Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00484g5.708ON54354329450.0
SAKL0E15048g5.708ON54254326560.0
TDEL0B021205.708ON54854925420.0
CAGL0H06633g5.708ON54454425250.0
KNAG0C066405.708ON54753525130.0
NCAS0A031605.708ON55255325110.0
Ecym_40135.708ON54254325060.0
AFR292W5.708ON54154324970.0
YKR097W (PCK1)5.708ON54954924940.0
NDAI0E050805.708ON55155224890.0
KAFR0H001605.708ON54954324840.0
Skud_11.3375.708ON54954924840.0
Smik_11.3615.708ON54954924830.0
KLTH0E00902g5.708ON54454524750.0
Suva_11.3345.708ON54854924730.0
ZYRO0B16456g5.708ON54854924570.0
Kwal_55.196635.708ON54454524290.0
TPHA0E001705.708ON57852122900.0
Kpol_1043.755.708ON55855922740.0
TBLA0E017005.708ON57654722470.0
Suva_7.275singletonON961131544e-12
TDEL0C063501.67ON693129890.032
NDAI0A005601.67ON71469830.18
KLTH0F02024g1.67ON73490770.83
TBLA0G030703.258ON114744761.2
TPHA0J025406.239ON86662723.3
CAGL0E00385g1.67ON60873723.6
Kwal_56.242656.259ON21759695.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00484g
         (543 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...  1139   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...  1027   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   983   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   977   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   972   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   971   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   969   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   966   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   965   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   963   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   961   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   961   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   961   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   957   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   957   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   951   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   940   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   886   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   880   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   870   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    64   4e-12
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...    39   0.032
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...    37   0.18 
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...    34   0.83 
TBLA0G03070 Chr7 complement(812624..816067) [3444 bp, 1147 aa] {...    34   1.2  
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    32   3.3  
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...    32   3.6  
Kwal_56.24265 s56 complement(928206..928859) [654 bp, 217 aa] {O...    31   5.1  

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/543 (100%), Positives = 543/543 (100%)

Query: 1   MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60
           MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD
Sbjct: 1   MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60

Query: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120
           KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG
Sbjct: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180
           WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180

Query: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240
           SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT
Sbjct: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300
           LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300

Query: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360
           KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD
Sbjct: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360

Query: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420
           ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT
Sbjct: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420

Query: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480
           MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF
Sbjct: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480

Query: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540
           NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG
Sbjct: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540

Query: 541 PQL 543
           PQL
Sbjct: 541 PQL 543

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score = 1027 bits (2656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/543 (88%), Positives = 516/543 (95%), Gaps = 1/543 (0%)

Query: 1   MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60
           MSP+KT  SAE+ IR EL LS EVVTIRRNAPAALLYEDALKER T IS++GALIAYSG+
Sbjct: 1   MSPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGE 60

Query: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120
           KTGRSPRDKRIV+E TS DNVWWGPVNK CSERTW+INRERAADYLRTRDH+YIVDAYAG
Sbjct: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180
           WDPRYRIKVRVVCARAYHALFMTNMLIRP+++EL  FGEPDFTVWNAGQFPANTHT+GMT
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180

Query: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240
           SKTTVEINFK+MEM+ILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI DNDVT
Sbjct: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300
           LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKC+GLSAEKEPEI+NAI
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300

Query: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360
           KFGSVLEN+IY+P TREVDYEDS+ITENTRCAYPI+YIPSAKIPCLAD+HP NIVLLTCD
Sbjct: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360

Query: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420
           ASGVLPPVS+LTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LHPMKYAT
Sbjct: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420

Query: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480
           MLAEKMA+HNANAWLINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLAKE+YE LP F
Sbjct: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480

Query: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540
           NL+IP  V + VP+ LLNP+KNW EGEAKYTS V++LA LFVENFKTYQD+AT QVL+AG
Sbjct: 481 NLEIPTRV-NNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAG 539

Query: 541 PQL 543
           PQL
Sbjct: 540 PQL 542

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/549 (83%), Positives = 501/549 (91%), Gaps = 7/549 (1%)

Query: 1   MSPTKTQNSA------EENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54
           MSP+K   S       E+ IR EL LS EV+TIRRNAPAA+LYEDAL E+ T I+++GAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114
           IAYSGDKTGRSP+DKRI+EEETSKDN+WWGPVNKP  E+TW INRERAADYLRTR H+YI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174
           VDA+AGWDPRYRIKVRVVCARAYHALFMTNMLIRP+ EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT GM+SKTTVEINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294
           Q NDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKC+GL+AEKEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354
           EI+NAIKFGS+LEN++YDP TR+VDYEDS+ITENTRCAYPIE+IPSAKIPCLAD HP+N+
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414
           VLLTCDASGVLPP+SKLTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474
           P++YATMLA+KM+EH ANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKE Y
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534
           E LP FNL IP  V + VP  LLNPSKNW EGEAKY + V +LA LFVENFK YQD+AT 
Sbjct: 481 ETLPTFNLHIPTKV-NGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATP 539

Query: 535 QVLAAGPQL 543
           +VLAAGPQ+
Sbjct: 540 EVLAAGPQV 548

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/544 (84%), Positives = 500/544 (91%), Gaps = 4/544 (0%)

Query: 3   PTKTQ---NSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSG 59
           P+K+    NS EE IR+ELGLS EV  IRRNAPAA+LY+DALKE+ T IS+AGALIAYSG
Sbjct: 2   PSKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSG 61

Query: 60  DKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYA 119
           +KTGRSP+DKRIVEEETS+DNVWWGPVNKPCSERTW INRERAADYLRTR+ +Y+VDA+A
Sbjct: 62  EKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFA 121

Query: 120 GWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGM 179
           GWDP+YRIKVRVVCARAYHALFMTNMLIRP++EEL NFGEPDFTVWNAGQFPAN  T  M
Sbjct: 122 GWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDM 181

Query: 180 TSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDV 239
           TSKTT+EINFK MEMVILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSS NQGI++ DV
Sbjct: 182 TSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDV 241

Query: 240 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNA 299
           TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LS EKEPEIF+A
Sbjct: 242 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDA 301

Query: 300 IKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTC 359
           I+FGSVLEN+IYD  + EVDY+DS+ITENTRCAYPI++IPSAKIPCLA  HPKNI+LLTC
Sbjct: 302 IRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTC 361

Query: 360 DASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYA 419
           DASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLSLHPM+YA
Sbjct: 362 DASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYA 421

Query: 420 TMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPI 479
           TMLAEKM EH+ANAWLINTGWTGSSYV+GGKRC LKYTRAILDAIHDGSLAK E+E LPI
Sbjct: 422 TMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPI 481

Query: 480 FNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAA 539
           FNLQ+PKAV + VP+ LLNP++NW+EGEAKY S V  LA LFVENFKTYQDKAT  VLAA
Sbjct: 482 FNLQVPKAV-EGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAA 540

Query: 540 GPQL 543
           GPQL
Sbjct: 541 GPQL 544

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/535 (84%), Positives = 494/535 (92%), Gaps = 1/535 (0%)

Query: 9   SAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGDKTGRSPRD 68
           S E+ IR EL LS EV+TIRRNAPAA+LYEDAL ER T I+++GALIAYSG+KTGRSP+D
Sbjct: 14  SVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKD 73

Query: 69  KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAGWDPRYRIK 128
           KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDH+YIVDA+AGWDP+YRIK
Sbjct: 74  KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIK 133

Query: 129 VRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMTSKTTVEIN 188
           VRVVCARAYHALFMTNMLIRPSKEEL NFGEPDFTVWNAGQFPAN HT  M+SK+T+EIN
Sbjct: 134 VRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEIN 193

Query: 189 FKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVTLFFGLSGT 248
           FK MEMVILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI++ DVTLFFGLSGT
Sbjct: 194 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGT 253

Query: 249 GKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAIKFGSVLEN 308
           GKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LSAEKEPEIF+AI+FGSVLEN
Sbjct: 254 GKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLEN 313

Query: 309 IIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCDASGVLPPV 368
           + YD  + EVDY+DSTITENTRCAYPIEYIPSAKIPCLAD HPKNI+LLTCDASGVLPPV
Sbjct: 314 VAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPV 373

Query: 369 SKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKMAE 428
           +KL+P+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHP++YA MLA KM+E
Sbjct: 374 AKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSE 433

Query: 429 HNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPKAV 488
           H ANA+LINTGWTGSSYV+GGKRCPLKYTRAILDAIHDGSLA+  YE LPIFNL++P AV
Sbjct: 434 HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAV 493

Query: 489 GDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAGPQL 543
            + VP  LLNP+KNWA+GEAKY   V +LA+LFVENFK YQDKAT  VLAAGP L
Sbjct: 494 -NGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/553 (81%), Positives = 502/553 (90%), Gaps = 11/553 (1%)

Query: 1   MSPTKTQNS----------AEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISN 50
           MSP K  +S           E++IR ELGLS +V TIRRNAPAA+LYEDAL ER T I++
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 51  AGALIAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRD 110
           +GALIAYSG KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSE+TW INRERAADYLRTRD
Sbjct: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 111 HIYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQF 170
           H+YIVDA+AGWDP+YRIKVRVVCARAYHA+FMTNMLIRP++EEL  FGEPDFT+WNAGQF
Sbjct: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 171 PANTHTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSA 230
           PAN +T  M+SKTT+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV HN+LTLHSSA
Sbjct: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 231 NQGIQDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSA 290
           NQGIQ+ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LSA
Sbjct: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 291 EKEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHH 350
           EKEPEIFNAIK+GS+LEN+IYD NTR VDY+D++ITENTRCAYPIEYIPSAKIPCLAD H
Sbjct: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 351 PKNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 410
           PKNI+LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 411 LSLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLA 470
           L+LHP++YATMLAEK++ H+A+AWLINTGWTGSSYV GGKRCPLKYTRAILD+IHDGSLA
Sbjct: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 471 KEEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQD 530
           K+ YE LPIFNL +P AV + VP  +LNP+KNW+EGEAKY++ V  L +LFVENFKTYQD
Sbjct: 481 KQSYETLPIFNLSVPTAV-NGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQD 539

Query: 531 KATEQVLAAGPQL 543
           +AT  VLAAGPQ+
Sbjct: 540 RATPDVLAAGPQI 552

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/543 (82%), Positives = 499/543 (91%), Gaps = 1/543 (0%)

Query: 1   MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60
           MSP+K   S EE IR+ELGLS+ V+ IRRNAPAALLYEDAL ER+TAIS+ GALIAYSG+
Sbjct: 1   MSPSKVFQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGE 60

Query: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120
           KTGRSP+DKRIV+E TS + VWWGPVN+  SERTW+INRERA DYLRTR+H+YIVDA+AG
Sbjct: 61  KTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAG 120

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180
           WDPRYRIK+R+VC RAYHALFMTNMLIRP++EEL  FGEPDFTVWNAGQFPANTHT GM+
Sbjct: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180

Query: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240
           SKTTVEINFK MEMVILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQGI   DVT
Sbjct: 181 SKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVT 240

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300
           LFFGLSGTGKTTLSAD HRLLIGDDEHCWSD+GVFNIEGGCYAKC+GLSAEKEPEIFNAI
Sbjct: 241 LFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAI 300

Query: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360
           ++GSVLEN++Y+P +R VDY+DS+ITENTRCAYPIEYIPSAKIPCL++ HP NIVLLTCD
Sbjct: 301 RYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCD 360

Query: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420
           ASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LHPMKYAT
Sbjct: 361 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420

Query: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480
           MLAEKM++HNANAWLINTGWTG+SYV+GGKRCPLKYTRAILDAIH GSLA  +YE LP+F
Sbjct: 421 MLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVF 480

Query: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540
            L IP+AV + VP+ LLNPS+NW EGE KY+  V SLANLFV+NFK YQD+AT++VL AG
Sbjct: 481 GLSIPRAV-EGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAG 539

Query: 541 PQL 543
           PQL
Sbjct: 540 PQL 542

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/543 (82%), Positives = 499/543 (91%), Gaps = 2/543 (0%)

Query: 1   MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60
           MSP+K   + EE IRAELGLS+ V+TIRRNAPAA+LYEDAL ER TAIS+ GALIAYSG+
Sbjct: 1   MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGE 60

Query: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120
           KTGRSP+DKRIV+E TS DN+WWGPVN+  SE+TW INRERAAD+LRTR+H+YIVDAYAG
Sbjct: 61  KTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAG 120

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180
           WDPRYRIK+R+VC RAYHALFMTNMLIRP++EEL  FGEPDFTVWNAGQFPANTHT GM+
Sbjct: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180

Query: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240
           SKTTVEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQG  +NDVT
Sbjct: 181 SKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVT 239

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300
           LFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKC+GLS EKEPEIFNAI
Sbjct: 240 LFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAI 299

Query: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360
           K+GSVLEN++YDP TR VDYEDS+ITENTRCAYPIEYIPSA+IPCL+++HP NIVLLTCD
Sbjct: 300 KYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCD 359

Query: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420
           ASGVLPPVS+LTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LHPMKYAT
Sbjct: 360 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 419

Query: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480
           MLAEKM++HNA+AWLINTGWTGSSY AGGKRCPLKYTRAILD+IHDG+LA+ EYE LP+F
Sbjct: 420 MLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVF 479

Query: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540
            L IPKAV + VPA LLNP+KNW EGE KY S V +LA+ F ENFK YQD+ATE+V+ AG
Sbjct: 480 GLSIPKAV-EGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAG 538

Query: 541 PQL 543
           PQ+
Sbjct: 539 PQI 541

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/549 (81%), Positives = 496/549 (90%), Gaps = 7/549 (1%)

Query: 1   MSPTK------TQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54
           MSP+K      + +  E+ IR EL LS EV TIRRNAPAA+LYED LKE  T IS++GAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114
           IAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRP++EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT  M+SK+T+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294
           Q+ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKC+ LSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354
           EIF+AIKFGSVLEN+IYD  +  VDY+DS+ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414
           +LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474
           P++YATMLA KM++H ANA+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA E Y
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534
           E LPIFNLQ+P  V + VPA LLNP+KNW++GE+KY   V +LANLFV+NFK YQD+AT 
Sbjct: 481 ETLPIFNLQVPTKV-NGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATP 539

Query: 535 QVLAAGPQL 543
            VLAAGPQ 
Sbjct: 540 DVLAAGPQF 548

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/552 (80%), Positives = 499/552 (90%), Gaps = 10/552 (1%)

Query: 1   MSPTKTQNS---------AEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNA 51
           MSP K  N+          E+ IR EL LS +V TIRRNAPAA+LYEDAL ER+T IS+ 
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 52  GALIAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDH 111
           GAL+AYSG+KTGRSPRDKRIVEEETSKD++WWGPVNKPCSERTW INRERAADYLRTRDH
Sbjct: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 112 IYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFP 171
           +YIVDA+AGWDP YRIKVRVVCARAYHALFMTNMLIRP++EEL  FGEPDFTVWNAGQFP
Sbjct: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 172 ANTHTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSAN 231
           AN HT  M+SKTT+EINFK MEMVILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSAN
Sbjct: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 232 QGIQDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAE 291
           QGI++ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LS E
Sbjct: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 292 KEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHP 351
           KEPEIF AIK+GS+LEN+IYDP TR V Y+DST+TENTRCAYPIE+IPSAKIPCLAD HP
Sbjct: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 352 KNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL 411
            NI+LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 412 SLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAK 471
           +LHP++YATMLA+K+++H+ANAWLINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLAK
Sbjct: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 472 EEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDK 531
           +E+E LP+FNLQ+P  V + VP  LLNP+KNWA+GEAKY + V +LA+LFVENFK YQDK
Sbjct: 481 QEFETLPVFNLQVPTNVNN-VPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDK 539

Query: 532 ATEQVLAAGPQL 543
           AT +VLAA P++
Sbjct: 540 ATPEVLAAAPRI 551

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/543 (81%), Positives = 497/543 (91%), Gaps = 2/543 (0%)

Query: 2   SPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALK-ERDTAISNAGALIAYSGD 60
           +P K  N+ E+ IR EL LS+ V TIRRNAP ++LYEDALK E++T IS+ GALIAYSG+
Sbjct: 8   TPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGE 67

Query: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120
           KTGR P+DKRIVEE  SK+++WWGPVNKPCSERTWEINRERAADYLRTR+HIYIVDA+AG
Sbjct: 68  KTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAG 127

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180
           WDP+YRIKVRVVCARAYHALFMTNMLIRP+K+ELENFG+PDFTVWNAGQFPAN HT  M+
Sbjct: 128 WDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMS 187

Query: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240
           SKTT+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSAN+GI+  DVT
Sbjct: 188 SKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVT 247

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300
           LFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LS EKEPEIFN+I
Sbjct: 248 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSI 307

Query: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360
           KFGS+LEN++YDP +REVDY+DS+ITENTRCAYPIE+IPSAKIPC+A+ HPKNI+LLTCD
Sbjct: 308 KFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCD 367

Query: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420
           ASGVLPPVSKLT DQVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFL+LHPMKYAT
Sbjct: 368 ASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYAT 427

Query: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480
           MLAEKM +H ANAWLINTGWTGSSY+AGGKRCPL YTRAILDAIHDGSL KE +E LPIF
Sbjct: 428 MLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIF 487

Query: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540
           NL++PK V + VP  LLNPSKNW EGE KY+  VK L+ LF+ENFKTY+DKAT++VLAAG
Sbjct: 488 NLKVPKNVNN-VPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAG 546

Query: 541 PQL 543
           P+L
Sbjct: 547 PRL 549

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/549 (81%), Positives = 495/549 (90%), Gaps = 7/549 (1%)

Query: 1   MSPTK------TQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54
           MSP+K      + +  E+ IR EL LS EV TIRRNAPAA+LYED LKE+ T IS++GAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114
           IAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRP++EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT  M+SK+T+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294
           Q+ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKC+ LSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354
           EIF+AIKFG+VLEN+ YD  +  VDY+DS+ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414
           +LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474
           P++YATMLA KM+ H +NA+LINTGW+GSSYV+GGKRCPLKYTRAILD+IHDGSLA E Y
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534
           E LPIFNLQ+P  V   VPA LLNP+KNW++GEAKY  +V +LANLFVENFK YQD+AT 
Sbjct: 481 ESLPIFNLQVPTKV-KGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATP 539

Query: 535 QVLAAGPQL 543
            VLAAGPQ 
Sbjct: 540 DVLAAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/549 (81%), Positives = 493/549 (89%), Gaps = 7/549 (1%)

Query: 1   MSPTK------TQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54
           MSP+K      + +  E+ IR EL LS EV TIRRNAPAA+LYED LKE+ T IS++GAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114
           IAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRP++EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT  M+SK+T+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294
           Q+ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKC+ LSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354
           EIF+AIKFG+VLEN+ YD  +  VDY+DS+ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414
           +LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474
           P++YATMLA KM++H ANA+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA E Y
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534
           E LPIFNLQ+P  V   VPA LLNP+KNW++GE KY   V SLA LFVENFK YQD+AT 
Sbjct: 481 ESLPIFNLQVPTKV-KGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATP 539

Query: 535 QVLAAGPQL 543
            VLAAGPQ 
Sbjct: 540 DVLAAGPQF 548

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/545 (82%), Positives = 493/545 (90%), Gaps = 3/545 (0%)

Query: 1   MSPTKTQN--SAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYS 58
           MSPTKT+N  SA+++IR EL L  EVVTIRRNAPAALLYEDALKE  T I+++GALIA+S
Sbjct: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60

Query: 59  GDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAY 118
           G KTGRSP+DKRIV+E TS  N+WWGPVNK CSE+TW +NRERAADYLRTRDH+YIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120

Query: 119 AGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSG 178
           AGWDPRYRIK+RVVCARAYHALFMTNMLIRP+KEELENFGEPDFTVWNAGQFPANTHT G
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180

Query: 179 MTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDND 238
           MTSKTTVEINF++MEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI+D D
Sbjct: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240

Query: 239 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFN 298
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKC+GL+  KEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 299 AIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLT 358
           AIKFGSVLEN+ YDP TR VDYED  ITENTRCAYPIEYIPSAKIPCLA+ HPKNIVLLT
Sbjct: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360

Query: 359 CDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKY 418
           CDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFL+LHP+KY
Sbjct: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 419 ATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLP 478
           ATMLAEKM++H ANAWLINTGWTG+S+V GG RCPLKYTRAILDA+HDGSLA+E++E LP
Sbjct: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480

Query: 479 IFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLA 538
            F L +P+ V + VP  +LNP+KNW EGE KY   V +LA LF ENFK YQD+A+  V++
Sbjct: 481 TFRLHVPRHV-NNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVIS 539

Query: 539 AGPQL 543
           AGP L
Sbjct: 540 AGPVL 544

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/549 (81%), Positives = 495/549 (90%), Gaps = 7/549 (1%)

Query: 1   MSPTK------TQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54
           MSP+K      T +  E+ IR EL LS EV TIRRNAPAA+LYED LKE+ T IS++GAL
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114
           IAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRP++EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT  M+SK+T+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294
           ++ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKC+ LSAEKEP
Sbjct: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354
           EIF+AI+FG+VLEN+ YD N+  VDY+DS+ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414
           +LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474
           P++YATMLA KM++H ANA+LINTGWTGSSYV+GG RC LKYTRAILD+IHDGSLAK  Y
Sbjct: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534
           E LPIFNLQ+P  V + VPA LLNP+KNW++GEAKY   V +LANLFVENFK YQD+AT 
Sbjct: 481 ESLPIFNLQVPTKV-NGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATP 539

Query: 535 QVLAAGPQL 543
            VLAAGPQ 
Sbjct: 540 DVLAAGPQF 548

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/549 (81%), Positives = 486/549 (88%), Gaps = 7/549 (1%)

Query: 1   MSPTKT------QNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54
           MSP+K           EE IR EL L +EVVTIR NAPAA LYED LKE+ TA+ ++GAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114
            AYSG KTGRSP+DKRI+EEETSK+ VWWGPVNKP SE+TW INRERAADYLRTRDH+YI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174
           +DAYAGWDPRYRIKVRV+CARAYHALFMTNMLIRPS EEL NFGEPDFTVWNAGQFPAN 
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           +T GMTSKTTVEINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294
           +  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKC+ L+AEKEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354
           EI+NAIKFGSVLEN+++D + REVDY D++ITENTRCAYPI+YIPSAKIPCLAD HP NI
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414
           VLLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474
           PM+YATMLA+KM +HNANAWL+NTGWTGSSY AGGKRCPLKYTRAILD+IHDGSL+K +Y
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534
           E LPIFNL  P  V + VP SLLNP+K+W EG  KY S VK+LA  F ENFK YQD+AT 
Sbjct: 481 ETLPIFNLHTPAKV-NGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATP 539

Query: 535 QVLAAGPQL 543
            VLAAGPQ 
Sbjct: 540 DVLAAGPQF 548

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/545 (80%), Positives = 490/545 (89%), Gaps = 3/545 (0%)

Query: 1   MSPTKTQN--SAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYS 58
           MSP+K +N  S ++ IR EL L  EVVTIRRNAPAALLYEDALKE  T IS +GALIA+S
Sbjct: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60

Query: 59  GDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAY 118
           G KTGRSP+DKRIV+E TS  N+WWGPVNK CSE+TW +NRERAAD+LRTRDH+YIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120

Query: 119 AGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSG 178
           AGWDPRYRIK+RVVCARAYHALFMTNMLI+P+ +ELE FGEPDFTVWNAGQFPANTHT G
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180

Query: 179 MTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDND 238
           MTSKTT+EINF++MEMVILGTEYAGEMKKGIFTVMFYLMP+NH VLTLHSSANQGI+DND
Sbjct: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240

Query: 239 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFN 298
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKC+GL+  KEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 299 AIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLT 358
           AI+FGSVLEN+ YD  TREVD+E+  ITENTRCAYPIEYIPSAKIPCLAD HPKNIVLLT
Sbjct: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360

Query: 359 CDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKY 418
           CDASGVLPPVSKLTP+QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFL+LHP+KY
Sbjct: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 419 ATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLP 478
           ATMLA+KM+ H A+AWLINTGWTG S+V GG RCPLKYTRAILDAIHDG+LAKEEYE LP
Sbjct: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480

Query: 479 IFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLA 538
            FNL IP  V + VP+++LNP+++W  GEAKY + V++LANLFVENFK Y+  A+ +++ 
Sbjct: 481 TFNLHIPLHV-NNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMC 539

Query: 539 AGPQL 543
           AGP L
Sbjct: 540 AGPLL 544

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/521 (78%), Positives = 457/521 (87%), Gaps = 1/521 (0%)

Query: 23  EVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGDKTGRSPRDKRIVEEETSKDNVW 82
           +++ I+RN P A LYED LKE  T +S+ GALIAYSG KTGRSP+DKRIVEEE SKDN+W
Sbjct: 59  QLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118

Query: 83  WGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAGWDPRYRIKVRVVCARAYHALFM 142
           WGPVNK CSERTW INRERA DYL TRD +Y++DA+ GWDPRYRIK+RVVCARAYHALFM
Sbjct: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178

Query: 143 TNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMTSKTTVEINFKQMEMVILGTEYA 202
            NMLIRP+KEELENFG+PDFTVWNAGQF AN+ T+ M+SKT+VEINFK+MEM ILGTEYA
Sbjct: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238

Query: 203 GEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVTLFFGLSGTGKTTLSADPHRLLI 262
           GEMKKGIFTVMFYLMP+ HNVLTLHSSANQ   + DVTLFFGLSGTGKTTLSADPHR LI
Sbjct: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298

Query: 263 GDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAIKFGSVLENIIYDPNTREVDYED 322
           GDDEHCWSD+GVFNIEGGCYAKC+GLS EKEP+IFNAIKFGSVLEN IYD  T EVDY++
Sbjct: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358

Query: 323 STITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCDASGVLPPVSKLTPDQVMYHFIS 382
           STITENTRCAYPI+YI +AKIPCLAD HP N++LLTCDASGVLPPVSKLTP+QVMYHFIS
Sbjct: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418

Query: 383 GYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKMAEHNANAWLINTGWTG 442
           GYTSKMAGTE GVTEP+ TFSSCFGQPFL+LHPMKYA+MLAEKM +H ANAWL+NTGWTG
Sbjct: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478

Query: 443 SSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPKAVGDKVPASLLNPSKN 502
           SSYV+GG RCPLKYTRAILDAIHDGSL  EEYE LPIFNLQIPK   + VP+ LLNP+ +
Sbjct: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKN-ANGVPSELLNPAGS 537

Query: 503 WAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAGPQL 543
           W +    Y + V+ L  LF ENFKTY+DKAT +V+ AGP L
Sbjct: 538 WTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/559 (74%), Positives = 468/559 (83%), Gaps = 17/559 (3%)

Query: 1   MSPTKTQN---SAEENIRAELGLSAEV-------------VTIRRNAPAALLYEDALKER 44
           M+PTK ++   +  ENI   L  ++ V             +TI+RN P A LYED LKE 
Sbjct: 1   MAPTKIEDYSLNERENIIKNLKSNSNVKLDNVMKCLYNKDITIKRNPPIAELYEDGLKED 60

Query: 45  DTAISNAGALIAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAAD 104
            T +S+ GAL+AYSG KTGRSP+DKRIVEE +SKDN+WWGPVNKPCSE TW INRERA D
Sbjct: 61  STTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAID 120

Query: 105 YLRTRDHIYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTV 164
           YL TR  +Y++DAYAGWD  YRIK+RVVCAR YHALFM NMLIRP+ EELENFGEPDFT+
Sbjct: 121 YLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTI 180

Query: 165 WNAGQFPANTHTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVL 224
           WNAG F AN+ T  MTSKT++EINFK MEMVILGTEYAGEMKKGIFTVMFYLMPV HNVL
Sbjct: 181 WNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVL 240

Query: 225 TLHSSANQGIQDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAK 284
           TLHSSANQG+ + DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAK
Sbjct: 241 TLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAK 300

Query: 285 CLGLSAEKEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIP 344
           C+GL+ EKEPEIFNAIKFGSVLEN +YD NT  VDY+DS ITENTRCAYPI++I SAKIP
Sbjct: 301 CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIP 360

Query: 345 CLADHHPKNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSS 404
           CL D HP N++LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFS+
Sbjct: 361 CLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSA 420

Query: 405 CFGQPFLSLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAI 464
           CFGQPFL+LHPMKYA MLA+KM  H A+AWLINTGWTG+SY AGGKRCPLKYTRAILDAI
Sbjct: 421 CFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAI 480

Query: 465 HDGSLAKEEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVEN 524
           H+GSLA EEYE LP+FNL IPK V + VP+ LLNPSK W++ +  Y+  VK L +LFV+N
Sbjct: 481 HNGSLANEEYETLPVFNLPIPKNV-ENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQN 539

Query: 525 FKTYQDKATEQVLAAGPQL 543
           F  YQD+AT+ V+AAGP L
Sbjct: 540 FTIYQDQATDDVIAAGPAL 558

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/547 (74%), Positives = 468/547 (85%), Gaps = 9/547 (1%)

Query: 5   KTQNSAEENIRAELGLS----AEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60
           K + S E+ + ++L       + ++ I+ N  AA+LYEDALKE  T IS++GALIAYSG 
Sbjct: 31  KQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGA 90

Query: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120
           KTGRSP+DKRIV E+ SKDNVWWGPVNKPCSE+TW+INRER  DYL TR ++Y++DAY G
Sbjct: 91  KTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVG 150

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180
           WDPRYR+KVRVVCARAYHALFMTNMLIRP++EEL+NF EPDFTVWNAG F AN++T+ MT
Sbjct: 151 WDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMT 210

Query: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240
           SKT+VEINFK MEM+ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN+GI+  DVT
Sbjct: 211 SKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVT 270

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300
           +FFGLSGTGKTTLSADP+RLLIGDDEHCWSDHGVFNIEGGCYAKC+GL+ EKEPEIF+AI
Sbjct: 271 VFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAI 330

Query: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360
           +FGSVLEN+ Y+    +VDY D  ITENTRCAYPI+YI SAKIPCLA+ HPKN++LLTCD
Sbjct: 331 RFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCD 390

Query: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420
           ASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LHP+ YAT
Sbjct: 391 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYAT 450

Query: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480
           MLA+KM ++ +NAWLINTGWTGSSY AGG RCPLKYTRAILDAIHDG+LA E YE LP+F
Sbjct: 451 MLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVF 510

Query: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAK----YTSNVKSLANLFVENFKTYQDKATEQV 536
           NLQIP  V + VP  +LNP  +W     K    Y   V  LA LFVENFK YQDKAT+ V
Sbjct: 511 NLQIPTHV-NGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDV 569

Query: 537 LAAGPQL 543
           LAAGPQ+
Sbjct: 570 LAAGPQV 576

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 59/113 (52%), Gaps = 22/113 (19%)

Query: 371 LTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKMAEHN 430
           LT ++VMYHF SG+ S   G         +       +PFL+LHP+ Y T++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 431 ANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKE-----EYEVLP 478
            +A+LINTG+             LK TR   D+IHD SLAKE      Y+ LP
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 34/129 (26%)

Query: 231 NQGIQDN-DVTL-------FFGLSGTGKTTLSA--------DPHRLLIGDDEHCWSDHGV 274
           NQ I D  D+T+         G SG+GK+T+++        +  R++IGD       H +
Sbjct: 452 NQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGD-------HNI 504

Query: 275 --FNIEGGCYAKCLGLSAEKEPEIFNAIKFGSVLENIIYDPNTREVDYED--STITENTR 330
             FN+    Y + LG+  ++EP++FN    G++L+NI+Y       D +D  ST      
Sbjct: 505 NSFNVRK--YRRLLGI-VQQEPQLFN----GTILDNILYTVPPERADNDDLISTAIGQAN 557

Query: 331 CAYPIEYIP 339
           C+  +   P
Sbjct: 558 CSKFLANFP 566

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 244 GLSGTGKTTLSADPHRLL-IGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAIKF 302
           G SG+GK+T+++   R   + +      D+ + N     Y + +G + ++EP +FN    
Sbjct: 480 GFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIG-TVQQEPSLFN---- 534

Query: 303 GSVLENIIY 311
           GS+L+NIIY
Sbjct: 535 GSILDNIIY 543

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 20/90 (22%)

Query: 244 GLSGTGKTTLSA--------DPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPE 295
           G SG GK+T+++        D   +LIG      +D   FN+    Y + +G+  ++EP 
Sbjct: 484 GPSGGGKSTVASLLLRFYDVDAGAILIGGQN--IAD---FNLR--KYRRLVGI-VQQEPM 535

Query: 296 IFNAIKFGSVLENIIYDPNTREVDYEDSTI 325
           +FN    G++LENI+Y    R ++ ED  +
Sbjct: 536 LFN----GTILENILYTVPQRLLNEEDGRV 561

>TBLA0G03070 Chr7 complement(812624..816067) [3444 bp, 1147 aa] {ON}
           Anc_3.258 YBR050C
          Length = 1147

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%)

Query: 451 RCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPKAVGDKVPA 494
           R P+ YTR+  +  H  S++ + +E+L   N+QIP    D  P+
Sbjct: 23  RVPIPYTRSKSNTTHYQSISSKNHELLQKNNMQIPDEDEDMGPS 66

>TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {ON}
           Anc_6.239 YGL137W
          Length = 866

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 212 VMFYLMPVNHNVLTLHSSANQGIQDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD 271
           VM + +P+N+N+  L++ +  G++ +    FF           A   R+ I  DE  WSD
Sbjct: 425 VMSWSIPLNYNIENLYTGSLLGVKSDGFVYFFDWES------GALIRRIDIDADEVVWSD 478

Query: 272 HG 273
           +G
Sbjct: 479 NG 480

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 10/73 (13%)

Query: 242 FFGLSGTGKTTLSA---DPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFN 298
           F G SG GK+T+S+     +R   G+      D   FN+    Y + LG+  ++EP +FN
Sbjct: 397 FVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLRK--YRRMLGV-VQQEPLLFN 453

Query: 299 AIKFGSVLENIIY 311
               G++L+NI Y
Sbjct: 454 ----GTILDNITY 462

>Kwal_56.24265 s56 complement(928206..928859) [654 bp, 217 aa] {ON}
           YPL233W (NSL1) - Protein required for cell viability
           [contig 165] FULL
          Length = 217

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 24  VVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGDKTGRSPRDKR-IVEEETSKDNV 81
           V  +RR AP  L + D + E  +A+  A ALIA   +    S RD++  VEE    DN+
Sbjct: 112 VAQLRREAPQKLCH-DYVAEARSALEEADALIASFTESDETSSRDQQESVEELYKSDNI 169

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,745,252
Number of extensions: 2616861
Number of successful extensions: 6724
Number of sequences better than 10.0: 29
Number of HSP's gapped: 6862
Number of HSP's successfully gapped: 29
Length of query: 543
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 428
Effective length of database: 40,294,809
Effective search space: 17246178252
Effective search space used: 17246178252
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)