Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00506g5.707ON1791798581e-119
YIR006C (PAN1)7.160ON148033691.8
CAGL0A03828g8.774ON47621637.3
Smik_16.3883.479ON729112638.7
Kwal_33.147482.149ON427111629.5
NOTE: 17 genes in the same pillar as KLLA0A00506g were not hit in these BLAST results
LIST: Kpol_1043.74 ZYRO0B16434g Skud_9.16 Smik_9.17 YIL152W NCAS0G00210 TBLA0I01690 KAFR0D02200 Suva_9.36 KLTH0E00946g Kwal_55.19675 TDEL0B02130 KNAG0L02160 TPHA0E00180 NDAI0F00270 Cgla_YGOB_Anc_5.707 SAKL0E15026g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00506g
         (179 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00506g Chr1 (43949..44488) [540 bp, 179 aa] {ON} no simila...   335   e-119
YIR006C Chr9 complement(365466..369908) [4443 bp, 1480 aa] {ON} ...    31   1.8  
CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} simila...    29   7.3  
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...    29   8.7  
Kwal_33.14748 s33 (804246..805529) [1284 bp, 427 aa] {ON} YHR118...    28   9.5  

>KLLA0A00506g Chr1 (43949..44488) [540 bp, 179 aa] {ON} no
           similarity
          Length = 179

 Score =  335 bits (858), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 164/179 (91%), Positives = 164/179 (91%)

Query: 1   MTDTKGRTKIGEVSELVDAWFGKKRKLLYAHKKCNASNIGGKGSINKLIQTSKSVVRARA 60
           MTDTKGRTKIGEVSELVDAWFGKKRKLLYAHKKCNASNIGGKGSINKLIQTSKSVVRARA
Sbjct: 1   MTDTKGRTKIGEVSELVDAWFGKKRKLLYAHKKCNASNIGGKGSINKLIQTSKSVVRARA 60

Query: 61  SKRQKTYTAPMAASIIPKADFSNDISHSPRTVQAIVFDSSTKIRLMKEHHSDADWLRLVV 120
           SKRQKTYTAPMAASIIPKADFSNDISHSPRTVQAIVFDSSTKIRLMKEHHSDADWLRLVV
Sbjct: 61  SKRQKTYTAPMAASIIPKADFSNDISHSPRTVQAIVFDSSTKIRLMKEHHSDADWLRLVV 120

Query: 121 RQXXXXXXXXXXXXXXXPKFSTVILQGLCSSNVHHVLCHDVSFFSLYRGVFWCLNWKLG 179
           RQ               PKFSTVILQGLCSSNVHHVLCHDVSFFSLYRGVFWCLNWKLG
Sbjct: 121 RQHHKLNDKLTLLKTDHPKFSTVILQGLCSSNVHHVLCHDVSFFSLYRGVFWCLNWKLG 179

>YIR006C Chr9 complement(365466..369908) [4443 bp, 1480 aa] {ON}
            PAN1Part of actin cytoskeleton-regulatory complex
            Pan1p-Sla1p-End3p, associates with actin patches on the
            cell cortex; promotes protein-protein interactions
            essential for endocytosis; binds to and activates the
            Arp2/3 complex in vitro; previously thought to be a
            subunit of poly(A) ribonuclease
          Length = 1480

 Score = 31.2 bits (69), Expect = 1.8,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 70   PMAASIIPKADFSNDISHSPRTVQAIVFDSSTK 102
            P AA + P A FS + +++PR+V A V  ++ K
Sbjct: 1198 PQAAPVAPSAAFSQNSTNAPRSVHAAVTPAAGK 1230

>CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301w RAX1
          Length = 476

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 9/21 (42%), Positives = 17/21 (80%)

Query: 15  ELVDAWFGKKRKLLYAHKKCN 35
           +++ +WFG  ++L+Y+HKK N
Sbjct: 385 DIIYSWFGLTQRLMYSHKKGN 405

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 28.9 bits (63), Expect = 8.7,   Method: Composition-based stats.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 12/112 (10%)

Query: 9   KIGEVSELVDAWFGKKRKLLYAH----KKCNASNIGGKGSINKLIQTSKSVVRARASKRQ 64
           K  E+  + + +  KK+ +   H    K+  ASN   K  + ++    K+ +      + 
Sbjct: 157 KNNELISIKEEFLSKKQYMNEGHEIHLKQLAASN---KKDLKQMENEYKTKIEKLKFMKI 213

Query: 65  KTYTAPMAASIIPKADFSNDISHSPRTVQAIVFDSSTKIRLMKEHHSDADWL 116
           K +    A+ +    +  N I  +P T+Q ++ DS  K+RL KE     +WL
Sbjct: 214 KQFENERASLLDKIEEVRNKIKMNPSTLQEMLNDSEQKLRLEKE-----EWL 260

>Kwal_33.14748 s33 (804246..805529) [1284 bp, 427 aa] {ON} YHR118C
           (ORC6) - 50-kDa subunit of ORC [contig 101] FULL
          Length = 427

 Score = 28.5 bits (62), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 43/111 (38%), Gaps = 20/111 (18%)

Query: 6   GRTKIGEVSELVDAWFGKKRKLLYAHKKCNASNIGGKGSINKLIQTSKSVVRARASKRQK 65
           GR    +  E+    FG   K     K  N +N G        + T+    + RA++R+ 
Sbjct: 129 GRFTAIDPKEMRRQLFGTPTKSKVTPKTINLANSGAPSPA---VTTADEASKIRATRRKL 185

Query: 66  TYTAPMAASIIPKADFSNDISHSPRTVQAIVFDSSTKIRLMKEHHSDADWL 116
           T+        +  A+   D+  +  T QA           M++H +D DW+
Sbjct: 186 TFE-------VEDAEDERDVDMASNTPQAD----------MRDHENDDDWV 219

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.132    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,842,663
Number of extensions: 512330
Number of successful extensions: 1354
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1371
Number of HSP's successfully gapped: 9
Length of query: 179
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 77
Effective length of database: 41,785,467
Effective search space: 3217480959
Effective search space used: 3217480959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)