Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00440g5.710ON35535515050.0
Ecym_40115.710ON4223584661e-53
NDAI0F002305.710ON4862164281e-47
KAFR0D021805.710ON3873054123e-46
AFR294W5.710ON3402174094e-46
KLTH0E00858g5.710ON3243424041e-45
SAKL0E15092g5.710ON3523264051e-45
TDEL0B021005.710ON3403723963e-44
NCAS0G001905.710ON4432263962e-43
Kwal_55.196555.710ON3243253796e-42
Kpol_1043.765.710ON3723443712e-40
YIL154C (IMP2')5.710ON3462223692e-40
Skud_9.145.710ON3512233668e-40
Smik_9.155.710ON3442233623e-39
Suva_9.345.710ON3202223594e-39
CAGL0H06677g5.710ON3383393544e-38
ZYRO0B16500g5.710ON3423433544e-38
TBLA0E017405.710ON3752173232e-33
KNAG0L021805.710ON4392263201e-32
TPHA0E001605.710ON4403442937e-29
ZYRO0G15488gsingletonON525116750.81
CAGL0F01969g8.59ON44867731.6
Kwal_27.99421.517ON35667693.8
AGR303W5.645ON94553704.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00440g
         (355 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON...   584   0.0  
Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON} s...   184   1e-53
NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}...   169   1e-47
KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {O...   163   3e-46
AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic ho...   162   4e-46
KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}...   160   1e-45
SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some...   160   1e-45
TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {O...   157   3e-44
NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}...   157   2e-43
Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}...   150   6e-42
Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON} (1644...   147   2e-40
YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}  IM...   146   2e-40
Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 3...   145   8e-40
Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON} Y...   144   3e-39
Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641...   142   4e-39
CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} simila...   140   4e-38
ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} simi...   140   4e-38
TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.7...   129   2e-33
KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5....   127   1e-32
TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}...   117   7e-29
ZYRO0G15488g Chr7 complement(1259998..1261575) [1578 bp, 525 aa]...    33   0.81 
CAGL0F01969g Chr6 complement(191278..192624) [1347 bp, 448 aa] {...    33   1.6  
Kwal_27.9942 s27 complement(130159..131229) [1071 bp, 356 aa] {O...    31   3.8  
AGR303W Chr7 (1299365..1302202) [2838 bp, 945 aa] {ON} Syntenic ...    32   4.2  

>KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON}
           similar to uniprot|Q753L8 Ashbya gossypii AFR294W
           AFR294Wp and weakly similar to YIL154C uniprot|P32351
           Saccharomyces cerevisiae YIL154C IMP2' Transcriptional
           activator involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 355

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/355 (84%), Positives = 300/355 (84%)

Query: 1   MEEPGRGILNKKLTDDKHLAAPPAFPTIKIEEPEQRGRSRSKTRDTGXXXXXXXXXXXXX 60
           MEEPGRGILNKKLTDDKHLAAPPAFPTIKIEEPEQRGRSRSKTRDTG             
Sbjct: 1   MEEPGRGILNKKLTDDKHLAAPPAFPTIKIEEPEQRGRSRSKTRDTGISSSRSISRSASR 60

Query: 61  XXXKDQAYLKWTILNKDPSERLHLKAKKGNTRDSVSPGQXXXXXXXXXXXXXXXXXXXXX 120
              KDQAYLKWTILNKDPSERLHLKAKKGNTRDSVSPGQ                     
Sbjct: 61  VSIKDQAYLKWTILNKDPSERLHLKAKKGNTRDSVSPGQENGGDEDEDEDEEEFIEDRED 120

Query: 121 XXXXXXXXXXXXXXXXXXIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEA 180
                             IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEA
Sbjct: 121 DGEVSEEEQVSDVENEIEIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEA 180

Query: 181 DKRDIKLEEIQHGIHRAVYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSF 240
           DKRDIKLEEIQHGIHRAVYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSF
Sbjct: 181 DKRDIKLEEIQHGIHRAVYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSF 240

Query: 241 GSVFTNGDTLYIINQCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHP 300
           GSVFTNGDTLYIINQCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHP
Sbjct: 241 GSVFTNGDTLYIINQCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHP 300

Query: 301 YPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           YPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD
Sbjct: 301 YPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355

>Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON}
           similar to Ashbya gossypii AFR294W
          Length = 422

 Score =  184 bits (466), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/358 (34%), Positives = 184/358 (51%), Gaps = 33/358 (9%)

Query: 23  PAFPTIKIEEP-EQRGRSRSKTRDTGXXXXXXXXXXXXXXXXK----DQAYLKWTILNKD 77
           P   TIKIEEP EQRGRSR+K  D                  +    +   L+WTIL  D
Sbjct: 73  PMGVTIKIEEPPEQRGRSRNKQSDATSSFSTSRSRTKLRSLSRVSIAEHELLRWTILRHD 132

Query: 78  PSERLHLKAKKGNTRDSVSPGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 137
           PSERLH  +  G    +   G                                       
Sbjct: 133 PSERLHRDSHAGT---AARFGDISPQTTTVVPAGAAAGIAEDIEDVLSDEEQISDVENDY 189

Query: 138 XIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAK-NAEIKTEADKRDIKLEEIQHGIHR 196
            +D  +DYDLG +VLPNF T I Q LDS   WLA    +I  + +K+ ++++ +++   R
Sbjct: 190 EVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLEN-CKR 248

Query: 197 AVYHMSK-------------GDNITAATSEKGH------SFVVYLDQMDESFAEKIYALV 237
           A+ H++K               +   A S   H      +F++YL+ ++ S +EK+YAL 
Sbjct: 249 AIQHIAKRALSPAPAGAAGQAGHAPLAGSAAAHECPQKKAFLLYLEDLNTSHSEKLYALT 308

Query: 238 YSFGSVFTNGDTLYIINQCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSM 297
           Y+FG+V  N DTLYI+ QCD    D+   + ++ + + +L + T+    LD +D++I ++
Sbjct: 309 YTFGAVLANRDTLYIVVQCD--AADVEAHLVKVREQVAFLLDATSAA--LDHLDIIILTL 364

Query: 298 YHPYPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           +HPYP+ LLTE++ + QPS++IIPLQ    SL  +++ VP LV+RKKLKRS+R+GI D
Sbjct: 365 HHPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTLVVRKKLKRSRRKGIYD 422

>NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}
           Anc_5.710 YIL154C
          Length = 486

 Score =  169 bits (428), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/216 (42%), Positives = 127/216 (58%), Gaps = 12/216 (5%)

Query: 139 IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAV 198
           IDE  +YDLG KVLPNF + I  +LD+ KPW+AK  E     +   +    +  G  RA+
Sbjct: 277 IDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDGGYIRAM 336

Query: 199 YHMSKGDNITA---ATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIIN- 254
             ++KG   +         G  +++Y D   ES     YAL Y  G+V  NGDTLYI++ 
Sbjct: 337 QLLTKGKGASMDFDPMKPAGRCYILYTDLSSES----TYALTYMMGAVLNNGDTLYIVHW 392

Query: 255 QCDDDTNDMLFQMN--RICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHS 312
           +     N+ L Q N  R+  H+ ++F+C + V  +D +DV+I S+ HPYPK LL EM H 
Sbjct: 393 ESSKVANEKLMQENVGRVRKHVMHMFDCVSAV--IDDLDVIILSLTHPYPKHLLNEMIHG 450

Query: 313 LQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRS 348
           L+P SI   L  +L++LQNF+ SVP LVIRKKLKRS
Sbjct: 451 LKPVSIACSLTIILSTLQNFVCSVPTLVIRKKLKRS 486

>KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {ON}
           Anc_5.710 YIL154C
          Length = 387

 Score =  163 bits (412), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 166/305 (54%), Gaps = 22/305 (7%)

Query: 64  KDQAYLKWTILNKDPSERLH-----LKAKKGNTRDS---VSPGQXXXXXXXXXXXXXXXX 115
           +++ +LKWT+L +DPS RL      LK K+G T DS    S                   
Sbjct: 92  REEEFLKWTVLRQDPSMRLFNANEKLKKKEG-TYDSDEIYSSESVEDEDKGDDEDEDEDE 150

Query: 116 XXXXXXXXXXXXXXXXXXXXXXXIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAK-NA 174
                                  IDE +D+DLG KVLPNF   I +VL+S KPW+ +   
Sbjct: 151 ESEDFEEEESDEEQVSDIDNEVEIDEKLDFDLGMKVLPNFCVSINEVLESRKPWVQQYEK 210

Query: 175 EIKTEADKRDIKLEEIQHGIHRAVYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIY 234
           EI++       KL+EI+ G  RA+  ++KG+   ++ +  G S+++++D   ES    IY
Sbjct: 211 EIESVLPDETTKLDEIEDGYIRAIDLVTKGEG--SSKNGDGQSYILFMDLSSES----IY 264

Query: 235 ALVYSFGSVFTNGDTLYIINQCDD----DTNDMLFQMNRICDHIDYLFECTNGVGTLDKI 290
           AL Y  G V  NGDTLYI+N        D   +   + R+     +LF+C +GV  +D +
Sbjct: 265 ALTYVMGCVINNGDTLYIVNWESTLKHIDETIIYNNLKRVKKMTLHLFDCISGV--IDNL 322

Query: 291 DVLICSMYHPYPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKR 350
           DV+I S+ HPYPK LL+EM + L+P ++   L  +L++LQNF+ SVP LV+R+KLKRSKR
Sbjct: 323 DVIIVSLTHPYPKHLLSEMIYGLKPMALCCSLSIMLSTLQNFVCSVPTLVVRRKLKRSKR 382

Query: 351 RGIAD 355
           RG+ D
Sbjct: 383 RGLTD 387

>AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL154C (IMP2')
          Length = 340

 Score =  162 bits (409), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 88/217 (40%), Positives = 133/217 (61%), Gaps = 10/217 (4%)

Query: 139 IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAV 198
           +D  +DYDLG +VLPNF   I QVLD    WLA+    +     R   ++ +Q    RAV
Sbjct: 134 VDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAAR---VDVLQDTCTRAV 190

Query: 199 YHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCDD 258
            H ++    + A    G +F+ YL+ ++ S AEK+YAL Y+FG+V  N DTLYI   C  
Sbjct: 191 RHFARH---SGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVLC-- 245

Query: 259 DTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSLQPSSI 318
           D  D+   +NR+ + + +L +C+     LD +DV++ ++ H YP+ LLTE  H+ +P+ +
Sbjct: 246 DAVDVESHLNRVAEQVAFLLDCS--AAALDDLDVVVLALQHAYPRHLLTETIHAFRPAGL 303

Query: 319 IIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           I+PLQ    SL  +++SVP L++RKKLKR++RRGI D
Sbjct: 304 IVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 49/110 (44%), Gaps = 25/110 (22%)

Query: 1   MEEPGRGILNK---------------------KLTDDKHLAAPPAFPTIKIEEP-EQRGR 38
           M+EP RGILN+                     K    +  ++P    TIKIEEP EQRGR
Sbjct: 1   MDEPSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRRTSSPIGV-TIKIEEPPEQRGR 59

Query: 39  SRSKTRDTG--XXXXXXXXXXXXXXXXKDQAYLKWTILNKDPSERLHLKA 86
           +R+K                        DQ +L+WTIL  DPSERLHL A
Sbjct: 60  TRNKQSGAAFSSSRSRTKSRSRSRVSVTDQEFLRWTILRADPSERLHLGA 109

>KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}
           some similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage
          Length = 324

 Score =  160 bits (404), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/342 (30%), Positives = 159/342 (46%), Gaps = 39/342 (11%)

Query: 3   EPGRGILNKKLTDDKHLAAPPAFPTIKIEEPE--QRGRSRSKTRDTGXXXXXXXXXXXXX 60
           EP R IL   L      A       ++ E P   +RGRSR K   +              
Sbjct: 5   EPKRSIL---LPSKAETAGRDNIRILESEVPSRSERGRSREKKGSSANTAVQHRSRTSSR 61

Query: 61  XXXKDQAYLKWTILNKDPSERLHLKAKKGNTRDSVSPGQXXXXXXXXXXXXXXXXXXXXX 120
                 +YLKWT+L  DPSERL L  K+G                               
Sbjct: 62  LRGDVGSYLKWTVLQHDPSERLLLGTKEG-------------------------AEASDD 96

Query: 121 XXXXXXXXXXXXXXXXXXIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEA 180
                             ID  + YDLG +VLPNF + +  V+ + KPW+AK  +   E 
Sbjct: 97  DEDVSDEEQVSDVENEIDIDAALGYDLGARVLPNFTSSLWDVVQNQKPWVAKFNK-SVEG 155

Query: 181 DKRDIKLEEIQHGIHRAVYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSF 240
               +KLE++Q G  RA+  +  G     A + +G S+++YLD   ESF    YAL+Y F
Sbjct: 156 KDSGVKLEDLQGGYARAI-KIVHGKPQQGAEAREGRSYIIYLDLTPESF----YALLYVF 210

Query: 241 GSVFTNGDTLYIINQCDDDTNDML-FQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYH 299
           G+V  + DTLY+++      N+ L   + R+     YL + ++    L+ ++V++ S+ H
Sbjct: 211 GAVLASNDTLYVVHISQRVPNEQLRANVERLEAEAAYLLDASSA--ALNAVNVVLLSVSH 268

Query: 300 PYPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLVI 341
           PYPK LL E+  +L+P ++ +PL  VL+SLQN++  +P +VI
Sbjct: 269 PYPKHLLNELVIALKPMALCVPLSLVLSSLQNYVCPIPTVVI 310

>SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some
           similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 352

 Score =  160 bits (405), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/326 (34%), Positives = 171/326 (52%), Gaps = 33/326 (10%)

Query: 33  PEQRGRSRSKTRDTGXXXXXXXXXXXXX---XXXKDQAYLKWTILNKDPSERLHLKAKKG 89
           P  RGRSR K    G                   +D++YLKWT+L +DPSERLH   +  
Sbjct: 53  PRGRGRSREKRSSVGGGTSNTRSLSTRSISGSRIEDESYLKWTVLRRDPSERLHKNEE-- 110

Query: 90  NTRDSVSPGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDEHIDYDLGC 149
           N RD  +                                          ID  +DYDLG 
Sbjct: 111 NDRDESA-----------------IDDDDYDEDDVSDEEQISDIENDQEIDSELDYDLGA 153

Query: 150 KVLPNFVTPITQVLDSMKPWLAKNAE-IKTEADKRDIKLEEIQHGIHRAVYHMSKGDNIT 208
           +VLPNF T I+ VL+S KPW  K  + +  +A++  IKL+ +  G  RA+  +++G    
Sbjct: 154 RVLPNFSTSISNVLESNKPWTKKYLQTVDQKAERAKIKLDSLPGGYMRAMSLVTRGK--- 210

Query: 209 AATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCDDDTNDMLFQ-M 267
             +S  G S+++Y D   ES    +YAL Y+ G+V  +GDTLY+++     T   L Q +
Sbjct: 211 GGSSTHGSSYILYADLSSES----MYALTYTLGAVVNSGDTLYVVHVESSTTETRLLQNI 266

Query: 268 NRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSLQPSSIIIPLQTVLA 327
           +++     +L +CT+GV  ++ + V++ S+ HPYPK L+ +M H L+P  +++ L  VL 
Sbjct: 267 DKLTQQTAFLLDCTSGV--VNDLSVVLLSLSHPYPKHLVNQMIHGLKPLLLVVSLSLVLT 324

Query: 328 SLQNFITSVPMLVIRKKLKRSKRRGI 353
           SLQN++ ++P LV+RKKLKRSKRRGI
Sbjct: 325 SLQNYVCNIPTLVVRKKLKRSKRRGI 350

>TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {ON}
           Anc_5.710 YIL154C
          Length = 340

 Score =  157 bits (396), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 184/372 (49%), Gaps = 49/372 (13%)

Query: 1   MEEPG-RGILNKKLTDDKHLAAP-------PAFPTIKIEEPEQRGRSRSKTRDTGXXXXX 52
           M +PG RGIL   LT      +P       PA       E  +RGRSR+K R+ G     
Sbjct: 1   MNKPGYRGIL---LTGTDGSQSPLNVNDNEPAGGVQFDSEQLERGRSRTKIRNNGSSQLS 57

Query: 53  XXXXXXXXXXXK---DQAYLKWTILNKDPSERLHLKAKKGN-TRDSVSPGQXXXXXXXXX 108
                          D+ +LKWT+L +DPS RL L  K    +RD  S  +         
Sbjct: 58  ASSSRSRSRASSRIRDEEFLKWTVLRRDPSMRLQLNQKDDKKSRDEQSDDEDSEELDLED 117

Query: 109 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDEHIDYDLGCKVLPNFVTPITQVLDSMKP 168
                                         IDE   YDLG KVLPNFV  +  VLDS K 
Sbjct: 118 DVSDEEQVTDVDNDFD--------------IDEEFHYDLGMKVLPNFVQSLNDVLDSSKQ 163

Query: 169 WLAKNAEIKTEADKRDIKLEEIQHGIHRAVYHMSKGDNITAATSEKGHSFVVYLDQMDES 228
           W+    E +    + +I L  +  G  RA+  +SKG     +T+++  S+++  D   ES
Sbjct: 164 WIR---EFRANTQEPEIPLATLAGGYKRAMLPLSKG---KGSTTDR--SYILCSDLTSES 215

Query: 229 FAEKIYALVYSFGSVFTNGDTLYII---NQCDDDTNDMLFQMN--RICDHIDYLFECTNG 283
                YAL Y  G++ +NGDTLY++   NQ   D  D   Q N   I ++++++F+    
Sbjct: 216 ----QYALTYVMGALVSNGDTLYVVHWDNQSSSDA-DAKLQKNILTIRENVEHMFDSIGA 270

Query: 284 VGTLDKIDVLICSMYHPYPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLVIRK 343
           V  ++  DV++ S+ HP+PKQLLTEM H LQP ++   L  +L++LQN++ SVP LVIRK
Sbjct: 271 V--IEDFDVVVLSLQHPFPKQLLTEMIHGLQPVALCCSLSMILSTLQNYVCSVPTLVIRK 328

Query: 344 KLKRSKRRGIAD 355
           KLKR+K++GI++
Sbjct: 329 KLKRAKKKGISE 340

>NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}
           Anc_5.710 YIL154C
          Length = 443

 Score =  157 bits (396), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 94/226 (41%), Positives = 136/226 (60%), Gaps = 15/226 (6%)

Query: 139 IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAV 198
           IDE  +YDLG KVLPNF + I  +LD+ KPW+AK  E     +  ++++  +  G  RA+
Sbjct: 224 IDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENDNVEIGRLDGGYLRAM 283

Query: 199 YHMSKGDNI------TAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYI 252
             ++KG         TA  +  G  +++Y D   ES     YAL Y+ G+V  NGDTLY+
Sbjct: 284 QLLTKGKGAYLNTESTATPTPAGRCYILYTDLSSES----TYALTYTMGAVINNGDTLYV 339

Query: 253 INQCDDDTND---MLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEM 309
           ++  + +  D   ML  + RI  H+ ++F+C + V     +  L  S+ HPYPK LL EM
Sbjct: 340 VHSENSNIFDEPLMLKNVGRIRKHVMHMFDCISAVVDDVDVVAL--SLTHPYPKHLLNEM 397

Query: 310 AHSLQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
            H L+P ++ +PL  +L+SLQNF+ SVP LVIRKKLKR+KR+GI D
Sbjct: 398 IHGLKPVALCVPLSIMLSSLQNFVCSVPTLVIRKKLKRAKRKGITD 443

>Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}
           YIL154C (IMP2') - transcription factor [contig 159] FULL
          Length = 324

 Score =  150 bits (379), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 108/325 (33%), Positives = 154/325 (47%), Gaps = 49/325 (15%)

Query: 28  IKIEEPE-----QRGRSRSKTRDTGXXXXXXXXXXXXXXXXKDQAYLKWTILNKDPSERL 82
           I+I E E     +RGRSR K   +                    +YLKWT+L+ DPSERL
Sbjct: 24  IRILESEVPGRGERGRSREKRGSSSNNTAQNRSRTTSRIRGDMGSYLKWTVLHHDPSERL 83

Query: 83  HLKAKKGNTRDSVSPGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDEH 142
            L A+ G                                                 ID  
Sbjct: 84  QLSAQDGKDSSDDE-------------------------EDVSDEEQVSDVDNEINIDAA 118

Query: 143 IDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAVYHMS 202
           + YDLG +VLPNF   +  VL + KPW+AK  E   E +  D+KL+E+Q G  RA+  M 
Sbjct: 119 LGYDLGARVLPNFTNSLWDVLQTEKPWIAKYNETVDE-NNTDVKLDELQGGYARAIQVMH 177

Query: 203 KGDNITAATSEK-----GHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCD 257
                 +A S+K     G S++VYLD   ESF    YAL+Y FG+V +  DTLY+++   
Sbjct: 178 ------SAKSQKTELKPGASYIVYLDLTPESF----YALLYVFGAVLSPNDTLYVVHISP 227

Query: 258 DDTNDML-FQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSLQPS 316
              +D L   + R+     YL + ++    LD + V+I S+ HPYPK LL EM  +L+P 
Sbjct: 228 RVPSDQLRSNVARLRAQTAYLLDASSA--ALDSVSVVILSVSHPYPKHLLNEMVLALKPM 285

Query: 317 SIIIPLQTVLASLQNFITSVPMLVI 341
           ++ +PL  VL+ LQN++  +P +VI
Sbjct: 286 ALCVPLSLVLSVLQNYVCPIPTVVI 310

>Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON}
           (164489..165607) [1119 nt, 373 aa]
          Length = 372

 Score =  147 bits (371), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/344 (29%), Positives = 170/344 (49%), Gaps = 22/344 (6%)

Query: 25  FPTIKIEEPEQRGRSRSKTRDTGXXXXXXXXXXXXXXXXKDQAYLKWTILNKDPSERLHL 84
           F + +IE    R + R+     G                +D+ +LKWT+L +DPS RL  
Sbjct: 38  FDSAQIENDRGRSKRRNGEFRNGSGASLSRSRSRANSRVRDEEFLKWTVLRRDPSMRLRT 97

Query: 85  KAKKGNTRDSVSPGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDEHID 144
             KK     +                                            IDE I 
Sbjct: 98  IRKKNQQGLNKKKHGAEEDDDEEEDEEEEEEEEDDDDDEISDEEQVSDIENENDIDEDIT 157

Query: 145 YDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAVYHMSKG 204
           +DLG KVLPN+   I  +++S K W++            ++ +E+++ G  +A+  +SK 
Sbjct: 158 FDLGTKVLPNYCMSINDIMESSKKWISDYLSRPENLRNDNVHIEKMEGGFVKAMELISKK 217

Query: 205 DN---ITAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCDDDTN 261
           ++     +++ ++G S+++Y D   ES     YAL Y  G++  NGDTLY+++   ++T+
Sbjct: 218 EDSSTSISSSGKEGDSYILYTDLTSES----TYALAYVLGALVNNGDTLYVVHWEGNNTH 273

Query: 262 --------DMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSL 313
                   D +F   RI  H+ +L +C++ V  +D+ID+L+ S+ HPYPK LL EM H L
Sbjct: 274 GVTDTRIYDNIF---RIRKHVMHLLDCSSAV--IDRIDILLISLTHPYPKHLLNEMIHGL 328

Query: 314 QPSSIIIPLQTVL--ASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           +P ++   L  VL  + LQN+++S+PMLVIRKKLKR +++GI +
Sbjct: 329 KPKTLCCSLSVVLSPSGLQNYVSSIPMLVIRKKLKRPRKKGINE 372

>YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}
           IMP2'Transcriptional activator involved in maintenance
           of ion homeostasis and protection against DNA damage
           caused by bleomycin and other oxidants, contains a
           C-terminal leucine-rich repeat
          Length = 346

 Score =  146 bits (369), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/222 (43%), Positives = 136/222 (61%), Gaps = 16/222 (7%)

Query: 139 IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAV 198
           IDE   YDLG KVLPNF T I +VLDS KPW+AK        +  D+ LE++  G  RA+
Sbjct: 136 IDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDGGYVRAM 195

Query: 199 YHMSKGDNITAATSEKGH--SFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIIN-- 254
             ++KG     A +E G+  SF++Y D   ES     YAL Y  G+    GDT+YI++  
Sbjct: 196 QLLTKG-----AGAEAGNQRSFILYTDLSSES----TYALTYLMGAAVNQGDTVYIVHWE 246

Query: 255 -QCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSL 313
                D + M   + RI  H+ +LF+C    G LD +DV++ S+ HPYPK LL EM H L
Sbjct: 247 PSKPTDDSQMFANVARIRKHVMHLFDCV--AGVLDDLDVVVLSLTHPYPKHLLNEMIHGL 304

Query: 314 QPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           +P ++   L  +L++LQNF+ SVP+L +RKKLKR+KR+GI++
Sbjct: 305 KPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGISE 346

>Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 351
           aa] {ON} YIL154C (REAL)
          Length = 351

 Score =  145 bits (366), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 139/223 (62%), Gaps = 18/223 (8%)

Query: 139 IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRD-IKLEEIQHGIHRA 197
           IDE   YDLG KVLPNF T I +VL+S KPW+AK  EI     + + + LE++  G  RA
Sbjct: 141 IDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAK-YEISIRGHENEGVSLEQLDGGYVRA 199

Query: 198 VYHMSKGDNITAATSEKGH--SFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIIN- 254
           +  ++KG     A +E G+  SF++Y D   ES     YAL Y  G+V   GDTLYI++ 
Sbjct: 200 MQLLTKG-----AGAEPGNQRSFILYTDLSSES----TYALTYLMGAVVNQGDTLYILHW 250

Query: 255 --QCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHS 312
                 D + M   + RI  H+ +LF+C    G LD +DV++ S+ HPYPK LL EM H 
Sbjct: 251 EPSKPTDDSQMFANVARIRKHVMHLFDC--AAGVLDDLDVVVLSLTHPYPKHLLNEMIHG 308

Query: 313 LQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           L+P ++   L  +L++LQNF+ SVP+L +RKKLKR+KR+GI++
Sbjct: 309 LKPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGISE 351

>Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON}
           YIL154C (REAL)
          Length = 344

 Score =  144 bits (362), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 137/223 (61%), Gaps = 18/223 (8%)

Query: 139 IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAK-NAEIKTEADKRDIKLEEIQHGIHRA 197
           IDE   YDLG KVLPNF T I +VL+S KPW+AK    I+   D+  + LE++  G  RA
Sbjct: 134 IDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIRGHEDE-GVSLEQLDGGYVRA 192

Query: 198 VYHMSKGDNITAATSEKGH--SFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQ 255
           +  ++KG     A +E G+  SF++Y D   ES     YAL Y  G+V   GDTLYI++ 
Sbjct: 193 MQLLTKG-----AGAEPGNQRSFILYTDLSSES----TYALTYLMGAVVNQGDTLYIVHW 243

Query: 256 CDDDTND---MLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHS 312
                 D   M   + RI  H+ +LF+C    G LD +DV++ S+ HPYPK LL EM H 
Sbjct: 244 EPSKPTDDAQMFANVARIRKHVMHLFDCV--AGVLDDLDVVVLSLTHPYPKHLLNEMIHG 301

Query: 313 LQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           L+P ++   L  +L++LQNF+ SVP+L +RKKLKR+KR+GI +
Sbjct: 302 LKPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGICE 344

>Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641)
           [963 bp, 320 aa] {ON} YIL154C (REAL)
          Length = 320

 Score =  142 bits (359), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 132/222 (59%), Gaps = 19/222 (8%)

Query: 139 IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAV 198
           IDE   YDLG KVLPNF T I  VLDS KPW+AK  E+  E D   + LE +  G  RA+
Sbjct: 113 IDEEFHYDLGMKVLPNFCTSINDVLDSAKPWIAK-YEMGHEND--GVSLERLAGGYVRAM 169

Query: 199 YHMSKGDNITAATSEKG--HSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIIN-- 254
             ++KG     A +E G    F++Y D   ES     YAL Y  G+V   GDTLYI++  
Sbjct: 170 QLLTKG-----AGAEPGAQRCFILYTDLSSES----TYALTYLMGAVLNQGDTLYIVHWE 220

Query: 255 -QCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSL 313
                D   ML  + RI  H+ +LF+C    G LD +DV++ S+ HPYPK LL EM H L
Sbjct: 221 PSTPVDDAQMLANVARIRKHVMHLFDCV--AGVLDDLDVVVLSLTHPYPKHLLNEMIHGL 278

Query: 314 QPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           +P ++   L  +L +LQNF+ SVP L +RKKLKR+KR+GI +
Sbjct: 279 KPVALCCSLSVILGTLQNFVCSVPTLAVRKKLKRAKRKGICE 320

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 17/21 (80%)

Query: 64 KDQAYLKWTILNKDPSERLHL 84
          K++ +LKWT+L +DPS RL +
Sbjct: 47 KEEQFLKWTVLRQDPSMRLRV 67

>CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154c IMP2
          Length = 338

 Score =  140 bits (354), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 113/339 (33%), Positives = 168/339 (49%), Gaps = 24/339 (7%)

Query: 26  PTIKIEEPEQRGRSRSKTRDTGXXXXXXXXXXXXXXXXK----DQAYLKWTILNKDPSER 81
           PT +I+   + GR RS+ + TG                     ++ +LKWT+L +DPS R
Sbjct: 15  PT-EIQFDSEIGRGRSRDKRTGGNGAGRLSLSRSRSRASSRVREEEFLKWTVLRRDPSMR 73

Query: 82  LHLKAKKGNTRDSVSPGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDE 141
           L    KK     S + G                                        IDE
Sbjct: 74  L-TTLKKNKKSGSGTGGDDDDDDDEDDDDEDDDDEEESDEERVSDIENDAE------IDE 126

Query: 142 HIDYDLGCKVLPNFVTPITQVLDSMKPWLAKN-AEIKTEADKRDIKLEEIQHGIHRAVYH 200
              +DLG KVLPNF T I  VL++ KPW+ K  + +  E ++  +  E ++ G  RA+  
Sbjct: 127 EFHFDLGTKVLPNFSTSINDVLENSKPWIQKYLSTLDMEKERAGVNFETLEGGYSRALEL 186

Query: 201 MSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCDDDT 260
           + KG     A  E   ++++  D   ES     YAL Y  GS+ +NGDTLYI++   D T
Sbjct: 187 VRKGKG-AEAHPETSKNYILCTDLSSES----TYALTYVMGSLVSNGDTLYIVHWDGDST 241

Query: 261 ----NDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSLQPS 316
               +  +    R+  H+ +L +C + +  +D +DV+I S+ HPYPK LL EM H L+P 
Sbjct: 242 TSTKDSFIDNALRVKKHVRHLMDCVSVI--VDDLDVVIISLTHPYPKHLLNEMIHGLKPV 299

Query: 317 SIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           ++   L  +L+SLQNF+ SVP LVIRKKLKRS+++GI++
Sbjct: 300 TLACSLSLILSSLQNFVCSVPTLVIRKKLKRSRKKGISE 338

>ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154C IMP2'
           Transcriptional activator involved in maintenance of ion
           homeostasis and protection against DNA damage caused by
           bleomycin and other oxidants contains a C- terminal
           leucine-rich repeat
          Length = 342

 Score =  140 bits (354), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 109/343 (31%), Positives = 160/343 (46%), Gaps = 30/343 (8%)

Query: 17  KHLAAPPAFPTIKIEEPEQRGRSRSKTRDTGXXXXXXXXXXXXXXXXKDQAYLKWTILNK 76
           +H  A P       E+ E RGRSR K                     ++  +LKWT+L +
Sbjct: 26  RHSLAEPGGVQFDSEQLE-RGRSRVKAARGIKSNSGSRSRSRNPSHVRNGEFLKWTVLKR 84

Query: 77  DPSERLHLKAKKGNTRDSVSPGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 136
           DPS RLH K           P                                       
Sbjct: 85  DPSMRLHKK-----------PHGNGIGNNADDEEEEEEDEDQEDEDLVSDEEQVSDVEND 133

Query: 137 XXIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHR 196
             IDE + YD+G +VLPN+   I +VL S K W++     +++   +D+   ++  G  R
Sbjct: 134 LEIDEQMHYDMGTRVLPNYAASINEVLASTKSWIST---YESQETTQDVSFTKLPGGYSR 190

Query: 197 AVYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIIN-- 254
               +S+G     AT+ +  SFV+  D   ES     YAL Y  G++  NGDTLYI++  
Sbjct: 191 CCQLLSRGK---GATTRR--SFVLCTDLTTESH----YALAYVIGALLNNGDTLYIVHWD 241

Query: 255 --QCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHS 312
             Q       +   +  +  H+ +  +C +   +L  +DV++ S+ HPYPK LL+EM ++
Sbjct: 242 GKQPGSSKETLEQSVKSLRQHVLHKLDCASA--SLQDLDVVLLSLSHPYPKHLLSEMIYA 299

Query: 313 LQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
           LQP ++   L  VL +LQNF+ SVP LVIRKKLKRSKR+GI+D
Sbjct: 300 LQPIALCCSLSLVLTTLQNFVCSVPTLVIRKKLKRSKRKGISD 342

>TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.710
           YIL154C
          Length = 375

 Score =  129 bits (323), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/217 (33%), Positives = 123/217 (56%), Gaps = 22/217 (10%)

Query: 139 IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRD-IKLEEIQHGIHRA 197
           +DE   ++ G K+LPNF T I   L+  K W+ +N E + +  + + I L ++ +G  RA
Sbjct: 169 LDEEFQFEQGNKILPNFCTYINLTLEGGKKWI-RNYESQVKGKENEGINLIKLDNGYARA 227

Query: 198 VYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCD 257
           +   SKG   +A     G S+++Y D   ES     YAL Y  GS+  NGD +Y+++   
Sbjct: 228 IEGYSKGKGCSA----DGKSYLLYSDLSSES----TYALAYLIGSIIKNGDMIYLVHWEG 279

Query: 258 DDT-------NDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMA 310
           ++        +D +F+M R   H+ +L +  + +  +D  ++++ S+ HPYPK  L E+ 
Sbjct: 280 NNKKIPEKQLSDNVFRMRR---HVLHLLDAASTI--IDDAEIMMVSLTHPYPKHFLNELI 334

Query: 311 HSLQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKR 347
           H L  S +   L  +L+ LQNF++S+PML++RKKLK+
Sbjct: 335 HGLDISMLCCSLTMILSGLQNFVSSIPMLIVRKKLKK 371

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 8/84 (9%)

Query: 6  RGILNKKLTDDKHLAAPPAFPTIKIEEPEQRGRSRSK-----TRDTGXXXXXXXXXXXXX 60
          RGIL   LT  +       F + +IE    R + R K     +R                
Sbjct: 5  RGIL---LTTPEGTGTAVQFDSEQIENDRGRSKKRFKDKTNTSRSATGGSSISRSRSRAS 61

Query: 61 XXXKDQAYLKWTILNKDPSERLHL 84
             +D+ +LKWT+L KDPS RL L
Sbjct: 62 SRVRDEEFLKWTVLRKDPSMRLIL 85

>KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5.710
           YIL154C
          Length = 439

 Score =  127 bits (320), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 129/226 (57%), Gaps = 23/226 (10%)

Query: 139 IDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAV 198
           IDE   YDLG K LPNF   I +V+ S +PW+ +      E+ ++ I + +++ G  RAV
Sbjct: 228 IDEKFTYDLGTKTLPNFCVSINEVISSAEPWIRQYDADHGESQEK-IDVRDVEGGYVRAV 286

Query: 199 YHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCDD 258
             +++G       S +  +++VY D   ES     YAL+Y  G++  NGDT+Y+++   D
Sbjct: 287 ELLTRG----KGASPQADTYIVYSDLSSESN----YALLYVLGTLVGNGDTVYVVHWHSD 338

Query: 259 ---------DTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEM 309
                    +    +  + R   H   LF+C +   T+D +D+++ S  HPYPK LL EM
Sbjct: 339 RGGGAVTHSEVRSNVRNLRRKALH---LFDCLSA--TVDDLDIVLLSTTHPYPKHLLNEM 393

Query: 310 AHSLQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355
            ++L P ++   L  VL+ LQNF+ SVP  VIRKKLKR+KR+GI+D
Sbjct: 394 INALHPVALCCSLSIVLSLLQNFVCSVPTFVIRKKLKRAKRKGISD 439

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 16/19 (84%)

Query: 65  DQAYLKWTILNKDPSERLH 83
           ++ +LKWT+L +DPS RLH
Sbjct: 139 EEEFLKWTVLRQDPSMRLH 157

>TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}
           Anc_5.710 YIL154C
          Length = 440

 Score =  117 bits (293), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 162/344 (47%), Gaps = 72/344 (20%)

Query: 65  DQAYLKWTILNKDPSERLHLK-AKKGNTRDSVSPGQXXXXXXXXXXXXXXXXXXXXXXXX 123
           D+ +LKWT+L KDPS RL  + A  G  RD                              
Sbjct: 112 DEEFLKWTVLRKDPSMRLKFRRANDGAHRD----------HSNEDLEDDDDEYFDEDDDE 161

Query: 124 XXXXXXXXXXXXXXXIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAE--IKTEAD 181
                          ID+   +DLG KVLPN+   I +VL+  KPW +   E  +K + D
Sbjct: 162 ISDEEQVSDLENELEIDD-FTFDLGMKVLPNYCISINEVLERSKPWKSAYNEDLVKNKID 220

Query: 182 -KRDIKLEEIQHGIHRAVYHMSKG----DNI-----------------------TAAT-- 211
              ++ + E++ G  +A+  +SK     D+I                       T+AT  
Sbjct: 221 PNANVLINELEGGFVKAMELISKNNKYDDDIDSGSGSFSSNSELNKQDSEHHASTSATIA 280

Query: 212 -------------SEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCDD 258
                        S+ G SF++Y D   ES     YAL Y  G++  N DTLYI++    
Sbjct: 281 SSNTNNTTSSSGSSDSGDSFILYTDLSSES----TYALTYVMGTLVKNNDTLYIVHWEGS 336

Query: 259 DTND-------MLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAH 311
            T++       M   + +I +++ YL +C N +  +D++DV++ SM HPYPK  L EM +
Sbjct: 337 TTSNNDAMKKKMTSNLQKIRENVMYLNDCNNSI--IDRLDVVVISMTHPYPKHFLNEMIY 394

Query: 312 SLQPSSIIIPLQTVL--ASLQNFITSVPMLVIRKKLKRSKRRGI 353
            L+P S+I  L  +L  + LQN++ S+P+LVIRKKLKR++RRGI
Sbjct: 395 GLKPKSLICSLNIMLSPSGLQNYVCSIPVLVIRKKLKRTRRRGI 438

>ZYRO0G15488g Chr7 complement(1259998..1261575) [1578 bp, 525 aa]
           {ON} some similarities with uniprot|O13297 Saccharomyces
           cerevisiae YPL228W CET1 Interacts with Ceg1p the mRNA
           capping enzyme alpha subunit removes gamma-phosphate
           from triphosphate-terminated RNA mRNA capping enzyme
           beta subunit (80 kDa) RNA 5'-triphosphatase
          Length = 525

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 24/116 (20%)

Query: 212 SEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFT----NGDTLYIINQCDDDTNDMLFQM 267
           +EKG      L+ +  S  E  +A+++ +   +T     G+ LY++   D D   +++  
Sbjct: 195 TEKG------LEHLRTSVKEGSFAILFRYDRFYTLHKEKGELLYLV--VDKDLPGVVWHS 246

Query: 268 NRICDHIDYLF----------ECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSL 313
            R  D ++  F          E T  V   D ID  I S+Y PY  ++  EM + +
Sbjct: 247 LRSVDGVNDTFYSGDFKAVDDELTKNVQ--DWIDTTIASVYEPYRSKIEVEMKYGI 300

>CAGL0F01969g Chr6 complement(191278..192624) [1347 bp, 448 aa] {ON}
           similar to uniprot|Q12110 Saccharomyces cerevisiae
           YLR049c
          Length = 448

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 277 LFECTNGVGTLDKIDVLICSM-YHPYPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITS 335
           L++C + V TL+ +D+++ SM YH     LL +M +++            L ++ N I S
Sbjct: 369 LYQCPHDVATLELLDIVVVSMHYHELQTVLLDQMLNAILQECHFKFFHESLHAINNEIKS 428

Query: 336 VPMLVIR 342
             + V R
Sbjct: 429 TELDVFR 435

>Kwal_27.9942 s27 complement(130159..131229) [1071 bp, 356 aa] {ON}
           YJR068W (RFC2) - Subunit 2 of Replication Factor C;
           homologous to human RFC 37 kDa subunit [contig 43] FULL
          Length = 356

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 186 KLEEIQHGIHRAVYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFT 245
           KL++IQ  +H  +     G    AA   + H F +  D    SF  ++  L++   S  T
Sbjct: 277 KLDDIQAYVHELIKSGWSG----AAVVSQLHDFYINSDHYSTSFKNEVSWLIFDADSKLT 332

Query: 246 NGDTLYI 252
           NG   +I
Sbjct: 333 NGSNEHI 339

>AGR303W Chr7 (1299365..1302202) [2838 bp, 945 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR048C (RAT1)
          Length = 945

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 6/53 (11%)

Query: 160 TQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAVYHMSKGDNITAATS 212
           T+ LD++K    +N   +T +D RD   EE++  I      +SKGDN++AA S
Sbjct: 470 TKALDALKRRSDENRTQRT-SDTRDFSQEELESAIE-----VSKGDNLSAAAS 516

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,169,899
Number of extensions: 1269685
Number of successful extensions: 3189
Number of sequences better than 10.0: 25
Number of HSP's gapped: 3204
Number of HSP's successfully gapped: 43
Length of query: 355
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 244
Effective length of database: 40,753,473
Effective search space: 9943847412
Effective search space used: 9943847412
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)