Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00462g5.709ON35335319060.0
Kwal_55.196615.709ON3713609231e-123
Kpol_2001.775.709ON4133589231e-122
AFR293C5.709ON3653309121e-121
NDAI0F002405.709ON4643229141e-120
KLTH0E00880g5.709ON3713499031e-120
TDEL0B021105.709ON3893459041e-120
NCAS0G002005.709ON4383399051e-119
Ecym_40125.709ON3953638961e-118
SAKL0E15070g5.709ON3853568921e-118
YIL153W (RRD1)5.709ON3933588921e-118
Skud_9.155.709ON4023528891e-117
Suva_9.355.709ON3933478831e-116
Smik_9.165.709ON3933608831e-116
ZYRO0B16478g5.709ON3913558741e-115
CAGL0H06655g5.709ON4243228201e-106
TPHA0D046505.709ON4213428141e-105
KAFR0D021905.709ON4263208131e-105
KNAG0L021705.709ON3963527861e-102
TBLA0E016905.709ON4883647831e-100
ZYRO0F07326g8.674ON3522964234e-48
NDAI0E024108.674ON3592964157e-47
TPHA0D012408.674ON3592994043e-45
CAGL0M02255g8.674ON3582964033e-45
Ecym_23998.674ON3512464015e-45
KLTH0D11176g8.674ON3532743991e-44
ACR139C8.674ON3592493947e-44
Skud_16.1308.674ON3583573931e-43
Suva_16.1588.674ON3583023903e-43
YPL152W (RRD2)8.674ON3583263903e-43
KLLA0F11187g8.674ON3602603886e-43
Kpol_1013.48.674ON3582393886e-43
KNAG0J016908.674ON3632973861e-42
KAFR0H024408.674ON3532403832e-42
Smik_6.3498.674ON3583263808e-42
SAKL0H06622g8.674ON3552933791e-41
NCAS0C016908.674ON3592963782e-41
TDEL0A062008.674ON3553453684e-40
Kwal_26.87838.674ON3552973606e-39
TBLA0C018608.674ON3563043606e-39
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00462g
         (353 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   738   0.0  
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   360   e-123
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   360   e-122
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   355   e-121
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      356   e-120
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   352   e-120
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   352   e-120
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      353   e-119
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   349   e-118
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   348   e-118
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   348   e-118
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   347   e-117
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   344   e-116
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   344   e-116
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   341   e-115
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   320   e-106
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   318   e-105
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   317   e-105
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   307   e-102
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   306   e-100
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   167   4e-48
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   164   7e-47
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   160   3e-45
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   159   3e-45
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   159   5e-45
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   158   1e-44
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   156   7e-44
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   155   1e-43
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   154   3e-43
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   154   3e-43
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   154   6e-43
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   154   6e-43
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   153   1e-42
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   152   2e-42
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   150   8e-42
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   150   1e-41
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   150   2e-41
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   146   4e-40
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   143   6e-39
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   143   6e-39

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/353 (100%), Positives = 353/353 (100%)

Query: 1   MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFF 60
           MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFF
Sbjct: 1   MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFF 60

Query: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120
           TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII
Sbjct: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120

Query: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPALLYCFNSYYDVIQKL 180
           ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPALLYCFNSYYDVIQKL
Sbjct: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPALLYCFNSYYDVIQKL 180

Query: 181 ILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFC 240
           ILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFC
Sbjct: 181 ILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFC 240

Query: 241 KSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT 300
           KSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT
Sbjct: 241 KSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT 300

Query: 301 AFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTSTSRFIHRR 353
           AFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTSTSRFIHRR
Sbjct: 301 AFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTSTSRFIHRR 353

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  360 bits (923), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 235/360 (65%), Gaps = 16/360 (4%)

Query: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI 63
           D     F+ P KRIFDS+GT  FQ+SVAM+R++ HL KY+ +  GQ+IP    E+   N+
Sbjct: 7   DVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPS---ETSNPNV 63

Query: 64  VV--ELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIE 121
           +   ++L   S L+DETP      RYGNL+ RDW  K + Q+   L E LPEKY  SI+E
Sbjct: 64  ISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVE 123

Query: 122 LSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFNSYYDVIQK 179
           L+YY+ NAFGS+ER+DYGTGHELSF +VI  LDML I     +   LLY FN YY +++K
Sbjct: 124 LAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRK 183

Query: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDV-NTSLIPKDISNTRLMEQNSSSNL 238
           LI  Y LEPAGSHGVWGLDDHFH  YI GA+Q  D  +    P++I +  ++++ + SN 
Sbjct: 184 LITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNF 243

Query: 239 FCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWF 298
           +C++I FI  VKSGPFS HSP+LY+ISRSV TW K+Q+GL+KMY  EVLNKFPVVQHFWF
Sbjct: 244 YCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWF 303

Query: 299 GTAFFPWTSYGNNHSLPIYQPAENNDDADFL--------TANNATTKMPPPLSTSTSRFI 350
           GTA FPWTS      LP Y+ ++  D    L        +       M PP   + SRFI
Sbjct: 304 GTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLRHPMNPPHLRNVSRFI 363

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  360 bits (923), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 242/358 (67%), Gaps = 17/358 (4%)

Query: 3   FDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDT--IKESFF 60
            + E  +F +P KRI+DSQGT  FQ+SVA+ R++Y + KYI L     IPD   + E   
Sbjct: 8   LNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPT 67

Query: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPE------- 113
            N +V+L+  LS L+DETPP     R+GNLS R+W  K    L++ L ++L +       
Sbjct: 68  VNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISS 127

Query: 114 KYNNSIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFN 171
           K  +S++ELSYY+ N+FGS  R+DYGTGHELSF+AVI  +DML +  E IKG  LL  FN
Sbjct: 128 KCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFN 187

Query: 172 SYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTS-LIPKDISNTRLM 230
            YY +++KLILTY LEPAGSHGVWGLDDHFHF+YILG+ Q  + N   L P DI N  L+
Sbjct: 188 EYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLV 247

Query: 231 EQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKF 290
            + +++N++C +I+FI+ VKSGPFS HSP+LY+IS+SVH W K++ GL+KMY VEVLNKF
Sbjct: 248 CEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKF 307

Query: 291 PVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTSTSR 348
           PVVQHFWFGT  FPW       SLP+Y+     +DA   T+ +  +  P PL  ST R
Sbjct: 308 PVVQHFWFGTGLFPWIDNNTKKSLPLYE-----NDAKKTTSIHTKSPSPSPLGISTRR 360

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  355 bits (912), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 170/330 (51%), Positives = 230/330 (69%), Gaps = 7/330 (2%)

Query: 1   MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFF 60
           M+F  E  +FS P KRIFD+ GT DFQ S+ M R+Q HL++Y+ L +GQ+IP + +    
Sbjct: 1   MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAV 60

Query: 61  TNIVVELLKRLSALIDETPPERMHSR-YGNLSYRDWQTKFQNQLENWLHELLPEKYNNSI 119
              V  +L+RL AL+DETPP    +R +G+L+ RDW  + Q +L+  L  LLPE    S 
Sbjct: 61  VRFVC-ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSA 119

Query: 120 IELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET---IKGPALLYCFNSYYDV 176
            EL YY+ +AFGS+ER+DYGTGHEL+FLAV++ LDML + T     G  +LY +  YY +
Sbjct: 120 AELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYAL 179

Query: 177 IQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLL-DVNTSLIPKDISNTRLMEQNSS 235
           + +LILTY LEPAGSHGVWGLDDH H +YILGA+Q   D N  + P DI + + + + S 
Sbjct: 180 VHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSE 239

Query: 236 SNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQH 295
           +NL+C SI F+  VK+G F+ HSP+L++I+++V TW K+  GLIKMY+VEVLNKFPVVQH
Sbjct: 240 TNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQH 299

Query: 296 FWFGTAFFPWTSYGNNHSLPIYQ-PAENND 324
           FWFGT FFPW    +  SLP Y+ P+E ++
Sbjct: 300 FWFGTGFFPWVDMAHGMSLPNYEAPSETSE 329

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  356 bits (914), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 170/322 (52%), Positives = 228/322 (70%), Gaps = 7/322 (2%)

Query: 3   FDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIP----DTIKES 58
            D +   FS+P KRIFDSQ T DFQ+S+A+ R+++ LQ+YI L    +IP      + E 
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 59  FFTNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEK-YNN 117
              N ++ LL  LS ++ +TPP +   RYGNL+ RDW +K + +L   L + +P      
Sbjct: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133

Query: 118 SIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDV 176
           SIIEL+YYI+N+FGS  R+DYGTGHELSF+A I  LDML +   + G  LL  FN+YY +
Sbjct: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193

Query: 177 IQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSS 236
           +++LILTY LEPAGSHGVWGLDDHFH +YILG++Q L+ N  L PK+I+N+RL++  S+ 
Sbjct: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN-NAPLTPKEITNSRLVKDYSTK 252

Query: 237 NLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHF 296
           NL+C+ I F+  VKSGPF+ HSP+LY+IS SV  W K+Q+GLIKMY  EVLNKFPVVQHF
Sbjct: 253 NLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHF 312

Query: 297 WFGTAFFPWTSYGNNHSLPIYQ 318
           WFGT F+PW ++     LP+Y+
Sbjct: 313 WFGTGFYPWINFQTLRELPVYE 334

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  352 bits (903), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 235/349 (67%), Gaps = 12/349 (3%)

Query: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI 63
           D  +A F+ P KRIFDS+G+  FQ+SVAM R++ +L KY++   G +IP+T   +     
Sbjct: 7   DASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPET-STNHEVRS 65

Query: 64  VVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELS 123
             ELLK LS L+D TP      RYGNL+ R W  K    LE  LH+ LPE  + SI+EL 
Sbjct: 66  FAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQ 125

Query: 124 YYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFNSYYDVIQKLI 181
           YY+ NAFGS+ER+DYGTGHELSF A I  LDML +     +   +L+ F+ YY +++KL+
Sbjct: 126 YYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALVRKLV 185

Query: 182 LTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLI-PKDISNTRLMEQNSSSNLFC 240
           LTY LEPAGSHGVWGLDDHFH  YI GA+Q +D   + I P+++ +  ++++ + +N +C
Sbjct: 186 LTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYC 245

Query: 241 KSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT 300
           ++I FI  VKSGPFS HSP+L++ISRSV TW K+Q+GL+KMY  EVLNKFPVVQHFWFGT
Sbjct: 246 QAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGT 305

Query: 301 AFFPWTSYGNNHSLPIYQPAENNDDA--DFLTA------NNATTKMPPP 341
             FPWTS G+ ++LP Y+ ++          TA      N+A  +M PP
Sbjct: 306 GLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARRQMNPP 354

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  352 bits (904), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 179/345 (51%), Positives = 224/345 (64%), Gaps = 15/345 (4%)

Query: 3   FDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTN 62
            D    KF  P K IFDSQG  DFQ SVA+ R++YHL+KY  +  GQ I          N
Sbjct: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIEVVN 66

Query: 63  IVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIEL 122
            VV LL RLS L+DETPP     RYGNL+ RDW  K    L   L ++LP+ Y+  I EL
Sbjct: 67  RVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPEL 126

Query: 123 SYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET--IKGPALLYCFNSYYDVIQKL 180
           SYY+ N+FGS  R+DYGTGHELSFLAV+  LDML + T    G  +L  F++YY +++KL
Sbjct: 127 SYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKLVRKL 186

Query: 181 ILTYKLEPAGSHGVWGLDDHFHFSYILGATQL-LDVNTSLIPKDISNTRLMEQNSSSNLF 239
           ILTY LEPAGSHGVWGLDDHFH  YILG++Q   D    + P+D+ N  L++  + +NL+
Sbjct: 187 ILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLY 246

Query: 240 CKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFG 299
           C++I FI  VKSGPFS HS +LY+I+ +V TW K+Q GL+KMY VEVL KFPVVQHFWFG
Sbjct: 247 CQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306

Query: 300 TAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLST 344
             F+PW S  N   LPIY+ AE+              K PP ++T
Sbjct: 307 PGFYPWISDRNGQKLPIYENAESEK------------KQPPSMTT 339

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 177/339 (52%), Positives = 234/339 (69%), Gaps = 15/339 (4%)

Query: 3   FDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIP--DTIKESFF 60
            D +  +FS+P KRIFDSQ T DFQ+S+A+ R+++ LQKYI++    Q P   T+     
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92

Query: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELL----PEKYN 116
            N +V+LL  LS LIDETPP     RYGNL+ RDW TK + QL   L+E+L    P+   
Sbjct: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152

Query: 117 NS------IIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET--IKGPALLY 168
            S      I EL+YYISNAFGS  R+D+GTGHELSF+A I  +DML + T  ++G  +L 
Sbjct: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212

Query: 169 CFNSYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTR 228
            FN+YY +++KLILTY LEPAGSHGVWGLDDHFH +YILG++Q +  N  + P+D+ +  
Sbjct: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIR-NAPMRPRDVKDIS 271

Query: 229 LMEQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLN 288
           L++Q + SNL+C+ I FI  VKSGPFS HSP+LY+I+ SV TW K+Q+GLIKMY  EVL 
Sbjct: 272 LVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLK 331

Query: 289 KFPVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDDAD 327
           KFPVVQHFWFG  F+PW +      LPIY+ +  +D+ +
Sbjct: 332 KFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETE 370

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  349 bits (896), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 180/363 (49%), Positives = 227/363 (62%), Gaps = 18/363 (4%)

Query: 1   MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFF 60
           M  +    KFS P KRIFDS GT DFQ S+ M R+Q HL++Y+ L   Q++P        
Sbjct: 1   MTVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV 60

Query: 61  TNIVVELLKRLSALIDETPPE-RMHSRYGNLSYRDWQTKFQNQLENWLHELLP----EKY 115
           ++ V   L R   LIDETPP      R+GN++ RDW  K Q ++++     LP      Y
Sbjct: 61  SSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAY 120

Query: 116 NNSIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ET------IKGPALLY 168
            N IIEL YY+ NAFGS ER+DYGTGHELSFLAV++ +DML + ET      + G  LLY
Sbjct: 121 ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY 180

Query: 169 CFNSYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDV--NTSLIPKDISN 226
            +N YY ++ KLILTY LEPAGSHGVWGLDDH H +YI+GA+Q  D   N  +   DI +
Sbjct: 181 LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILD 240

Query: 227 TRLMEQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEV 286
            + + Q   +NL+C SI F+  VKSGPFS HSP+LY+ISR+V TW K   GLIKMY+VEV
Sbjct: 241 MKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEV 300

Query: 287 LNKFPVVQHFWFGTAFFPWTSYGNNHSLPIYQ----PAENNDDADFLTANNATTKMPPPL 342
           LNKFPVVQHFWFGT FFPW       SLP Y+     A      D   + ++TT +P   
Sbjct: 301 LNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTAT 360

Query: 343 STS 345
            +S
Sbjct: 361 GSS 363

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  348 bits (892), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 173/356 (48%), Positives = 232/356 (65%), Gaps = 20/356 (5%)

Query: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI 63
           D  + KF+ P K+IFD+QGT DFQ+SV M R+Q +L KYITL   + IP T       N 
Sbjct: 11  DVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDA-VNR 69

Query: 64  VVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELS 123
             +++  LS  IDETPP     R+GN + R W  K +  L+  L   +PEKY+  I+E+ 
Sbjct: 70  FTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIR 129

Query: 124 YYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFNSYYDVIQKLI 181
           YY+ NAFGSKER+DYGTGHELSFLAV+  +DML +      G  +L+ FN YY +++KLI
Sbjct: 130 YYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLVKKLI 189

Query: 182 LTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVN-TSLIPKDISNTRLMEQNSSSNLFC 240
            TY LEPAGSHGVWGLDDHFH +YILG++QL  ++   L P DI +   +E  + +NL+ 
Sbjct: 190 ATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYF 249

Query: 241 KSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT 300
           ++I FI+ VKSG FS HSP+LY+I+++V TW K+Q+GL+KMY  EVLNKFPVVQHFWFGT
Sbjct: 250 QAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFGT 309

Query: 301 AFFPWTSYGNNHSLPIYQPAENNDDADFLTANN---------------ATTKMPPP 341
            FFPW +  +   LP Y+ A   ++  F +  +               ++T MPPP
Sbjct: 310 GFFPWVNVKSGAILPTYE-ANQEENPHFSSVTSISNMPTATKSVLPATSSTTMPPP 364

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  348 bits (892), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 174/358 (48%), Positives = 227/358 (63%), Gaps = 24/358 (6%)

Query: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPD---TIKESFF 60
           D+ +A FS P KRIFD+Q TLDFQ+S+A+ RI+YHL KY TL      PD   T      
Sbjct: 7   DWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAM 66

Query: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120
            N ++ +L +L+ LIDETPP     RYGNL+ R+W  K   +L  WL E+LP +Y+  + 
Sbjct: 67  VNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVVP 126

Query: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDVIQK 179
           EL YY+ N+FGS  R+DYGTGHELSF+A +  LDML +   ++G  +   FN YY ++++
Sbjct: 127 ELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTIMRR 186

Query: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQ--LLDVNTSLIPKDISNTRLMEQNSSSN 237
           LILTY LEPAGSHGVWGLDDHFH  YILG++Q  LLD    L P++I +  L+ +   +N
Sbjct: 187 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTN 246

Query: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297
            +C+ I FIN VK GPF  HSP+LY+I+ +V  W K+ +GL+KMY VEVL KFPVVQHFW
Sbjct: 247 FYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFW 306

Query: 298 FGTAFFPWTSYGNNHSLPIY--------------QPAENNDDADFLTANNATTKMPPP 341
           FGT FFPW +  N   LP++               P        F T+    T MPPP
Sbjct: 307 FGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTS----TSMPPP 360

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  347 bits (889), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 228/352 (64%), Gaps = 13/352 (3%)

Query: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKES---FF 60
           D+ +A FS P KRIFD+Q TLDFQ+S+A+ RI+YHL KY TL      PD    S     
Sbjct: 16  DWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAM 75

Query: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120
            N ++ +L +L+ LIDETPP     RYGNL+ R+W  K    L  WL E+LP +Y+  + 
Sbjct: 76  VNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVVP 135

Query: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDVIQK 179
           EL YY+ N+FGS  R+DYGTGHELSF+A +  LD+L +   ++G  +   FN YY ++++
Sbjct: 136 ELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYYTIMRR 195

Query: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQ--LLDVNTSLIPKDISNTRLMEQNSSSN 237
           LILTY LEPAGSHGVWGLDDHFH  YILG++Q  LLD    L P+++ +  L+     +N
Sbjct: 196 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKDTN 255

Query: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297
            +C+ I FIN VK GPF  HSP+LY+I+ +V  W K+ +GL+KMY VEVL KFPVVQHFW
Sbjct: 256 FYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFW 315

Query: 298 FGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTSTSRF 349
           FGT FFPW +  N   LP+++  E+       T   A    P P  TST RF
Sbjct: 316 FGTGFFPWVNIQNGTDLPVFEEKEDE------TIEQANAASPGPNHTST-RF 360

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  344 bits (883), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 169/347 (48%), Positives = 225/347 (64%), Gaps = 10/347 (2%)

Query: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPD---TIKESFF 60
           D+ +A FS P KRIFD+Q T DFQ+S+A+ RI+YHL KY TL      PD   T      
Sbjct: 7   DWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPM 66

Query: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120
            N ++ +L R + LID+TPP     RYGNL+ R+W  K    L  WL E+LP +Y+  + 
Sbjct: 67  VNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVP 126

Query: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDVIQK 179
           EL YY+ N+FGS  R+DYGTGHELSF+A +  LD+L +   ++G  +   F+ YY ++++
Sbjct: 127 ELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAIMRR 186

Query: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQ--LLDVNTSLIPKDISNTRLMEQNSSSN 237
           LILTY LEPAGSHGVWGLDDHFH  YILG++Q  LLD    L P+D+ +  L+ +   +N
Sbjct: 187 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTN 246

Query: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297
            +C+ I FIN VK GPF  HSP+LY+I+ +V  W K+ +GL+KMY VEVL KFPVVQHFW
Sbjct: 247 FYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFW 306

Query: 298 FGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLST 344
           FGT FFPW +  N   LP+++  E       +   NAT+  P   ST
Sbjct: 307 FGTGFFPWINVQNGTDLPVFEEKEEES----IDQANATSATPDRTST 349

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  344 bits (883), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 172/360 (47%), Positives = 234/360 (65%), Gaps = 24/360 (6%)

Query: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPD--TIKESF-F 60
           D+ +A FS P KRIFD+Q TLDFQ+S+A+ RI+YHL KY TL      PD   +  S   
Sbjct: 7   DWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPM 66

Query: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120
            N ++++L +L+ LIDETPP     RYGNL+ R+W  K   +L  WL E+LP +Y+  + 
Sbjct: 67  DNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVP 126

Query: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDVIQK 179
           EL YY+ N+FGS  R+DYGTGHELSF+A +  LD+L +   ++G  +   FN YY ++++
Sbjct: 127 ELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTIMRR 186

Query: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQ--LLDVNTSLIPKDISNTRLMEQNSSSN 237
           LILTY LEPAGSHGVWGLDDHFH  YILG++Q  LLD    L P++I +  L+ +  ++N
Sbjct: 187 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTN 246

Query: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297
            +C+ I FIN VK GPF  HSP+LY+I+ +V  W K+ +GL+KMY VEVL KFPVVQHFW
Sbjct: 247 FYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFW 306

Query: 298 FGTAFFPWTSYGNNHSLPIYQ--------------PAENNDDADFLTANNATTKMPPPLS 343
           FGT FFPW +  N  +LP+++              P   +    F     A+  MPPP++
Sbjct: 307 FGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRF----PASMSMPPPIT 362

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  341 bits (874), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 232/355 (65%), Gaps = 13/355 (3%)

Query: 6   ENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVV 65
           EN +F+ P KRIFDSQ TL+FQ SVA+VR++Y +QKY  +     IP         N  V
Sbjct: 7   ENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFV 66

Query: 66  ELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYY 125
            +L  +S L+D+TPP     RYGNL+ RDW  K   Q+ +   ++LP+++++ I+EL +Y
Sbjct: 67  GVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHY 126

Query: 126 ISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET--IKGPALLYCFNSYYDVIQKLILT 183
           + N+FGS  R+DYGTGHELSFLAV+  +DML + T   +G   L   N+YY V++KLILT
Sbjct: 127 LGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILT 186

Query: 184 YKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTS-LIPKDISNTRLMEQNSSSNLFCKS 242
           Y LEPAGSHGVWGLDDHFH +Y+ G+ Q  +   + L P+DI N  L+++ +  NL+C++
Sbjct: 187 YTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQT 246

Query: 243 IRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAF 302
           I FI  VK GPF  HS +LY+++ +VHTW K++ GL+KMY VEVLNKFPVVQHFWFGT F
Sbjct: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306

Query: 303 FPWTSYGNNHSLPIYQPAENNDD---------ADFLTA-NNATTKMPPPLSTSTS 347
           +PW        L IY PA+ +           A F+++ N+     P P +T+ S
Sbjct: 307 YPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAAS 361

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  320 bits (820), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 219/322 (68%), Gaps = 9/322 (2%)

Query: 10  FSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVVELLK 69
           FS P KRI+DSQG   FQ+S A+ R++  + KY  L + + + D ++ S     VV++L 
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVAD-LELSGVVGGVVKVLD 60

Query: 70  RLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNS---IIELSYYI 126
           RL  L+ ETPP     RYGN++ RDW  K + ++   L +L+   + +    ++EL YY+
Sbjct: 61  RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120

Query: 127 SNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPALLYCFNSYYDVIQKLILTYKL 186
           +N+FGS  R+D+GTGHELSFLA +  LDML   +  G  +LY F+ YY ++ +LIL+Y L
Sbjct: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGA-SFDGDQVLYIFDRYYSLVHRLILSYTL 179

Query: 187 EPAGSHGVWGLDDHFHFSYILGATQLLDVNT-SLIPKDISNTRLMEQNSSSNLFCKSIRF 245
           EPAGSHGVWGLDDHFH +YILG++Q  +    ++ P D+S+  L+EQ S +N+FCK++ F
Sbjct: 180 EPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLNF 239

Query: 246 INVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAFFPW 305
           +  VKSG F  HSP+L++ISRSV TW K+++GL KMYK EVLNKFPV+QHFWFGT F+PW
Sbjct: 240 VFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYPW 299

Query: 306 TSYGNNHSLPIYQPAENNDDAD 327
             Y N   LP Y   EN+ D D
Sbjct: 300 VDYKNGKPLPNY---ENSPDID 318

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  318 bits (814), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 163/342 (47%), Positives = 224/342 (65%), Gaps = 16/342 (4%)

Query: 10  FSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDT--IKESFFTNIVVEL 67
           FS+P KRI+DSQ T  FQ+S+A+ R++Y+L KYI +    +IPD   + E    N +  L
Sbjct: 14  FSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITIVNEMSSL 73

Query: 68  LKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLP-----------EKYN 116
           L  LS  ID  PP     RYGNL+ R+W +   +++   L ++L            EK  
Sbjct: 74  LTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEKGEFEKLK 133

Query: 117 NSIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFNSYY 174
             IIEL+YY+ N+ GS  R+DYGTGHELSFLAVI  +DML +  E  KG  LL+ F+ YY
Sbjct: 134 GCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLLHMFHCYY 193

Query: 175 DVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLD-VNTSLIPKDISNTRLMEQN 233
           ++++KLI+TY LEPAGSHGVWGLDDHFH SYILG++QL +  N    P DI N +++ + 
Sbjct: 194 ELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDIINKKIVTEY 253

Query: 234 SSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVV 293
              N +C +I FI  VKSGPFS HSP+LY+IS +V++W K+  GL+KMY VEVLNKFPVV
Sbjct: 254 MHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMVEVLNKFPVV 313

Query: 294 QHFWFGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNAT 335
           QHFWFG  F+PW +   +  L +Y    N ++  F ++++++
Sbjct: 314 QHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSSS 355

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  317 bits (813), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 216/320 (67%), Gaps = 6/320 (1%)

Query: 8   AKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESF-FTNIVVE 66
           +KFS+P KRIFDSQ T  FQ+SVA  R++Y   KYI L +G  +P +   +   T  +++
Sbjct: 15  SKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILD 74

Query: 67  LLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPE----KYNNSIIEL 122
           LL + S  IDETPP     R+GNLS R W  K  + L   L  ++      +  N   EL
Sbjct: 75  LLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNEL 134

Query: 123 SYYISNAFGSKERIDYGTGHELSFLAVIICLDMLK-IETIKGPALLYCFNSYYDVIQKLI 181
           +YY+ N+FGSK R+DYGTGHELSFLA I C+DM++ ++ +     L  + SYY++ +KLI
Sbjct: 135 NYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYYNLTRKLI 194

Query: 182 LTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCK 241
           LTY LEPAGSHGVWGLDDHFH +YI G++QL+   + L PKDI    ++ ++  +NL+C+
Sbjct: 195 LTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENNLYCQ 254

Query: 242 SIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTA 301
           +I FI  VK GPF+ HSP+LY+IS++V +W K+ +GL+KMY  EVLNKFPVVQHFWFG  
Sbjct: 255 AINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWFGDG 314

Query: 302 FFPWTSYGNNHSLPIYQPAE 321
           FFPW    +   LP+++ +E
Sbjct: 315 FFPWKDNNSGKDLPVFEHSE 334

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  307 bits (786), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 157/352 (44%), Positives = 219/352 (62%), Gaps = 11/352 (3%)

Query: 1   MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKE-SF 59
           +  D E+A F  P+KRIFDSQ T  FQ SVA+ RI++H++KY+ + +G    DT    S 
Sbjct: 14  LPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG----DTSGGISA 69

Query: 60  FTNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSI 119
               ++++L RL AL+DETPP     RYGNL+ RDW  K  + L     ++       + 
Sbjct: 70  SVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129

Query: 120 IELSYYISNAFGSKERIDYGTGHELSFLAVIICLDML-KIETIKGPALLYCFNSYYDVIQ 178
           IE  YY+ N+FGSK R+DYGTGHELSFLA +  LDM+ +   I    L   ++ YY +++
Sbjct: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189

Query: 179 KLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDI-SNTRLMEQNSSSN 237
           +LI+ Y LEPAGSHGVWGLDDHFH +Y+ GA+Q  +    + P+D+ S       ++ +N
Sbjct: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRDDAPAN 249

Query: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297
              ++I F+  VK GPF  +SP+L +I   V +W K+Q+GL +MY  EVLNKFPVVQHFW
Sbjct: 250 FLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFW 309

Query: 298 FGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTA---NNATTKMPPPLSTST 346
           FGTAFFPWTS  +   LP+Y+ + + +   F +       TT + P L TST
Sbjct: 310 FGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTL-PALDTST 360

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  306 bits (783), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 218/364 (59%), Gaps = 28/364 (7%)

Query: 7   NAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI--V 64
           N  FS P K+IFDSQGT  F  S+A  RIQY + KY  L + + IP T   S    I  V
Sbjct: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGV 71

Query: 65  VELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLP---EKYNNS--I 119
            +++  L  L++ETPP     RYGNLS R W  +  + +     + L     K+N     
Sbjct: 72  SKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLF 131

Query: 120 IELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET-IKGPALLYCFNSYYDVIQ 178
           +EL YY + + GS  R+DYGTGHELSFLA I  LDML + T I G  +L+ FN YY +I+
Sbjct: 132 LELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLIR 191

Query: 179 KLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLI--------------PKDI 224
           KLIL Y LEPAGSHGVWGLDDHFH  YI G++Q    N  +               P DI
Sbjct: 192 KLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDI 251

Query: 225 SNTRLMEQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKV 284
            N  L+E+  SSN +C+SI FI  VK+GPF  HSP+L++I+++VH W K++ GL+KMY V
Sbjct: 252 LNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMV 311

Query: 285 EVLNKFPVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLST 344
           EVLNKFPVVQHFWFGT F+PW +      LP Y+ A ++++  +      T   P  LS 
Sbjct: 312 EVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTY------TINKPTDLSK 365

Query: 345 STSR 348
           S S+
Sbjct: 366 SGSK 369

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  167 bits (423), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 165/296 (55%), Gaps = 11/296 (3%)

Query: 12  MPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI--VVELLK 69
           +PEKR+  ++    + +S  M  +   +       +G++     KE    ++   ++LLK
Sbjct: 2   IPEKRLTTNKDMKIWMDSTTMDSLVEFVTILADSVRGRE-NTAYKEPISKDMEPTMQLLK 60

Query: 70  RLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYIS 127
           +++ LID+ P   +   SR+G + +RD+    Q   E  +    P    + + EL+ Y+ 
Sbjct: 61  KVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEELAVYLY 120

Query: 128 NAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPA---LLYCFNSYYDVIQKLILTY 184
            ++G+K RIDYG+GHEL+F+  I  L + K+  ++  A   +L  F  Y  +++ L   Y
Sbjct: 121 ESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRILETKY 180

Query: 185 KLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSIR 244
            LEPAGSHGVWGLDD+    ++ GA QL   +  L PK I N  ++E      ++   I 
Sbjct: 181 WLEPAGSHGVWGLDDYHFLPFLFGAHQLA-THPHLRPKSIHNEEVVEMFMDKYIYFGCIA 239

Query: 245 FINVVKS-GPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFG 299
           FIN VKS      HSP+L +IS  V TW K+ +G+IKMYK EVL+K P++QHF+FG
Sbjct: 240 FINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYFG 294

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  164 bits (415), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 100/296 (33%), Positives = 162/296 (54%), Gaps = 13/296 (4%)

Query: 12  MPEKRIFDSQGTLDFQNSVA---MVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVVELL 68
           +PEKR+        ++ S     ++     L + +  C+  QI + I  +   N + ++L
Sbjct: 2   LPEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQISEPISPAI--NTLEQIL 59

Query: 69  KRLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYI 126
             +  +ID+ P   ++  SR+G   +R +  +     E  +HE  P   +  + +L+ Y+
Sbjct: 60  VSIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQLEQLTIYL 119

Query: 127 SNAFGSKERIDYGTGHELSFLAVIICL---DMLKIETIKGPALLYCFNSYYDVIQKLILT 183
             ++G+K+RIDYG+GHEL+F+  +  L   D+LK++      +L  F  Y D+++ L   
Sbjct: 120 DESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNMVLIIFIKYLDIMRSLETK 179

Query: 184 YKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSI 243
           Y LEPAGSHGVWGLDD+    ++ GA QL   +  L P  I N  L+E  +   L+   I
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAYQLA-THKHLKPLSIHNEELVEMFAKKYLYFGCI 238

Query: 244 RFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWF 298
            FIN VK +     HSP+L +IS  V  W K+ +G++KMY  EVL+K P++QHF+F
Sbjct: 239 AFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIMQHFYF 293

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  160 bits (404), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 163/299 (54%), Gaps = 9/299 (3%)

Query: 12  MPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPD-TIKESFFTNIVVELLKR 70
           +P+KR+  +     +  S     +   L++     +G++  D T+  S     +++LL +
Sbjct: 2   LPQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDYTLPISQPVESMMKLLHK 61

Query: 71  LSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYISN 128
           + +++ + P   +   SR+G + +RD+     +Q +  L E  P   ++ I +L  Y+  
Sbjct: 62  VQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIEQLYVYVDE 121

Query: 129 AFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPA---LLYCFNSYYDVIQKLILTYK 185
           ++G+K+RIDYG+GHEL+F+  I  L   KI  ++  A   +L  F  Y  +++ L L Y 
Sbjct: 122 SWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKLMRVLELQYW 181

Query: 186 LEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSIRF 245
           LEPAGSHGVWGLDD+    ++ GA Q L  +  L P  I N  L+E  +   L+   I F
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAYQ-LSTHKHLKPSSIHNDDLIEMFADKYLYFGCIEF 240

Query: 246 INVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAFF 303
           IN VK +     HSP+L +IS  V  W K+ +G+ KMY+ EV+ K P++QHF+F   F 
Sbjct: 241 INSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQHFYFNDMFL 298

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  159 bits (403), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/296 (34%), Positives = 158/296 (53%), Gaps = 13/296 (4%)

Query: 12  MPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKG---QQIPDTIKESFFTNIVVELL 68
           +P KRI   +    ++ S     I   ++      +G    Q+ + + +S  + I V  L
Sbjct: 2   IPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIAV--L 59

Query: 69  KRLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYI 126
             +  LI   P   ++  SR+G + +RD+      + ++ L    P   +  I +LS Y+
Sbjct: 60  TEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQIEQLSIYL 119

Query: 127 SNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPA---LLYCFNSYYDVIQKLILT 183
             ++G+K RIDYG+GHEL+F+  +  L   KI  ++  A   +L  F  Y  +++++   
Sbjct: 120 QESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLKIMREIETL 179

Query: 184 YKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSI 243
           Y LEPAGSHGVWGLDD+    ++ GA QL   +  L PK I N  L+E  +   L+   I
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLAP-HKHLKPKSIHNEELVEMFADKYLYFGCI 238

Query: 244 RFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWF 298
            FIN VK S     HSP+L +IS  V  W K+ +G+IKMYK EVL K P++QHF+F
Sbjct: 239 AFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPIMQHFYF 293

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  159 bits (401), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 90/246 (36%), Positives = 143/246 (58%), Gaps = 8/246 (3%)

Query: 64  VVELLKRLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIE 121
           +  LL  ++ ++D+ P   ++  SR+G + +RD+  + +   +  +  L  E  +  + E
Sbjct: 55  LCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSLSSELTDEQVEE 114

Query: 122 LSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFNSYYDVIQK 179
           L+ Y + ++G ++RIDYG+GHEL+F+  +  L    +  +  K   +L  F  Y DV++ 
Sbjct: 115 LAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYLDVMRL 174

Query: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLF 239
           L   Y LEPAGSHGVWGLDD+    ++ GA QL   +  L PK I N  ++E      ++
Sbjct: 175 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLT-THKHLKPKSIHNPEIVEVFEKRYMY 233

Query: 240 CKSIRFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWF 298
            + + FIN VK +     HSP+L +IS  V TW K+ +G++KMYK EVL K P++QHF+F
Sbjct: 234 FECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVLGKLPIMQHFFF 292

Query: 299 GTAFFP 304
            T F P
Sbjct: 293 ST-FLP 297

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  158 bits (399), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 148/274 (54%), Gaps = 18/274 (6%)

Query: 64  VVELLKRLSALIDETPPER--MHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIE 121
             +LL+ +++L ++ P ++    SR+G + +R +    +++ +  +             E
Sbjct: 55  CCQLLEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQCEE 114

Query: 122 LSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPA-----LLYCFNSYYDV 176
           LS Y + ++G + RIDYG+GHEL+FL  +  L    +   K PA     +L  F  Y  V
Sbjct: 115 LSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGV--FKEPADYRNMVLKLFIKYLGV 172

Query: 177 IQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSS 236
           ++ L   Y LEPAGSHGVWGLDD+    ++ GA QL   +  L PK I N+ ++E     
Sbjct: 173 MRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQL-STHKHLKPKSIHNSEVVEMFGKR 231

Query: 237 NLFCKSIRFINVVKS-GPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQH 295
            L+   I FIN VK+      HSP+L +IS  V TW K+ +G+IKMYK EVLNK P++QH
Sbjct: 232 YLYFGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPIMQH 290

Query: 296 FWFGT------AFFPWTSYGNNHSLPIYQPAENN 323
           F+FG+         P  ++  +H    + P EN 
Sbjct: 291 FFFGSFLQCPEGISPPGTHAESHQHCSHSPLENT 324

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  156 bits (394), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 141/249 (56%), Gaps = 15/249 (6%)

Query: 68  LKRLSALIDETPPERMH---------SRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNS 118
           ++ L AL++E      H         SR+G + +RD+  + Q + E  + ++ P   +  
Sbjct: 60  IEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVDPSLTDEQ 119

Query: 119 IIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFNSYYDV 176
             EL+ Y+ NA+G  +RIDYG+GHEL+F+  +  L    +  E     A+L  F  Y DV
Sbjct: 120 AQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAVLRVFVKYMDV 179

Query: 177 IQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSS 236
           ++ L   Y LEPAGSHGVWGLDD+    ++ GA QL   +  L PK I N  ++E   + 
Sbjct: 180 MRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLA-THKHLKPKSIHNPEVVELFENR 238

Query: 237 NLFCKSIRFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQH 295
            L+   I FIN VK +     HSP+L +IS  V +W K+ +G++KMYK EVL K P++QH
Sbjct: 239 YLYFGCIAFINRVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKAEVLGKLPIMQH 297

Query: 296 FWFGTAFFP 304
           F+F + F P
Sbjct: 298 FFF-SRFLP 305

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  155 bits (393), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 109/357 (30%), Positives = 177/357 (49%), Gaps = 20/357 (5%)

Query: 12  MPEKRIF---DSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVVELL 68
           +PEKR+    D +   + Q      +    L + +   +  Q  + I E   +  ++ LL
Sbjct: 2   LPEKRLLTAGDMKLWEESQTRADFTKFIIELAESVKGHENYQFKEPISEQIIS--MMNLL 59

Query: 69  KRLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYI 126
            ++  +I + P   +   SR+G + +RD+  +        L    P   +  + +LS Y+
Sbjct: 60  SQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQLEQLSIYL 119

Query: 127 SNAFGSKERIDYGTGHELSFLAVIICL---DMLKIETIKGPALLYCFNSYYDVIQKLILT 183
             ++G+K RIDYG+GHEL+F+ ++  L    +  +       +L  F  Y  +++ L   
Sbjct: 120 DESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMRILETK 179

Query: 184 YKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSI 243
           Y LEPAGSHGVWGLDD+    ++ GA Q L  +  L P  I N  L+E  +   L+   I
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQ-LTTHKHLKPISIHNNELVEMFAHRYLYFGCI 238

Query: 244 RFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAF 302
            FIN VK S     HSP+L +IS  V TW K+ +G+IKMYKVEVL+K P++QHF+F   F
Sbjct: 239 AFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPIMQHFYF-CEF 296

Query: 303 FPWTSYGNNHSLPIYQPAENNDDADFLTANNAT------TKMPPPLSTSTSRFIHRR 353
            P     +     I+     +D+ +F    ++T       K+P  ++ +     H +
Sbjct: 297 LPCPEGVSRSRGHIHNGTYADDECNFEDHVHSTWGDCCGIKLPSAIAATEMNKKHHK 353

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  154 bits (390), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 160/302 (52%), Gaps = 14/302 (4%)

Query: 12  MPEKRIFDSQGTLDFQNS---VAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVVELL 68
           +PEKR+  ++    ++ S       +    L K +   +  Q  + + E      ++ LL
Sbjct: 2   LPEKRLLTAEDMKLWEKSQTRADFTKFVIDLAKSVEGHENSQYKEPVSEQI--TRMLSLL 59

Query: 69  KRLSALIDETPP--ERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYI 126
            R+  +I++ P   +   SR+G + +RD+  +        L        +  + +LS Y+
Sbjct: 60  SRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQLEQLSIYL 119

Query: 127 SNAFGSKERIDYGTGHELSFLAVIICL---DMLKIETIKGPALLYCFNSYYDVIQKLILT 183
             ++G+K RIDYG+GHEL+F+ ++  L    +  +       +L  F  Y D+++ L   
Sbjct: 120 DESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLDIMRVLETK 179

Query: 184 YKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSI 243
           Y LEPAGSHGVWGLDD+    ++ GA QL   +  L P  I N+ L+E  S   L+   I
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLT-THKHLKPISIHNSELVEMFSDRYLYFGCI 238

Query: 244 RFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAF 302
            FIN VK S     HSP+L +IS  V TW K+ +G+IKMY+ EVL+K P++QHF+F + F
Sbjct: 239 AFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-SEF 296

Query: 303 FP 304
            P
Sbjct: 297 LP 298

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  154 bits (390), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 106/326 (32%), Positives = 165/326 (50%), Gaps = 14/326 (4%)

Query: 12  MPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQ---QIPDTIKESFFTNIVVELL 68
           +PEKR+        ++ S         +       KG    Q  + I ES   N ++ LL
Sbjct: 2   LPEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESI--NSMMNLL 59

Query: 69  KRLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYI 126
            ++  +  + P   +   SR+G + +RD+  +        L    P   +  + +LS Y+
Sbjct: 60  SQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYL 119

Query: 127 SNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPA---LLYCFNSYYDVIQKLILT 183
             ++G+K RIDYG+GHEL+F+ ++  L    I  +   +   +L  F  Y  +++ L   
Sbjct: 120 DESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETK 179

Query: 184 YKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSI 243
           Y LEPAGSHGVWGLDD+    ++ GA QL   +  L P  I N  L+E  +   L+   I
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLT-THKHLKPISIHNNELVEMFAHRYLYFGCI 238

Query: 244 RFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAF 302
            FIN VK S     HSP+L +IS  V TW K+ +G+IKMYK EVL+K P++QHF+F + F
Sbjct: 239 AFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYF-SEF 296

Query: 303 FPWTSYGNNHSLPIYQPAENNDDADF 328
            P     +     I+   + +D+ +F
Sbjct: 297 LPCPDGVSPPRGHIHDGTDKDDECNF 322

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  154 bits (388), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 144/260 (55%), Gaps = 17/260 (6%)

Query: 49  QQIPDTIKESFFTNIVVELLKRLSALID--ETPPERMHSRYGNLSYRDWQ---TKFQNQL 103
           Q I D ++       V  LL +++ +I   E   +   SR+G + +RD+    ++  N+L
Sbjct: 45  QPISDNVQR------VSNLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNEL 98

Query: 104 ENWLHELLPEKYNNSIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI---ET 160
            + + E + +     + ++  Y  N++G + RIDYG+GHEL+F+  + CL   K+   E 
Sbjct: 99  ISKIFEGIEKPDTGKLDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLEN 158

Query: 161 IKGPALLYCFNSYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLI 220
                +L  F  Y  +++ L L Y LEPAGSHGVWGLDD+    ++ GA Q L  +  L 
Sbjct: 159 DSSNIVLMLFIKYLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ-LSTHKHLK 217

Query: 221 PKDISNTRLMEQNSSSNLFCKSIRFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLI 279
           PK I N  ++E      L+   I FIN VK +     HSP+L +IS  V  W K+ +G++
Sbjct: 218 PKSIHNPEVVEMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMV 276

Query: 280 KMYKVEVLNKFPVVQHFWFG 299
           KMYK EVL K P++QHF+FG
Sbjct: 277 KMYKAEVLQKLPIMQHFYFG 296

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  154 bits (388), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 137/239 (57%), Gaps = 8/239 (3%)

Query: 67  LLKRLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSY 124
           LLK ++ +ID+ P   +   SR+G + +RD+  +  +Q +  +    P    + + +L  
Sbjct: 58  LLKSVNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQLDQLYV 117

Query: 125 YISNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGP---ALLYCFNSYYDVIQKLI 181
           Y+  ++G+K+RIDYG+GHEL+FL ++  L   KI          +L  F  Y  V++ L 
Sbjct: 118 YLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEYLRVMRILE 177

Query: 182 LTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCK 241
             Y LEPAGSHGVWGLDD+    ++ GA QL   +  L P  I N  L+E      L+  
Sbjct: 178 TKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLA-THKHLKPLSIHNEELVEMFQDKYLYFS 236

Query: 242 SIRFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFG 299
            + FIN VK S     HSP+L +IS  V  W K+ +G+IKMY+ EVL+K P++QHF+FG
Sbjct: 237 CVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPIMQHFYFG 294

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  153 bits (386), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/297 (30%), Positives = 160/297 (53%), Gaps = 11/297 (3%)

Query: 11  SMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPD-TIKESFFTNIVVELLK 69
           +MP KR+   +    +++S     + + +++     +G++     +  S     ++ LL+
Sbjct: 4   AMPCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALMGLLQ 63

Query: 70  RLSALIDETPPERMH---SRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYI 126
           ++  +I+  P  +     SR+G + +RD+  + + +  + +    P+   N + +L  Y+
Sbjct: 64  QVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQNQVRQLQTYL 123

Query: 127 SNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGP----ALLYCFNSYYDVIQKLIL 182
             ++G K RIDYG+GHEL+F+  +  L   K+  + G      +L  F  Y  +++ L  
Sbjct: 124 EESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFDLGGTDRANLVLKPFIEYLKIMRVLET 183

Query: 183 TYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKS 242
            Y LEPAGSHGVWGLDD+    ++ GA Q L  +  L P  I N  ++E  +   L+   
Sbjct: 184 EYWLEPAGSHGVWGLDDYHFLPFLFGAFQ-LSTHKHLKPLSIHNEEVVELFADKYLYFGC 242

Query: 243 IRFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWF 298
           I FIN VK +     HSP+L +IS  V  W K+ +G++KMY+ EVL+K P++QHF+F
Sbjct: 243 IHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSKLPIMQHFYF 298

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  152 bits (383), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 136/240 (56%), Gaps = 7/240 (2%)

Query: 64  VVELLKRLSALIDETPP-ERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIEL 122
            + LL  + +++DE P      SR+G   +R +    ++   N L +       N I +L
Sbjct: 57  TLALLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIEQL 116

Query: 123 SYYISNAFGSKERIDYGTGHELSFLAVIICL---DMLKIETIKGPALLYCFNSYYDVIQK 179
           S Y   ++G++ERIDYG+GHEL+F+  +  L   D+ ++E      ++  F  Y  ++++
Sbjct: 117 SIYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYLKIMRR 176

Query: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLF 239
           L   Y LEPAGSHGVWGLDD+    ++ GA QL + +  L PK I N  +++      L+
Sbjct: 177 LETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSN-HKHLKPKSIHNDEIVDMFKDKYLY 235

Query: 240 CKSIRFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWF 298
              I FIN VK +     HSP+L +IS  V  W K+ +G+IKMY  EVL+K PV+QHF+F
Sbjct: 236 FGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQHFYF 294

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  150 bits (380), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 103/326 (31%), Positives = 166/326 (50%), Gaps = 14/326 (4%)

Query: 12  MPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQ---QIPDTIKESFFTNIVVELL 68
           +PEKR+  S     ++ S         +       KG    Q  + + E    + ++ LL
Sbjct: 2   LPEKRLLTSGDMKLWEESQTRANFTKFIIDLAESVKGHENSQYEEPVSEPI--SRMMNLL 59

Query: 69  KRLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYI 126
             +  +I + P   +   SR+G + +RD+  +       +L    P   +  + +LS Y+
Sbjct: 60  SYIRDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQLEQLSIYL 119

Query: 127 SNAFGSKERIDYGTGHELSFLAVIICL---DMLKIETIKGPALLYCFNSYYDVIQKLILT 183
             ++G+K RIDYG+GHEL+F+ ++  L    +  +       +L  F  Y  +++ L   
Sbjct: 120 DESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLKIMRILETR 179

Query: 184 YKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSI 243
           Y LEPAGSHGVWGLDD+    ++ GA QL   +  L P  I N  L+E  ++  L+   I
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLTS-HKHLKPISIHNNELVEMFANRYLYFGCI 238

Query: 244 RFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAF 302
            FIN VK S     HSP+L +IS  V TW K+ +G+IKMY+ EVL+K P++QHF+F + F
Sbjct: 239 DFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-SDF 296

Query: 303 FPWTSYGNNHSLPIYQPAENNDDADF 328
            P     +     I+   + +D+ +F
Sbjct: 297 LPCPEGVSPPRGHIHDGTDVDDECNF 322

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  150 bits (379), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 151/293 (51%), Gaps = 10/293 (3%)

Query: 64  VVELLKRLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIE 121
           +  LL +++ ++   P   +   SR+G + +RD+     ++    +  L  +     + E
Sbjct: 55  LCSLLDKVNKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQVDE 114

Query: 122 LSYYISNAFGSKERIDYGTGHELSFLAVIICLD---MLKIETIKGPALLYCFNSYYDVIQ 178
           L+ Y   ++G++ RIDYG+GHEL+F+  +  L+      +E      +L  F  Y DV++
Sbjct: 115 LAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLDVMR 174

Query: 179 KLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNL 238
            L   Y LEPAGSHGVWGLDD+    ++ GA QL   +  L PK I N   +E      L
Sbjct: 175 TLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLA-THKHLKPKSIHNKEFVEMFEKRYL 233

Query: 239 FCKSIRFINVVKSG-PFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297
           +   I FIN VK+      HSP+L +IS  V TW K+ +G++KMYK EVL K P++QHF+
Sbjct: 234 YFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPIMQHFY 292

Query: 298 FGTAFF--PWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTSTSR 348
           FG         S   +HS       E +D A     +    K+P  ++ + ++
Sbjct: 293 FGDFLVCPKGVSEPRSHSHDDSDDFECHDHAHNTWGDCCGIKIPSAIAATEAK 345

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  150 bits (378), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 156/296 (52%), Gaps = 13/296 (4%)

Query: 12  MPEKRIFDSQGTLDFQNSVA---MVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVVELL 68
           +PEKRI        ++NS     ++     L + +   +  QI + I  S  +  +  LL
Sbjct: 2   VPEKRILTENDMEVWKNSATRKDLLNFISTLAESVEGHENSQIVEPISPSIAS--LSSLL 59

Query: 69  KRLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYI 126
             ++ L+D+ P   E   SR+G + +RD+  +   +  + +        +  + +LS Y+
Sbjct: 60  DEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQLEQLSIYL 119

Query: 127 SNAFGSKERIDYGTGHELSFLAVIICL---DMLKIETIKGPALLYCFNSYYDVIQKLILT 183
             ++G+K RIDYG+GHEL+F+  +  L    +  +E      +L  F  Y ++++ L   
Sbjct: 120 DESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVVFLKYLNIMRVLETK 179

Query: 184 YKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSI 243
           Y LEPAGSHGVWGLDD+    ++ GA QL+  +  L P  I N  L+E      L+   I
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLVP-HKHLKPMSIHNEELVELFKDKFLYFGCI 238

Query: 244 RFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWF 298
            FIN VK +     HSP+L +IS  V  W K+ +G+IKMY  EVL K P++QHF+F
Sbjct: 239 SFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPIMQHFYF 293

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  146 bits (368), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 106/345 (30%), Positives = 163/345 (47%), Gaps = 16/345 (4%)

Query: 12  MPEKRIF---DSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVVELL 68
           +PEKR+    D Q   + Q    +++    L   +   +  Q    I  S  +  V  L+
Sbjct: 3   LPEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLENSQYSQPIGGSIQS--VEALI 60

Query: 69  KRLSALIDETPPERMH-SRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYIS 127
           + +   I+  P E    SR+G   +RD       +    + E      +  + +LS Y +
Sbjct: 61  ECVDQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQVAQLSVYFN 120

Query: 128 NAFGSKERIDYGTGHELSFLAVIICL---DMLKIETIKGPALLYCFNSYYDVIQKLILTY 184
            ++G K RIDYG+GHEL+FL  +  L    +  +       +L  F  Y   ++ +   Y
Sbjct: 121 ESWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMKYLKTMRVIETVY 180

Query: 185 KLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSIR 244
            LEPAGSHGVWGLDD+    ++ GA+Q L  +  L PK I N  ++E  S   L+   I 
Sbjct: 181 WLEPAGSHGVWGLDDYHFLPFLFGASQ-LSTHRHLKPKSIHNPEVVEMFSEKYLYFGCID 239

Query: 245 FINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAFF 303
           FIN VK +     HSP+L +IS  V  W K+ QG++KMY  EVL K P++QHF+F + F 
Sbjct: 240 FINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYF-SEFL 297

Query: 304 PW---TSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTS 345
           P     S    HS         +D+      +    K+P  ++ +
Sbjct: 298 PCPEGVSPARKHSHTKEDSCCGHDELRNTWGDCCGIKIPSAIAAT 342

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  143 bits (360), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 156/297 (52%), Gaps = 13/297 (4%)

Query: 13  PEKRIFDSQGT---LDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVVELLK 69
           P+KR+  SQ     +D      ++     L + +   +  Q  + I  S   +    LL 
Sbjct: 3   PQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLENNQYQEPIGASI--DKCCSLLD 60

Query: 70  RLSALIDETP--PERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYIS 127
            + ++  + P   +   SR+G + +R +    + + ++ + +   +   +   EL  Y  
Sbjct: 61  EVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQAEELVAYFV 120

Query: 128 NAFGSKERIDYGTGHELSFLAVIICL-DMLKIETIKG--PALLYCFNSYYDVIQKLILTY 184
            ++G +ERIDYG+GHEL+F+  +  L D    E  +     +L  F  Y ++++ L  TY
Sbjct: 121 ESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKVFIHYLELMRVLETTY 180

Query: 185 KLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCKSIR 244
            LEPAGSHGVWGLDD+    ++ GA+QL   +  L PK I N  L++  +S  L+   I 
Sbjct: 181 WLEPAGSHGVWGLDDYHFLPFLFGASQLAP-HKHLKPKSIHNNELVDMFASRYLYFGCID 239

Query: 245 FINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT 300
           FIN VK +     HSP+L +IS    +W K+ +G+IKMY+ EVL K P++QHF FG+
Sbjct: 240 FINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEVLAKLPIMQHFLFGS 295

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  143 bits (360), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 100/304 (32%), Positives = 154/304 (50%), Gaps = 16/304 (5%)

Query: 12  MPEKRIFDSQGTLDFQNSVA---MVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVVELL 68
           MPEKR+  SQ    + NS     +V     L   I   +  Q+   + +S   N    LL
Sbjct: 1   MPEKRLLSSQDLTIWINSKTKQDLVDFIETLANSIVDYQNSQLSLPLSDSI--NNAFSLL 58

Query: 69  KRLSALIDETPPER----MHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSY 124
           + +  +I+  P E       SR+G + ++ +        E  +         N I ELS 
Sbjct: 59  QDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDPNQIQELSI 118

Query: 125 YISNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPA---LLYCFNSYYDVIQKLI 181
           Y+  ++G+++RIDYG+GHEL+F+  +  L    I  +   +   +L  F  Y ++++ + 
Sbjct: 119 YLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFMEYINIMRIIE 178

Query: 182 LTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCK 241
             Y LEPAGSHGVWGLDD+    ++ GA Q L  +  L P  I N  ++E      ++  
Sbjct: 179 TKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ-LSKHKHLKPISIHNEEMVEMFKDKYMYFG 237

Query: 242 SIRFINVVK-SGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT 300
            I FIN +K +     HSP+L +IS  V  W K+ +G+IKMY  EVL K P++QHF+F +
Sbjct: 238 CIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKLPIMQHFYF-S 295

Query: 301 AFFP 304
            F P
Sbjct: 296 DFLP 299

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,583,259
Number of extensions: 1942350
Number of successful extensions: 5506
Number of sequences better than 10.0: 54
Number of HSP's gapped: 5546
Number of HSP's successfully gapped: 54
Length of query: 353
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 242
Effective length of database: 40,753,473
Effective search space: 9862340466
Effective search space used: 9862340466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)