 788  FVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALD 847

Query: 757  TGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLE 816
                +  I +       M+ +ELLT    NE LPE W CWG+LWF+ I+ KS+ D  + E
Sbjct: 848  NSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSYE 907

Query: 817  STGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE-WEACDGYGHG---- 871
              G+SD LF DSP +GI FD  DE G K+W+R  R + LF  I E ++      H     
Sbjct: 908  KIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPVY 967

Query: 872  CKKLNPEATS-WKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGS 930
            C++ + E      +  F+      +  +V++  E       E  E+ + +N +    D +
Sbjct: 968  CRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNIT---MDAT 1024

Query: 931  K--SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKI 988
               S+    +I    G+K + P+   F+KNG+L +A+ YT              ++A +I
Sbjct: 1025 PPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSW------------YSAQEI 1072

Query: 989  LDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFV 1048
            +       ++ +  SS     +   +E  +   F   E  + S L  LN +     T FV
Sbjct: 1073 VPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLET----TSFV 1128

Query: 1049 LDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLY 1108
            LDAT+WLRH AHIYKLA++S L F+ICLTTFQELRFLRKSKDE+V+EAA RA+I +RQLY
Sbjct: 1129 LDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLY 1188

Query: 1109 YERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKF------NVLNN 1162
             + K++ LRFTGN+A H+EEHLE EEQ+TW+SHVDEFVI++I+KAQ KF      N ++N
Sbjct: 1189 SDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDN 1248

Query: 1163 DAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGR 1222
            D+                     F  LV+DD NM+ KA +  IRTF+TRFVFA+C E+G+
Sbjct: 1249 DS--------------------RFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGK 1288

Query: 1223 ETGVCTN 1229
               +CTN
Sbjct: 1289 GRLICTN 1295

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/1026 (44%), Positives = 642/1026 (62%), Gaps = 91/1026 (8%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            S Q L+ KLQ+IYKSI+ QE ELQ  CS +T+ QTTDLK +W  YKIN EL++NY++FIT
Sbjct: 272  STQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFIT 331

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TALLPSQS++ L IGQEI+DVY+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQFI +VF
Sbjct: 332  TALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVF 391

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            I+++NM + +P K+SIPW  RLGDLSRMA ALYP G  DWKLSAE+WY E++K+T+G GK
Sbjct: 392  ISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGK 451

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH 519
            LYYHM+TVQQN+L AF+NLGKSVFC D FVP+ QY+QLVIDNIYQRA+  R    +    
Sbjct: 452  LYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQ 511

Query: 520  IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHF 578
            I+DYLKH E+M+LP+F+E+ ELQ +   YF  KFG    G NFFD   +F+Q+ E +K +
Sbjct: 512  ILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFY 571

Query: 579  FRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXXDPVE 638
            FRHS LF+Q+HILQ+ G+G+  N FA+L+E                          D + 
Sbjct: 572  FRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLS 631

Query: 639  F--SSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGP 696
            F  S  +     ++F+++++    +  P ++ +W +SL Y N T + CGM+VL++FL GP
Sbjct: 632  FQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGP 691

Query: 697  IVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMV 756
             VTALPH+LPW+ F+IS+  +++ + D   + FW +FIRRIFPW+++I F+N LI +   
Sbjct: 692  FVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKD 751

Query: 757  TGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLE 816
                   ++    TY  ++ +E+LT+  ENE LPE W+CWGSLWF+TI  KS+   + L+
Sbjct: 752  NSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLK 811

Query: 817  STGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCK--- 873
            + G+ D  FLD+P +GI FD++D+ G K+W+R CR L LF    E      +  G +   
Sbjct: 812  TAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAE-----KFDQGLRLTN 866

Query: 874  --KLNPEATSW-------KNLVFRFN-DDTNDQLSV--------ELYPEENESFPFEKFE 915
               LN E  +        +N+ F F  D T D L +        ++Y    E  P   FE
Sbjct: 867  INSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLP--AFE 924

Query: 916  IISNLNCSDNLQDGSK--SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLE 973
             IS  N    + D     S+I G SI +  G+K + P Y+ ++KNG++   ++Y+    E
Sbjct: 925  SISENNI---ILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSN--WE 979

Query: 974  TANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPD------------ 1021
              N Q G+       ++NG   + D L+ S   +  E+     ++  D            
Sbjct: 980  AFN-QLGNGLKPR--MENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAEV 1036

Query: 1022 -----------------------FRQREL--LNRSFLGNLNCQADTNVTFFVLDATTWLR 1056
                                     QR+L  + ++   N   +     T+F+ DATTWLR
Sbjct: 1037 EREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLR 1096

Query: 1057 HFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLAL 1116
            HFAHIYK+A S +L F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  +K++ L
Sbjct: 1097 HFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPL 1156

Query: 1117 RFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK--FNVLNNDAIEKGKDC--I 1172
            RF G +A H+EEHLE EEQ+TW+SHV+EFVI+A+AK+Q+   F+ L+N++ +   D   +
Sbjct: 1157 RFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENM 1216

Query: 1173 PLSEDGQSTQRFN---------FVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRE 1223
              ++   + QR N            LVTDD NM +KA++ GIRT STRF+F+IC +LG +
Sbjct: 1217 DTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMK 1276

Query: 1224 TGVCTN 1229
             G+CTN
Sbjct: 1277 YGICTN 1282

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/979 (47%), Positives = 622/979 (63%), Gaps = 88/979 (8%)

Query: 278  ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF 337
            A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  YK+N ELI NYI F
Sbjct: 200  AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINF 259

Query: 338  ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY 397
            I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFI Y
Sbjct: 260  IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITY 319

Query: 398  VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH 457
             FI +SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct: 320  AFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC 379

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGN-- 515
            GKLYYH++T+QQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R SSGN  
Sbjct: 380  GKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDR-SSGNTN 438

Query: 516  ------RTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIF 568
                  R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  F    +F
Sbjct: 439  NNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMF 498

Query: 569  IQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXX 628
             Q+ E L+++FRH+  F++S ILQL GFG+PKNPFA+LF+                    
Sbjct: 499  CQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSGAA 558

Query: 629  XXXXXXDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMI 687
                  DP +     Q S+E +F  ID+    + + P ++G+W  SL+YIN+TS++C + 
Sbjct: 559  EIPHYRDPFD----DQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQ 614

Query: 688  VLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFM 747
            VL +FL+ P+  ALPH L WL FII++  +L+ +N   +  FWI F+RR  PW+S++TF 
Sbjct: 615  VLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFS 674

Query: 748  NTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKK 807
            N L+ Y M+     F ++  +  +  +  ++L+    ENENLPE W CWGSLWF+ + KK
Sbjct: 675  NVLVCY-MLDNLHPF-LEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAV-KK 731

Query: 808  SDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDG 867
             D+    +E  G+ D LF DSP +GI FD  DE G K+W R  RT+L            G
Sbjct: 732  CDV----MEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTIL---------TLKG 778

Query: 868  YGHGCKKLNPEATSWKNLVFRFNDDTND----QLSVELYPEENESF-----------PFE 912
                   L  +     ++  R ND + D     L+ +L P E ++F             E
Sbjct: 779  IAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIE 838

Query: 913  KFEIISNLNCSDNLQDGSK-SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGP 971
              E+I  +N   +LQ   K S++ G SI    G+  +  DY CF+KNG   +A +YT+  
Sbjct: 839  INELIETVNI--DLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW- 895

Query: 972  LETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRS 1031
               +N+  G             L V     Y S  + L   W           + L ++ 
Sbjct: 896  ---SNVGNG-----------VTLDVSSESLYDSTTNDLSLHW----------AKILFDKV 931

Query: 1032 FLGNLNCQADTNVT-FFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKD 1090
            F    N   D + + +FV+DAT+WLRHFAHI+KLA +++LKFAICLTTFQELR+LR SKD
Sbjct: 932  FTIGKNTDDDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKD 991

Query: 1091 ESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAI 1150
            ++V+EAATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAI
Sbjct: 992  DNVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAI 1051

Query: 1151 AKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFST 1210
            AK    F       I+K K        G+S +   F  LVTDD NM  KA+   I+T +T
Sbjct: 1052 AKLNQNFQT--ERTIDKNK--------GRSKE---FAVLVTDDDNMNQKAKDKMIKTCNT 1098

Query: 1211 RFVFAICRELGRETGVCTN 1229
            +++F++  +LG  +G+CTN
Sbjct: 1099 KYLFSLGSKLGINSGLCTN 1117

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 75/158 (47%), Gaps = 31/158 (19%)

Query: 1   MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENV------DISVAEIPQ 53
           M P +A+      LHQKRH+S+S  D  +S+  KRR   GV E V       I+ ++I  
Sbjct: 32  MRPTTAAF-----LHQKRHSSSSHNDTPESSFAKRRVP-GVVEPVGKGFIDGITTSQI-- 83

Query: 54  EPCQYLDTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSG-EFPQSPFYLPTT 112
                   S+   P K     + PSI++     ME TPQ      S  + P+SP+Y+  T
Sbjct: 84  --------SMQNIPFKAEDISRRPSISRK---AMETTPQLHTSSNSAMDIPKSPYYVNRT 132

Query: 113 SQT-NFEAAT--TVNENS-SIRRSDSVTRLTTVGNNTQ 146
           + T N E  +  + +EN    R  DS+T  T +  N+Q
Sbjct: 133 AITRNMEVVSKESHDENGPQTRADDSLTTSTGIYANSQ 170

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/975 (47%), Positives = 621/975 (63%), Gaps = 80/975 (8%)

Query: 278  ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF 337
            A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct: 201  AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF 260

Query: 338  ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY 397
            I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct: 261  IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY 320

Query: 398  VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH 457
             FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct: 321  AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC 380

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS---- 513
            GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct: 381  GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN 440

Query: 514  ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI 569
                +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct: 441  NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC 500

Query: 570  QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXX 629
            Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+                     
Sbjct: 501  QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE 560

Query: 630  XXXXXDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV 688
                 DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct: 561  TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV 616

Query: 689  LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN 748
            L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct: 617  LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN 676

Query: 749  TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS 808
             L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct: 677  VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC 733

Query: 809  DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY 868
            D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct: 734  DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL 789

Query: 869  GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI 916
                     C++ + P     KNL F+ +    D+ ND   + +LY         E  E 
Sbjct: 790  KVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDT------IEINEE 843

Query: 917  ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN 976
            I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct: 844  IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN 898

Query: 977  IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL 1036
            +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct: 899  VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY 943

Query: 1037 NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA 1096
            NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct: 944  NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA 998

Query: 1097 ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK 1156
            ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct: 999  ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR 1058

Query: 1157 FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF 1214
            F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct: 1059 FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF 1103

Query: 1215 AICRELGRETGVCTN 1229
            ++  +LG  +G+CTN
Sbjct: 1104 SLGSKLGINSGLCTN 1118

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 56/114 (49%), Gaps = 15/114 (13%)

Query: 1   MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL 59
           M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct: 32  MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS 81

Query: 60  DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT 112
             S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct: 82  QISAQNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT 132

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/990 (46%), Positives = 619/990 (62%), Gaps = 76/990 (7%)

Query: 280  SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
            S Q LV+KLQ+IYK+IVKQE ELQERC  LT  QTT+LKNLW  Y++N+EL+DNYI FIT
Sbjct: 380  SSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFIT 439

Query: 340  TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
            TA+ P+Q ES   IG+EI+++Y+IERRLWVYGTITFLD+LKNFSNFMDPEVCCQFI +VF
Sbjct: 440  TAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVF 499

Query: 400  IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            I++SNML D+P KY + W ++LGDLSRMAIALYPS F+DWKLSAE WY  +++FT+GHGK
Sbjct: 500  ISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGK 559

Query: 460  LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH 519
            LYYHMSTVQQNTLEAFVNLGKS+FC++ FVPS QY+QLVI NIYQRA+A+ ++S N  N 
Sbjct: 560  LYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRND 619

Query: 520  --IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGV---SSSGNFFDPNLIFIQDAER 574
              +VDY+KH EV LLP+F ES ELQ VV+ YF  KFGV   +SS N F    +F+Q+ ++
Sbjct: 620  QLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNNDQ 679

Query: 575  LKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXXXXXXX 634
             K F+R+S+ F++S ILQ+ G+G+ K+PF++LFE                          
Sbjct: 680  FKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKIT 739

Query: 635  DPVEF------------SSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSM 682
             P  +            ++    + E+FF  ID+   P   P  + +W  SL Y N  S+
Sbjct: 740  QPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSI 799

Query: 683  KCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDS 742
            KC MIV ++FL+ P + ALPH LPW  FIISI ++LD+  ++ + +FW+ F+RRIFPW+S
Sbjct: 800  KCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNS 859

Query: 743  LITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFN 802
            ++ F+N L+ Y +    +   ++     Y  M+ +ELLT   ENE LPE W C GSLWF+
Sbjct: 860  IVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFD 919

Query: 803  TISKK--------------SDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQR 848
            TI +K              SD ++   +  G+ D  F D P +G  FD+ DE G ++W+R
Sbjct: 920  TIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKR 979

Query: 849  ICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENES 908
              R + LF  + E       G G   L+ EA  +      +  +T  Q  +E   + N S
Sbjct: 980  AARVIFLFKKLAE----SYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNAS 1035

Query: 909  FP-------FEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDL 961
                      E FE    +N  D  +    SM+ G SI +  G+K + P+++ F+KNGD 
Sbjct: 1036 SDGVMLDDIIESFETPDEVNY-DTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDF 1094

Query: 962  ITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFM--- 1018
            I+ S +    ++    +   +   + I D+   +       S+A      P  E  +   
Sbjct: 1095 ISTSFFNSWSIKNLTNELSRN-TCSSITDDA--ISSGSGNDSAAASTNNDPMNELLVFNE 1151

Query: 1019 --NPDFRQRELLNRSFLGNLNCQADTNV-----TFFVLDATTWLRHFAHIYKLATSSVLK 1071
              +P ++  E     +   +   + TN+     T+F+LDAT+WLRHFAHIYK+ATS +LK
Sbjct: 1152 CFDPKYKTLEEF---WSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILK 1208

Query: 1072 FAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLE 1131
            FAICLTTFQELR+LRKSKD +V+EAATRA+I +RQLY+E  LL LRFTGNVA H+EEHLE
Sbjct: 1209 FAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLE 1268

Query: 1132 IEEQMTWKSHVDEFVIDAIAKAQ----DKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFV 1187
             EEQ+TW+SHVDEFVI+A+ KA+    D+ N +N D  EK K                 +
Sbjct: 1269 FEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFG-------------I 1315

Query: 1188 SLVTDDFNMRNKAQQLGIRTFSTRFVFAIC 1217
             LVTDD  M+NKA    I+TFSTRF+F++ 
Sbjct: 1316 ILVTDDITMKNKAMDRKIKTFSTRFIFSMA 1345

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/977 (46%), Positives = 632/977 (64%), Gaps = 84/977 (8%)

Query: 278  ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF 337
            A   Q  ++KLQEIY+ IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct: 201  AQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINF 260

Query: 338  ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY 397
            I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct: 261  IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY 320

Query: 398  VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH 457
             FI++S+MLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct: 321  AFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC 380

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSG--- 514
            GKLYYH++TVQQN+LEAFVNLGKSVFC+D+F PS Q +QL+I+NIYQ AF +R S+G   
Sbjct: 381  GKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNN 440

Query: 515  ----NRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI 569
                +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct: 441  NETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFC 500

Query: 570  QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXX 629
            Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+                     
Sbjct: 501  QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGATE 560

Query: 630  XXXXXDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV 688
                 DP +     Q S+E +F  IDS    + + P +L +W  SL++IN+TS++C + V
Sbjct: 561  VPQYRDPFD----DQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHV 616

Query: 689  LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN 748
            L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++   N
Sbjct: 617  LTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLAN 676

Query: 749  TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS 808
             L+ Y M+     F ++  +  +  +  ++L+    ENENLPE W CWGSLWF+ I KK 
Sbjct: 677  VLVCY-MLDNIHPF-LERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAI-KKC 733

Query: 809  DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY 868
            D+    +E  G+ D LF DSP +GI FD+ DE G ++W R  RT+L+   + +     G 
Sbjct: 734  DV----MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLGL 789

Query: 869  GHG------CKK--LNPEATSWKNLVFRFND----DTNDQLSV-ELYP--EENESFPFEK 913
                     C++  ++P+    KN  F+ ++    D ND   + ELY   E N     EK
Sbjct: 790  KVNFQAPVFCRRNDISPDYF-LKNFTFKLDEYEENDHNDNNELDELYDTIEIN-----EK 843

Query: 914  FEIIS-NLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPL 972
             E ++ +L  + NL     S++ G +I    G+  + PDY CF+KNG   +A +Y++   
Sbjct: 844  IERVNRDLRATPNL-----SVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQW-- 896

Query: 973  ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSF 1032
              +N+  G       +LD     V     Y +A + L   W + F    F +      + 
Sbjct: 897  --SNVGNG------MVLD-----VSSESMYDAANNNLSPHWEKIF----FDRITTAGHNG 939

Query: 1033 LGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDES 1092
              N NC       +FV+DAT+WLRHFAHI+KLA +++LKFAICLTTFQELR+LR SKD++
Sbjct: 940  DKNGNCSV-----YFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDN 994

Query: 1093 VLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAK 1152
            V+EAATR+VI +RQLY E+K++ LRFTGN+A ++EE+LE EEQ+TW++HVDEFVIDAIAK
Sbjct: 995  VVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAK 1054

Query: 1153 AQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRF 1212
                F       I+K K+           +   +  LVTDD NM  KA+   I+T +T++
Sbjct: 1055 LNQNFQT--ERLIDKNKN-----------KNNAYAVLVTDDDNMDGKAKDKMIKTCNTKY 1101

Query: 1213 VFAICRELGRETGVCTN 1229
            +F++  ++G  +G+CTN
Sbjct: 1102 LFSLGSKIGINSGLCTN 1118

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 67/140 (47%), Gaps = 15/140 (10%)

Query: 14  LHQKRHNSNS-VDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIRH 72
           LHQKRH+S+S  D  +S+ +KRR   GV E V         +       S+  +PSK   
Sbjct: 40  LHQKRHSSSSHNDTPESSFVKRRVP-GVVEPVGKGFI----DGIASGQVSVQNTPSKTDD 94

Query: 73  HEKTPSITKPHTLQMEQTPQPRGVDTSG-EFPQSPFYLPTTSQT-NFEAAT----TVNEN 126
             + PSI++     ME TP+      S  + P+SP+Y+  ++ T N E  +      N  
Sbjct: 95  ISRRPSISRK---AMETTPKVNTASISTIDVPKSPYYMNKSAITRNMEVVSRGNYAENTT 151

Query: 127 SSIRRSDSVTRLTTVGNNTQ 146
           S +R  +S+     + +N+Q
Sbjct: 152 SQMRTDESMATSNGIYSNSQ 171

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/977 (46%), Positives = 613/977 (62%), Gaps = 84/977 (8%)

Query: 278  ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF 337
            A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct: 201  AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF 260

Query: 338  ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY 397
            I TALL +Q  + L +GQEI+D+Y +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct: 261  IITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY 320

Query: 398  VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH 457
             FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct: 321  AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC 380

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSG--- 514
            GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R SSG   
Sbjct: 381  GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNN 440

Query: 515  NRTNH----IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI 569
            N T H    ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF++KFG   +GN  FD   +F 
Sbjct: 441  NETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFC 500

Query: 570  QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFEXXXXXXXXXXXXXXXXXXXXX 629
            Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+                     
Sbjct: 501  QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSSATE 560

Query: 630  XXXXXDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV 688
                 DP       + S E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct: 561  TPQYRDPF----HDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHV 616

Query: 689  LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN 748
            L +FL+ P V ALPH L WL F+++I  RL+ +N   +  FWI F+RR  PW+S+++  N
Sbjct: 617  LTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLAN 676

Query: 749  TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS 808
             L+ Y M+     F +   + ++     ++L+    ENENLPE W CWGSLWF+ I KK 
Sbjct: 677  VLVCY-MLDNLHPF-LKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAI-KKC 733

Query: 809  DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY 868
            D+    +E  G+ D LF DSP +GI FD+ DE G ++W R  R + L   I +      +
Sbjct: 734  DV----MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAK-----KF 784

Query: 869  GHGCKKLNPEATSWKNLVFRFNDDTND------QLSVELYPE------ENESFPFEKFEI 916
                 K+N +A     +  R ND   D         ++ Y E            +E  EI
Sbjct: 785  PDLGLKVNFQAP----VFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEI 840

Query: 917  ---ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLE 973
               I N+N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++    
Sbjct: 841  NEKIDNVNL-DLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW--- 896

Query: 974  TANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFL 1033
             +N+  G   +           V +   Y    + L   W + F           +R   
Sbjct: 897  -SNVGNGVPID-----------VSNEPIYDVTDNDLSLHWEKIF----------FDRIAA 934

Query: 1034 GNLNCQADTNVT-FFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDES 1092
               NC  + N T +FV+DAT+WLRHFAHI+KLA +S+L FAICLTTFQELR+LR SKD++
Sbjct: 935  AYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDN 994

Query: 1093 VLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAK 1152
            V+EAATR+VI +RQLY ERK++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK
Sbjct: 995  VVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAK 1054

Query: 1153 AQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRF 1212
                F      A  K K+               F  LVTDD NM  KA+   I+T +T++
Sbjct: 1055 LNQNFQTERMIAENKNKNK-------------QFAVLVTDDDNMNKKAKDKMIKTCNTKY 1101

Query: 1213 VFAICRELGRETGVCTN 1229
            +F++  +LG  +G+CTN
Sbjct: 1102 LFSLGSKLGINSGLCTN 1118

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 67/143 (46%), Gaps = 15/143 (10%)

Query: 14  LHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIRH 72
           LHQKRH+S+S  D  +S+  KRR   GV E V         +       S   +PSK+  
Sbjct: 40  LHQKRHSSSSHNDTPESSFAKRRVP-GVVEPVGKGFI----DGVTNGQISAQNTPSKVDD 94

Query: 73  HEKTPSITKPHTLQMEQTPQPRGVDTSG-EFPQSPFYLPTTS-QTNFEAATT----VNEN 126
             + PSI++     ME TPQ +    S  + P+SP+Y+  T+   N E  +      N N
Sbjct: 95  VSRRPSISRK---VMESTPQAKTASISTMDVPKSPYYVNRTAVARNMEVVSKESYDENAN 151

Query: 127 SSIRRSDSVTRLTTVGNNTQLAS 149
             +R  +S+     + NN+Q  S
Sbjct: 152 PQMRIDESLVASNGIYNNSQPQS 174

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1319

 Score =  488 bits (1256), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 241/347 (69%), Positives = 283/347 (81%), Gaps = 20/347 (5%)

Query: 282 QQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTA 341
           + LV KLQ+IYK IVKQE ELQERCS LTT QTTDLKNLW  YK+N +LI+NY+ FITTA
Sbjct: 298 EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357

Query: 342 LLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIA 401
           LL SQS+  L IG+EI+++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VFI+
Sbjct: 358 LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417

Query: 402 LSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLY 461
           LS ML D+P KYSIPWL+RLGDLSRMAIALYPSGF+DWKLSAE WY E++KFT+ HGKLY
Sbjct: 418 LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477

Query: 462 YHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIV 521
           YHMSTVQQNTLEAFVNLGKSVFC++ F PS QYMQLVIDNIYQRAF ER++  NR   ++
Sbjct: 478 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537

Query: 522 DYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGV--------------------SSSGNF 561
           +YLKH+EVMLLP+FLE+SELQ VV+ YFQ KFG+                    + + + 
Sbjct: 538 EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM 597

Query: 562 FDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFE 608
           F    +FIQ+ E+LK+FFRH+  F++SHILQL GFGDPKNPFA+LFE
Sbjct: 598 FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFE 644

 Score =  418 bits (1075), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 246/635 (38%), Positives = 358/635 (56%), Gaps = 69/635 (10%)

Query: 644  QASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPH 703
            Q ++E+FF  I+  +  Y  P  L +W  SL++IN+ S+KC MIVL++FL+GP++ ALPH
Sbjct: 705  QVTSEEFFQNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPH 764

Query: 704  VLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCM-------- 755
            +LPW  FIISI ++ + +     K FWI  ++ IFPW+ +I F+N L+ Y +        
Sbjct: 765  LLPWCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTP 824

Query: 756  --VTGTKNFDIDAHM----STYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSD 809
              V  TK  D++  +    + Y  M   +LL    ENE+LPE W CWG+LWF+TIS K+ 
Sbjct: 825  SAVNDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNG 884

Query: 810  LDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDG-- 867
            +D  + E+ G+ D +FLD P +GI +  +DE G  +W+R  R + LF  I E     G  
Sbjct: 885  MDADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLK 944

Query: 868  --YGHGCKKLN---PEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISN--- 919
              Y  G +  N   P     K   F++     D +   L  E          EI +N   
Sbjct: 945  VSYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDE---------LEIYTNTII 995

Query: 920  ------LNCSDNLQDGS--------KSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITAS 965
                  ++  + + + +        KSMI    I +  G+K + P+   F+KNG+  + S
Sbjct: 996  NRITEFVDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGS 1055

Query: 966  LYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQR 1025
            +YT  P++   +    + N N    +    + D    + +ID+L          P+FR +
Sbjct: 1056 IYTAWPMDYDQLILAQNNNNNTNATDE---MTDLFTGTLSIDELS---FRQLKRPEFRDK 1109

Query: 1026 ELLNRSFLGNLNCQA-DTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRF 1084
              L    L + + +  +   T+FV DAT+WLRHFAHIYKLA++ VLKFA+CLTTFQELRF
Sbjct: 1110 STL----LSSTSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRF 1165

Query: 1085 LRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDE 1144
            LRKSKD +V+EA+TRA+I +RQLY +  LL LRFTGNVA  +EEHLE EEQ+TW+SHVDE
Sbjct: 1166 LRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDE 1225

Query: 1145 FVIDAIAKAQDKF----------NVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDF 1194
            FVI+A+ KAQ+KF             N   I+     +  +E+ + +  F +V L+TDD 
Sbjct: 1226 FVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDATTTTVS-AEEEEKSNLFKYVVLITDDD 1284

Query: 1195 NMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN 1229
            +MR KAQ  GI TF T+ VF++C  +G + GVCTN
Sbjct: 1285 SMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVCTN 1319

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 55/117 (47%), Gaps = 24/117 (20%)

Query: 11  HSGLHQKRHNSNSVDYYDSN-IIKRRTGDGVPENVDISVAEIPQEPCQYLDT----SLLT 65
              + QKRH+SNS     +N  +KRR     PE V +          +Y+D     +  T
Sbjct: 49  QENIRQKRHSSNSYSNAKNNPAVKRRIAK--PEEVSL----------KYIDNMEYGTATT 96

Query: 66  SPSKIRHHEKTPS---ITKPHTL---QMEQTPQPRGVDTSGEFPQSPFYLPTTSQTN 116
             + I   ++TPS   +++  +L   QM  TPQP     S E P SPFYLP  S +N
Sbjct: 97  GNNSIICQQQTPSKGTLSRRPSLIKKQMNSTPQPMSYVVS-EVPASPFYLPANSFSN 152

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  473 bits (1217), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 241/374 (64%), Positives = 286/374 (76%), Gaps = 44/374 (11%)

Query: 279 SSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFI 338
           +S Q L++KLQ+IYK IVKQE +LQ+RCS LTT QTTDLKNLW  YKIN +LI+NYI FI
Sbjct: 393 TSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFI 452

Query: 339 TTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYV 398
           T ALLP+QS++ L IG+EI+++YRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI++V
Sbjct: 453 TNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHV 512

Query: 399 FIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHG 458
           FIA+S +L D+P KYSI WL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HG
Sbjct: 513 FIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHG 572

Query: 459 KLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTN 518
           KLYYHMSTVQQNTLEAFVNLGKSVFC++ F PS QYMQLVIDNIYQRAF ER++  +R  
Sbjct: 573 KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNL 632

Query: 519 HIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG------------------- 559
            +++YLKHTEVMLLP+FLES +LQNVV+ YFQ KFG+  S                    
Sbjct: 633 QLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNI 692

Query: 560 -------------------------NFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLC 594
                                    + F    +FIQ+ + LK+FFRHS  F+QSHILQL 
Sbjct: 693 PYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLV 752

Query: 595 GFGDPKNPFAMLFE 608
           GFGDPKNPFA+LFE
Sbjct: 753 GFGDPKNPFALLFE 766

 Score =  319 bits (817), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 203/584 (34%), Positives = 305/584 (52%), Gaps = 80/584 (13%)

Query: 648  EDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPW 707
            E+FF  ID  + PY+ P  + +W  SL  IN+ S+KC +IVL++FL GPI+ ALPH+L W
Sbjct: 866  EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925

Query: 708  LLFIISIQIRLDQ-VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCM-VTGTKNFDID 765
            + FIISI ++++  + D   K FW  F++ I PW+S++ F+N L+ Y +     +NF + 
Sbjct: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985

Query: 766  AHMST-YLPMNRE---ELLTSICENENLPECWSCWGSLWFNTISKKS------------- 808
              +S  Y  M+     E+L    +NENLPE W CWG+LWF+ I  K+             
Sbjct: 986  ISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNN 1045

Query: 809  ------------------DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRIC 850
                              D D  TL + G+ D   LD P +GI F  +DE G  +++R  
Sbjct: 1046 NTTTTTKNNGEDILNDNYDTD-KTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104

Query: 851  RTLLLFNIITE------WEACDGYGHGCKKLN-PEATSWKNLVFRFNDDTNDQLSVELYP 903
            R + L   + E       +      + C+    P+     N  F+  +  +  L +   P
Sbjct: 1105 RLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLII--IP 1162

Query: 904  -----------------EENESFP------FEKFEIISNLNCSDNLQDGSKSMIPGVSIE 940
                             E N+S        F+  E I  +N +  LQ     +    +I 
Sbjct: 1163 QTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIF 1222

Query: 941  NLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQ-------GGDDFNANKILDNGR 993
            N  G+K +  +   F++NG++I+ S+Y+  P++    +         +    +  + N  
Sbjct: 1223 NYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNEN 1282

Query: 994  LVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATT 1053
            + V D     ++  +  +      ++      +  N   +G      + + TFFV DAT+
Sbjct: 1283 VTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMG---VSINKHRTFFVFDATS 1339

Query: 1054 WLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKL 1113
            WLRHFAHIYKL+ +  LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+I +RQLY E KL
Sbjct: 1340 WLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKL 1399

Query: 1114 LALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKF 1157
            L LRFTGNVA  +EEHLE EEQ+TW+SHVDEFVI+AI ++Q++F
Sbjct: 1400 LPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  417 bits (1072), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/406 (51%), Positives = 270/406 (66%), Gaps = 77/406 (18%)

Query: 280 SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT 339
           S Q L++KLQ IYK IV QE ELQ++C+ L+T Q+T LK LW  YK+N +LI+NYILFI 
Sbjct: 265 SNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFIL 324

Query: 340 TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF 399
           T+L PSQS +   IG+EI+++Y+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFI +VF
Sbjct: 325 TSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVF 384

Query: 400 IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK 459
            ++SNM+ DLP  +  PW +RLGDLSRMAIALYPS F+DWKLS+E+WY ES+KFTF HGK
Sbjct: 385 ESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGK 444

Query: 460 LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERD-------- 511
           LYYH+STVQQN LEAFVNLGKSVFC D F+PS +YMQLVIDNIYQRAF ER+        
Sbjct: 445 LYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSNN 504

Query: 512 ---------------SSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFG-V 555
                          +   +   +++YLKH+EVMLLP+FLE+  L+ VV++YF + FG +
Sbjct: 505 AGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKI 564

Query: 556 SSSGNFFDP--------------------------------------------------- 564
           +   N  DP                                                   
Sbjct: 565 AIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLFN 624

Query: 565 --NLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFE 608
             N+   ++++ LK+FF++S+ F++SHILQL GFGDPKNPFA+LF+
Sbjct: 625 FRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQ 670

 Score =  237 bits (604), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 150/344 (43%), Positives = 208/344 (60%), Gaps = 44/344 (12%)

Query: 910  PFEKFEII-SNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYT 968
            PFEK  I  ++LNC   L     S+I   S+   +G+K   PD+  F+KNG+LI+ SLYT
Sbjct: 1149 PFEKNSIQNTDLNCEPGL-----SLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYT 1203

Query: 969  KGPLET-------ANI-----QGGDDFNANKILDNGRLVVQDRLEYSSAIDK-----LEQ 1011
               ++T       ANI        D+ N +     G    ++    ++ ID      +E+
Sbjct: 1204 STIIDTINGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEK 1263

Query: 1012 PWLEAFMNPDFRQRELLNRSFLGNLNCQADTNV----TFFVLDATTWLRHFAHIYKLATS 1067
                  ++PD++  + + R  + +     DT++    T+FVLDAT+WLRHFAH+YKLAT+
Sbjct: 1264 EIFNKILDPDYKNIDEIWRGEMFH-----DTSIQFSDTYFVLDATSWLRHFAHVYKLATN 1318

Query: 1068 SVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLE 1127
             +LKFAICLTTFQELRFLRKSKDE+V+EAATRA+I +RQLY E++LL LRFTGN+A H+E
Sbjct: 1319 GILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIE 1378

Query: 1128 EHLEIEEQMTWKSHVDEFVIDAIAKAQ----DKFNVLNNDAIEKGKDCIPLSEDGQSTQR 1183
            EHLE EEQ+TW+SHVDEFVI+AI +AQ    D  N  +++      + I  + +      
Sbjct: 1379 EHLEFEEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLN 1438

Query: 1184 FN---FVSLVTDDFNMRNKAQQL----GIRTFSTRFVFAICREL 1220
                 FV LVTDD +M  K Q+      I TFST+FVF++C  L
Sbjct: 1439 VTDMIFV-LVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  182 bits (463), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 143/227 (62%), Gaps = 6/227 (2%)

Query: 646  STEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVL 705
            S +DFF+ ++S K+ +  P  L +W  SL YIN+ S+ C +IVL++FL GP+  +LPH+L
Sbjct: 787  SPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHML 846

Query: 706  PWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDID 765
            PW  FIIS+ +R++ + ++  + FW+ FIR+IFPW+S+++++N +I   +    +N  I 
Sbjct: 847  PWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMIT 906

Query: 766  AHMSTYLPMNREELLTSICENE-NLPECWSCWGSLWFNTISKKSDL-DVTTLESTGLSDT 823
              ++ Y   N +ELL    ENE  LPE W C+GSLWF+ I++   +      ++  + DT
Sbjct: 907  KLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDT 966

Query: 824  LFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFN-IITEWEACDGYG 869
              L+ P +G+ FD+ +E G  +W+R CR + LF  +IT +   +G+G
Sbjct: 967  KCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRF---NGFG 1010

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  135 bits (340), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 189/871 (21%), Positives = 344/871 (39%), Gaps = 161/871 (18%)

Query: 288  LQEIYKSIVKQETELQERCSN---LTTQQTTDLKNLWLA--YKINAELIDNYILFITTAL 342
            L  ++ SI + ET ++   S+   L      D+ N +L   +K++ +++  Y  FI  AL
Sbjct: 107  LLPLFMSIERAETSIETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIAL 166

Query: 343  LPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCC 392
              + ++  L  G+E V   R+  RL  +     L++++N+ N M          + +   
Sbjct: 167  NINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNII 226

Query: 393  QFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR---- 448
            +FI    I +++MLE++P K+   W   +GDL+R+ + L       ++L++ H Y     
Sbjct: 227  EFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAP 286

Query: 449  -ESLKFTFGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQL 497
              ++ ++  +GK           Y+++S VQ ++L   V L K +  E+  V      QL
Sbjct: 287  VVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQL 346

Query: 498  VIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLL----PSFLESSELQNVVIHYFQHKF 553
             ID I  +   ++ +           +K+  ++ L     S  + S ++   +HYF ++F
Sbjct: 347  AIDKIISKLLNKQVNLKQSMGGTTILMKYFTLLSLFFGSTSSSQLSGMERSSLHYFWNEF 406

Query: 554  GVSSSGNFFD----PNLIFIQDAERLKHF-FRHSSLFSQSHILQLCGFGDPKNPFAMLFE 608
                  N+       N  + Q       F F ++ LFS   I++        NPF  +++
Sbjct: 407  ANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYK 466

Query: 609  XXXXXXXXXXXXXXXXXXXXXXXXXXDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLG 668
                                                 S++DF   I S        + L 
Sbjct: 467  -------------------------------------SSDDF--EIKS--------VSLS 479

Query: 669  VWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKK 728
             WK  +  ++ T +    ++ ++FL   +  + P +LPWLLF IS+   +  V D  +  
Sbjct: 480  NWKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLL 539

Query: 729  FWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENEN 788
             W   ++ + PWD ++T++N  I         +  + A +      +  +LL  +    N
Sbjct: 540  LWKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESN 599

Query: 789  LPECWSCWGSLWFNTI-SKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQ 847
              E   C G +WF+++ SK     +TT ES  L      ++  + + +DDDD+   K W 
Sbjct: 600  FQEISMCEGFIWFDSLASKIKQASITTNES--LMKFKSYNASEDSLIYDDDDQVYTKMWT 657

Query: 848  RICRTLLLF-NIITEW-EACDGYGHGCKKLNPEATSWKNLVFRFNDD--TNDQLSVELYP 903
            R    +LL  N+I ++ E  D    G    N             N D  TND L      
Sbjct: 658  RALLIILLIKNVINDYPELIDVSIRGQSLTNSSCIK--------NSDSLTNDYLF----- 704

Query: 904  EENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMY-PDYFCFNKNGDLI 962
                 + FE             L + +  +I        + FK  Y PD+  F+KNGD+ 
Sbjct: 705  ----DWGFE-------------LNNNNAVIIDDTLHGRNRIFKFSYIPDFQDFDKNGDIT 747

Query: 963  TASLYTKGPLETANIQGGDDFNA----NKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFM 1018
                +    +   +    +DFN+    N      R ++    +YS    K   P LE   
Sbjct: 748  ----WGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLEN-- 801

Query: 1019 NPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTT 1078
                                       +F++D   WL+H   + +      +K  + ++ 
Sbjct: 802  --------------------------NYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSI 835

Query: 1079 FQELRFLRK-SKDESVLEAATRAVIAVRQLY 1108
              +L  L+  S+ ESV  +A+R +I +  LY
Sbjct: 836  LNDLNELKNYSEHESVRSSASRVMIVINYLY 866

>KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.486
           YDR253C
          Length = 202

 Score = 33.5 bits (75), Expect = 1.9,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 6   ASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQE--PCQYLDTSL 63
           +S+    G+    H  NS D   S  I  + G  V  N+  + A+   E  PC   +   
Sbjct: 72  SSLDDSHGIPGGVHKENSTDS-TSTAITDKNGSIVANNLAYAGAQDSGEKYPCAQCELEF 130

Query: 64  LTSPSKIRHHEKTPSITKPH 83
           L  P  +R HEK  SI  PH
Sbjct: 131 L-RPGDLRRHEKAHSIASPH 149

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 129,489,349
Number of extensions: 5989214
Number of successful extensions: 27216
Number of sequences better than 10.0: 231
Number of HSP's gapped: 27363
Number of HSP's successfully gapped: 308
Length of query: 1229
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1108
Effective length of database: 39,606,813
Effective search space: 43884348804
Effective search space used: 43884348804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)