Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00418g5.711ON64264232500.0
SAKL0E15114g5.711ON64962026450.0
KLTH0E00836g5.711ON64160924950.0
CAGL0H06699g5.711ON65062524820.0
Kwal_55.196495.711ON64159324790.0
TDEL0B020905.711ON64361624760.0
Ecym_40105.711ON64459024660.0
KAFR0D021705.711ON66061924020.0
ZYRO0B16522g5.711ON64361723970.0
AFR295W5.711ON63159023890.0
TPHA0E001505.711ON64662123520.0
Kpol_1043.775.711ON65763023400.0
NCAS0G001805.711ON65460622770.0
TBLA0E017505.711ON66561822470.0
NDAI0F002105.711ON65361922240.0
YIL155C (GUT2)5.711ON64960021410.0
Skud_9.135.711ON64960021320.0
Smik_9.145.711ON65259721140.0
KNAG0L021905.711ON64559320800.0
Suva_9.325.711ON53854219620.0
Suva_10.5264.276ON114446810.42
Skud_12.4944.276ON114846752.3
YLR410W (VIP1)4.276ON114646752.4
KNAG0B062704.276ON118346743.1
TPHA0G015808.681ON77098725.0
Kpol_1065.323.339ON150681717.0
KLLA0D18667g8.402ON68581708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00418g
         (642 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...  1256   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...  1023   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   965   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   960   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   959   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   958   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   954   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   929   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   927   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   924   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   910   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   905   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   881   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   870   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   861   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   829   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   825   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   818   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   805   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   760   0.0  
Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR41...    36   0.42 
Skud_12.494 Chr12 (877731..881177) [3447 bp, 1148 aa] {ON} YLR41...    33   2.3  
YLR410W Chr12 (937541..940981) [3441 bp, 1146 aa] {ON}  VIP1Inos...    33   2.4  
KNAG0B06270 Chr2 (1231820..1235371) [3552 bp, 1183 aa] {ON} Anc_...    33   3.1  
TPHA0G01580 Chr7 complement(322799..325111) [2313 bp, 770 aa] {O...    32   5.0  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    32   7.0  
KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]...    32   8.3  

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score = 1256 bits (3250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/642 (94%), Positives = 608/642 (94%)

Query: 1   MFAAKRXXXXXXXXXXXXXXXXXXXXMVNQSRDTNTLQNDVSVSTIKKSNVDLPSRANLL 60
           MFAAKR                    MVNQSRDTNTLQNDVSVSTIKKSNVDLPSRANLL
Sbjct: 1   MFAAKRASKVLLGSAVSAAAVFGAVSMVNQSRDTNTLQNDVSVSTIKKSNVDLPSRANLL 60

Query: 61  SRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDFASGTSSKSTKMAHGGVRY 120
           SRLSKTDKFDV              DASTRGLNVALVEMNDFASGTSSKSTKMAHGGVRY
Sbjct: 61  SRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTKMAHGGVRY 120

Query: 121 LEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYVGTKMYD 180
           LEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYVGTKMYD
Sbjct: 121 LEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYVGTKMYD 180

Query: 181 LFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAITAIEKGA 240
           LFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAITAIEKGA
Sbjct: 181 LFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAITAIEKGA 240

Query: 241 TVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQMDQSPT 300
           TVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQMDQSPT
Sbjct: 241 TVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQMDQSPT 300

Query: 301 GLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRV 360
           GLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRV
Sbjct: 301 GLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRV 360

Query: 361 MFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDVLSAWAGI 420
           MFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDVLSAWAGI
Sbjct: 361 MFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDVLSAWAGI 420

Query: 421 RPLVKDPRKADSGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQ 480
           RPLVKDPRKADSGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQ
Sbjct: 421 RPLVKDPRKADSGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQ 480

Query: 481 FNSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDP 540
           FNSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDP
Sbjct: 481 FNSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDP 540

Query: 541 RNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLD 600
           RNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLD
Sbjct: 541 RNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLD 600

Query: 601 AKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642
           AKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV
Sbjct: 601 AKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/620 (76%), Positives = 553/620 (89%), Gaps = 7/620 (1%)

Query: 30  QSRDTNTLQNDVSVST-IKKSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDAS 88
           Q +  + + NDV+V+  ++KS ++LP+R +LLS+LSKT++FDV              DA+
Sbjct: 30  QQQQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAA 89

Query: 89  TRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLN 148
           TRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLV+EALNERAHML 
Sbjct: 90  TRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLY 149

Query: 149 TAPHLCKILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDA 208
           TAPHLCKILPIMIPVYNYWQ PYFYVG KMYDLFAGSQNLKSSY+L+ SRA+EVAPMLDA
Sbjct: 150 TAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDA 209

Query: 209 SKLKAGLVYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDR 268
           SKLKAGLVYHDGSFNDSRMN++LA+TA+EKGATVLNY+++KQL+KN++TGKVEGA+A DR
Sbjct: 210 SKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDR 269

Query: 269 ETGDEYQIKAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKM 328
           ETG+ ++IKAKVVVNATGP+SDR+LQMD+   GLPDD +LQ  N NAT+S+K+AV NP+M
Sbjct: 270 ETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAVANPQM 329

Query: 329 VVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTA 388
           VVPSAGVHIVLPSFYCPKEIGLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTA
Sbjct: 330 VVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTA 389

Query: 389 TEADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADS------GSGSTQQLVR 442
           TEADIQDILKELQHYI FPVKREDVLSAWAGIRPLVKDPRK          + STQ+LVR
Sbjct: 390 TEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVR 449

Query: 443 SHFLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPN 502
           SHFLFTS ++LVTI+GGKWTTYREM+EETI+EVVKVG+FN+KPC+T+KLKL G EN++PN
Sbjct: 450 SHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPN 509

Query: 503 LSALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDY 562
           L A+L+Q+YHLSS M+E+LANNYGTRAPLICELF +D +NKLP+A  G+ENV+V+G+VD+
Sbjct: 510 LPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDF 569

Query: 563 DSFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWD 622
           DSFRYP+TIGELKYS+  EY R  LDFLMRRTRYAFLDAKQAL AV+GTVKVMGDEL WD
Sbjct: 570 DSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWD 629

Query: 623 SKKRQDEIQQATEYIKTFGV 642
           S +RQ+E ++ATE+IKTFGV
Sbjct: 630 SNRRQEEREKATEFIKTFGV 649

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/609 (73%), Positives = 524/609 (86%), Gaps = 4/609 (0%)

Query: 38  QNDVSVST-IKKSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVAL 96
            N+V VS  +K     +PSR+ LL +++KTD+FDV              D +TRGLNVAL
Sbjct: 33  HNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVAL 92

Query: 97  VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKI 156
           VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER HMLNTAPHLCK+
Sbjct: 93  VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKV 152

Query: 157 LPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLV 216
           LPIMIPVYNYWQVPYFYVG KMYDLFAGSQNLKSSY+++  RASEVAPMLDAS LKAGLV
Sbjct: 153 LPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLV 212

Query: 217 YHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQI 276
           YHDGSFNDSRMN++LA+TAIE+GATVLNY+++ +L+KN++TG+VEGA+A DRETG E++I
Sbjct: 213 YHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRI 272

Query: 277 KAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINE-NATVSTKIAVPNPKMVVPSAGV 335
            AKVVVN+TGP+SDR+LQMD +  GLP + ++Q  NE + ++ +++AV NP+MVVPSAGV
Sbjct: 273 NAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGV 332

Query: 336 HIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQD 395
           HIVLP+FYCPK+IGLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTATEADIQD
Sbjct: 333 HIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQD 392

Query: 396 ILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADSGS--GSTQQLVRSHFLFTSPSNL 453
           ILKELQHYI FPVKREDVLSAWAGIRPLV+DPR    G    STQ LVR+HFLFTS + L
Sbjct: 393 ILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGL 452

Query: 454 VTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLSALLSQKYHL 513
           VTI+GGKWTTYREMAEETIDEVVK G F +KPC+TKK+KL G E W+PN  A+L+Q+YHL
Sbjct: 453 VTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHL 512

Query: 514 SSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGE 573
           SS M+EHLANNYGTR+P+ICE+F  D +N+LPV   G+ENV+V+ +V++DSFRYP+TI E
Sbjct: 513 SSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAE 572

Query: 574 LKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQA 633
           LKYS+KYEY R  LDFLMRRTR+ FLDAKQAL AV+GTV +MGDELGWD  KR  EIQQA
Sbjct: 573 LKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQA 632

Query: 634 TEYIKTFGV 642
           +++IKTFGV
Sbjct: 633 SDFIKTFGV 641

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/625 (73%), Positives = 527/625 (84%), Gaps = 11/625 (1%)

Query: 27  MVNQSRDTNTL-QNDVS-VSTIKKSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXXXXX 84
           + N   + N L  NDVS +S ++K +V LP+R  LL +LS+T++FDV             
Sbjct: 28  VANHYNNNNKLISNDVSLISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCA 87

Query: 85  XDASTRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERA 144
            DA+TRGLNVALVE NDFASGTSSKSTKMAHGGVRYLEKAFWE+SKAQLDLVIEALNERA
Sbjct: 88  LDAATRGLNVALVEKNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERA 147

Query: 145 HMLNTAPHLCKILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAP 204
           H+LNTAPHLCK+LPI+IPVYNYWQVPYFY G KMYDLFAGSQNLK SYL+S +   EVAP
Sbjct: 148 HLLNTAPHLCKLLPIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAP 207

Query: 205 MLDASKLKAGLVYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAI 264
           MLD S LKAGLVYHDGSFND+RMN++LA+TAIE  ATVLNY+++KQLVK+K+ GKV GA+
Sbjct: 208 MLDGSNLKAGLVYHDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKDKD-GKVAGAV 266

Query: 265 AVDRETGDEYQIKAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQK----INENATVST- 319
             DRETG  Y ++AKVVVNATGPYSDRLLQMD +P GLPD+ V+QK    I+ NATV + 
Sbjct: 267 VEDRETGKTYSVRAKVVVNATGPYSDRLLQMDANPDGLPDE-VVQKTEPIIDGNATVKSI 325

Query: 320 --KIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDI 377
             ++AV  P MVVPSAGVHI+LPSFYCPKE+GLLDA+TSDGRVMFFLPWQGKVLAGTTDI
Sbjct: 326 MSQVAVTKPNMVVPSAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDI 385

Query: 378 PMKQIPENPTATEADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADSGSGST 437
           P+KQ+PENPTATEADIQDILKELQ YI FPVKREDVLSAWAGIRPLV DPRK     GST
Sbjct: 386 PLKQVPENPTATEADIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRKKSKADGST 445

Query: 438 QQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGE 497
           Q LVRSHF+FTS   LVTI+GGKWTTYR MAEETIDEVVK G+F++KPC+T+KLKL G E
Sbjct: 446 QGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEETIDEVVKNGKFDAKPCITRKLKLAGAE 505

Query: 498 NWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVF 557
           NW+PNL ALL+QKYHLS  MS +LA NYGTRAPLICE+F+EDP N+LP+ LA +E   V 
Sbjct: 506 NWDPNLPALLAQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVL 565

Query: 558 GHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGD 617
           GHVD+DSFRYP TI ELKY++KYEYAR  LDFLMRRTR+AFLDAKQALNAVEGTV++MGD
Sbjct: 566 GHVDFDSFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGD 625

Query: 618 ELGWDSKKRQDEIQQATEYIKTFGV 642
            LGWD ++RQDEI+ +TE+IKTFGV
Sbjct: 626 SLGWDEQRRQDEIRYSTEFIKTFGV 650

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/593 (74%), Positives = 517/593 (87%), Gaps = 3/593 (0%)

Query: 53  LPSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDFASGTSSKSTK 112
           LP+R+ LL +++KT++FDV              DA+TRGLNVALVEMNDFASGTSSKSTK
Sbjct: 49  LPTRSELLEKMAKTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSKSTK 108

Query: 113 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYF 172
           MAHGGVRYLEKAFWELSKAQLDLVIEALNER HMLNTAPHLCK+LPIMIPVYNYWQVPYF
Sbjct: 109 MAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYF 168

Query: 173 YVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLA 232
           YVG KMYDLFAGSQNLKSSY++S  RASEVAPMLDAS LKAGLVYHDGSFNDSRMN++LA
Sbjct: 169 YVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALA 228

Query: 233 ITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRL 292
           +TAIE+GATVLNY+++ QLVKN ++G++EGA+  DRETG+E++IKAKVVVN+TGP+SDRL
Sbjct: 229 VTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRL 288

Query: 293 LQMDQSPTGLPDDSVLQKINE-NATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLL 351
           LQMD +  G P + ++Q  NE + ++ ++IAV NP+MVVPSAGVHIVLP+FYCPKEIGLL
Sbjct: 289 LQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLL 348

Query: 352 DAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKRE 411
           DA+TSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTATEADIQDILKELQHYI FPVKR 
Sbjct: 349 DAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRG 408

Query: 412 DVLSAWAGIRPLVKDPRKADSGS--GSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAE 469
           DVLSAWAGIRPL++DPR    G    STQ LVR+HFL+TS + LVTI+GGKWTTYREMAE
Sbjct: 409 DVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAE 468

Query: 470 ETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRA 529
           ETIDEVVK G+F +KPC+TKK+KL G E W+PN  A+L+Q+YHLSS M+EHLANNYGTR+
Sbjct: 469 ETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRS 528

Query: 530 PLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDF 589
           P+ICE+F  D +N+LPV   G+ENV+V+ +V++DSFRYP+TIGELKYS++YEY R  LDF
Sbjct: 529 PIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALDF 588

Query: 590 LMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642
           LMRRTR+ FLDA+QAL AV+GTV VMGDELGW   +RQ E QQA+E+IKTFG+
Sbjct: 589 LMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/616 (72%), Positives = 530/616 (86%), Gaps = 5/616 (0%)

Query: 29  NQSRDTNTLQNDVSV-STIKKSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDA 87
           N S +   + NDV++ S +   NV LPSR +LLS+LSKTD+FDV              DA
Sbjct: 31  NDSVEQRRIANDVALQSAVDTPNVKLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDA 90

Query: 88  STRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHML 147
           +TRGLNVALVEM+DFASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNER HML
Sbjct: 91  ATRGLNVALVEMHDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHML 150

Query: 148 NTAPHLCKILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLD 207
           NTAPHLCKILPIMIPVY YWQ+PYFYVG KMYDLFAGSQNLK+SYLL+  +A+++APMLD
Sbjct: 151 NTAPHLCKILPIMIPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLD 210

Query: 208 ASKLKAGLVYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVD 267
            + LKAGLVYHDGSFNDSRMN++LA+TAIE GATVLNY+++KQL+K+KETGKV+GA+  +
Sbjct: 211 PTTLKAGLVYHDGSFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTN 270

Query: 268 RETGDEYQIKAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKIAVPNPK 327
           RETG+++ +KAKV VNATGPYSD+LLQMD++  G PD +   K   NAT+STK+AV NPK
Sbjct: 271 RETGEQFTVKAKVTVNATGPYSDKLLQMDENKDGKPDPT---KPLPNATISTKVAVENPK 327

Query: 328 MVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPT 387
           MVVPSAGVHI+LPSFYCP+E+GLLD +TSDGRVMFFLPWQGKVLAGTTDIPMKQ+P+ PT
Sbjct: 328 MVVPSAGVHIILPSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPT 387

Query: 388 ATEADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADSGS-GSTQQLVRSHFL 446
           A E+DIQDIL+ELQHYI FPVKREDVLSAWAGIRPLV DPRK+   + GSTQ LVRSH  
Sbjct: 388 AAESDIQDILQELQHYIKFPVKREDVLSAWAGIRPLVIDPRKSQGNTGGSTQGLVRSHLC 447

Query: 447 FTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLSAL 506
           FT+ + +VTI+GGKWTTYREMAEETI+EVVKVG+FN KPC+T+KLKL G ENWNPNL+AL
Sbjct: 448 FTTDNGMVTIAGGKWTTYREMAEETINEVVKVGKFNVKPCITRKLKLSGAENWNPNLAAL 507

Query: 507 LSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFR 566
           L+QKYHLS AMS HL+ NYGTRAPLICE+F ED RN+LPV   G+ENV+V+G+V++DSFR
Sbjct: 508 LAQKYHLSGAMSNHLSENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFR 567

Query: 567 YPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKR 626
           YP+TIGEL YS+ YEY R  LDFLMRRTR+AFLDA+QAL+AVEGTV VMGD+L WDS +R
Sbjct: 568 YPFTIGELNYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRR 627

Query: 627 QDEIQQATEYIKTFGV 642
           + EI+++ E+I+TFGV
Sbjct: 628 KHEIEKSKEFIRTFGV 643

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/590 (76%), Positives = 516/590 (87%), Gaps = 7/590 (1%)

Query: 54  PSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDFASGTSSKSTKM 113
           PSRA LL +L KTD+FDV              DA+TRGLNVAL+EMND+ASGTSSKSTKM
Sbjct: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120

Query: 114 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFY 173
           AHGGVRYLEKAFWELSKAQLDLVIEALNERAHML+TAPHLCKILPIMIPVY +WQVPYFY
Sbjct: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180

Query: 174 VGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAI 233
           VGTKMYD FAG QNLKSSYLLS + AS+VAPMLDASKLKAGLVYHDGSFNDSRMNS+LA+
Sbjct: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240

Query: 234 TAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLL 293
           TAIE GAT+LNY+++KQL+KN ETGKVEGAIAVDRETG +Y +KAKVVV+ATGP+SDR+L
Sbjct: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300

Query: 294 QMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDA 353
           QM+  P GLPDD  L K NE AT++TK+AV +PKMVVPS+GVHI+LPSFYCPK++GLLDA
Sbjct: 301 QMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDA 360

Query: 354 QTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDV 413
           +TSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTATEADIQDILKELQHYI FPVKREDV
Sbjct: 361 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDV 420

Query: 414 LSAWAGIRPLVKDPRKADSGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETID 473
            SAWAGIRPLVKDPRK +S    TQ LVRSHFLFTS S LVTISGGKWTTYREMA+ETID
Sbjct: 421 QSAWAGIRPLVKDPRKDNS---DTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETID 477

Query: 474 EVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLI 532
           EVVKVG F N+KPC+T+K+KLVG ENW+PNL A+LSQ+Y+L   +SE+L+ NYGT+A  I
Sbjct: 478 EVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAI 537

Query: 533 CELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMR 592
           CE+F  D RN+LPV+LA ++  +   +VDYD+FRYP+T+GELKY+++ EYAR  LDFLMR
Sbjct: 538 CEIFQSDKRNQLPVSLAAEKAAA---NVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMR 594

Query: 593 RTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642
           RTRYAFLDAKQA+ AV GTVK+MGDELGWDS KR+ E + A E+IKTFGV
Sbjct: 595 RTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/619 (71%), Positives = 516/619 (83%), Gaps = 24/619 (3%)

Query: 43  VSTIKKSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDF 102
           +S + K +V+LP+R +L+S+L+KT++FDV              DA+TRGLNVALVE  DF
Sbjct: 47  ISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDF 106

Query: 103 ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIP 162
           ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAH+LNTAPHLCKILPIMIP
Sbjct: 107 ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIP 166

Query: 163 VYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSF 222
           VYNYWQ+PYFY G KMYDLFAGSQNLKSSYLLS   A++VAPMLD +KLKAGLVYHDG+F
Sbjct: 167 VYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTF 226

Query: 223 NDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVV 282
           NDSRMNS+LA+TAIE G+TVLNY+++KQL+K K +GK+EGAI  D ETG +Y IKAKVV+
Sbjct: 227 NDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVI 286

Query: 283 NATGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSF 342
           NATGPYSD +LQMDQ+PTGLP D +   +  N  ++TK++V NPKMVVPSAGVHI+LPSF
Sbjct: 287 NATGPYSDAILQMDQNPTGLP-DPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSF 345

Query: 343 YCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQH 402
           YCPK+IGLLDA+TSDGRVMFFLPWQGKVLAGTTD+PMKQIPENPTATEADIQDILKELQH
Sbjct: 346 YCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQH 405

Query: 403 YINFPVKREDVLSAWAGIRPLVKDPRKAD-SGSGSTQQLVRSHFLFTSPSNLVTISGGKW 461
           YI FPVKREDVLSAWAGIRPLVKDPR  D +G GSTQ LVRSHF+FTS   LVTI+GGKW
Sbjct: 406 YIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKW 465

Query: 462 TTYREMAEETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEH 520
           TTYR MAEET+DE +KVG+F N KPC+T+ +KL GGENWNPNL ALL+Q+YHLSS +S+H
Sbjct: 466 TTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQH 525

Query: 521 LANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVD-----------------YD 563
           LA+NYGTRAP+ICE++ +D +NKLP+ALA   N     H D                 ++
Sbjct: 526 LADNYGTRAPIICEMYAKDRKNKLPIALAANYN----EHEDEIENANDLIYNNERGDVFE 581

Query: 564 SFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDS 623
            FRYP+T+GE+KYS+ YEYA   LDFLMRR+R+AFLDAK+A++AVEGTVK+MGDEL WD 
Sbjct: 582 CFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDE 641

Query: 624 KKRQDEIQQATEYIKTFGV 642
            +R  EI+   +YIKTFGV
Sbjct: 642 SRRHKEIENTIKYIKTFGV 660

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/617 (71%), Positives = 513/617 (83%), Gaps = 4/617 (0%)

Query: 28  VNQSRDTNTLQNDVSV-STIK-KSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXXXXXX 85
           ++  R ++ L N+V V S I  + +V+LPSR +LLS L KTDKFDV              
Sbjct: 29  MDSRRQSSALSNEVPVVSPIDPRPSVNLPSREDLLSNLQKTDKFDVLIIGGGASGAGSAL 88

Query: 86  DASTRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAH 145
           DA+TRGLNVA VE NDFASGTSSKSTKMAHGGVRYLEKA +ELS+AQLDLVIEALNER H
Sbjct: 89  DAATRGLNVACVEANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGH 148

Query: 146 MLNTAPHLCKILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPM 205
           ML TAPHLCKILPIMIPVY+YWQVPYF+ G K+YD FAG QNL+SSYLLS + ASE+APM
Sbjct: 149 MLETAPHLCKILPIMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPM 208

Query: 206 LDASKLKAGLVYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIA 265
           LD SKLKAGLVYHDGSFNDSRMNS+LAI+AIE GATVLNYV++ QL+K+  T KVEGAI 
Sbjct: 209 LDESKLKAGLVYHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIV 268

Query: 266 VDRETGDEYQIKAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKIAVPN 325
            D+ETG +YQ+KAKV VNATGPYSD +LQMD++  GLPD    Q    N +++T++AV  
Sbjct: 269 EDQETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGLPDPQPPQP--ANVSIATEVAVNK 326

Query: 326 PKMVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPEN 385
           P MVVPSAGVHI+LPS+YCPK +GLLD +T+DGRVMFFLPWQGKVLAGTTDIPMK +P+N
Sbjct: 327 PNMVVPSAGVHIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQN 386

Query: 386 PTATEADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADSGSGSTQQLVRSHF 445
           PTATEADIQDIL+ELQHYI FPV+REDVLSAWAGIRPLV DPRK     GST+ LVR+H 
Sbjct: 387 PTATEADIQDILRELQHYIKFPVRREDVLSAWAGIRPLVMDPRKRKDTGGSTEGLVRNHL 446

Query: 446 LFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLSA 505
           +FTS + L+T++GGKWTTYREMAE+TIDEVVK G F+ KPC+T+K+KL GGENW PNLSA
Sbjct: 447 IFTSETGLITLAGGKWTTYREMAEQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSA 506

Query: 506 LLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSF 565
           LL+Q Y LS AMS+HL+NNYGTRAP+ICELF ED RN+LPVA  G+ENV+V  HV++DSF
Sbjct: 507 LLAQHYKLSQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSF 566

Query: 566 RYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKK 625
           RYP+TIGE  YS+++EY+R   DFLMRRTRYAFLDA  AL AVEGTVKVMGDEL WDS +
Sbjct: 567 RYPFTIGEFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSAR 626

Query: 626 RQDEIQQATEYIKTFGV 642
           RQ EI++ TE+IKTFGV
Sbjct: 627 RQREIEECTEFIKTFGV 643

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/590 (74%), Positives = 505/590 (85%), Gaps = 8/590 (1%)

Query: 54  PSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDFASGTSSKSTKM 113
           PSR+ LL +L KT++FDV              DASTRGLNVAL+EMNDFASGTSSKSTKM
Sbjct: 49  PSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTSSKSTKM 108

Query: 114 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFY 173
           AHGGVRYLEKA WELSKAQLDLVIEALNERAH+L TAPHLCK+LPIMIPVY +WQVPYFY
Sbjct: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168

Query: 174 VGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAI 233
           VGTKMYD FAGSQNLKSSYLLS S A EVAPMLDASKLKAGLVYHDGSFNDSRMN+++A+
Sbjct: 169 VGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228

Query: 234 TAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLL 293
           TAIE GATVLNY+++K+L+KN E GKVEGA+A+DRETG EY ++AKVVVNATGP+SDRLL
Sbjct: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288

Query: 294 QMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDA 353
           QMD  P GLPDD +L  IN+++T++T++AV NPKMVVPS+GVHI+LPS+YCPK +GLLDA
Sbjct: 289 QMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDA 348

Query: 354 QTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDV 413
           +TSDGRVMFFLPWQGKVLAGTTDIPMKQ+P NPTATEADIQDILKELQHYI FPVKREDV
Sbjct: 349 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDV 408

Query: 414 LSAWAGIRPLVKDPRKADSGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETID 473
            SAWAGIRPLVKDPRK  S    TQ LVRSH +FTS + +VTISGGKWTTYREMAEET++
Sbjct: 409 QSAWAGIRPLVKDPRKNLS---DTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEETVN 465

Query: 474 EVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLI 532
           EVVKVG+F N+KPC+T+KLKL G E+W+ NL ALLS +Y++   ++EHL+ NYGT+A  +
Sbjct: 466 EVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAAQV 525

Query: 533 CELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMR 592
           CELF +D  N LPV+LA  +  S    +DY++FRYPYTIGELK+++ +EYAR  LDFLMR
Sbjct: 526 CELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIGELKFTMTHEYARTPLDFLMR 581

Query: 593 RTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642
           RTRYAFLDAKQAL AV+GTVKVMGD LGWDS KR  E + A EYIKTFGV
Sbjct: 582 RTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/621 (69%), Positives = 512/621 (82%), Gaps = 11/621 (1%)

Query: 29  NQSRDTNT------LQND-VSVSTIKKSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXX 81
           NQ + TN       +QN+ V  + +   NV++P+R+ L++ L  TD+FDV          
Sbjct: 30  NQLQSTNNWDNASIIQNEAVLANPVDSPNVNIPTRSELVNNLKTTDQFDVLIIGGGATGS 89

Query: 82  XXXXDASTRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALN 141
               DA+TRGLNVALVE +DFASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALN
Sbjct: 90  GSALDAATRGLNVALVEKDDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALN 149

Query: 142 ERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASE 201
           ERAH+L TAPHLCKILPIMIPVY YWQVPYFY G KMYD+FAGSQNLKSSYL+S + A E
Sbjct: 150 ERAHLLYTAPHLCKILPIMIPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACE 209

Query: 202 VAPMLDASKLKAGLVYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVE 261
           +APMLD SKLKAGLVYHDG+FNDSRMNS+LAITAIE GATVLNY+++KQL+K+  + ++ 
Sbjct: 210 IAPMLDESKLKAGLVYHDGTFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLT 269

Query: 262 GAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKI 321
           GAI  D ETG++ QI AKV+VNATGPYSD++LQMD +  G PD+      +   +++TK+
Sbjct: 270 GAIVEDIETGEKIQINAKVIVNATGPYSDKILQMDNNKNGKPDEFTQ---SAETSIATKV 326

Query: 322 AVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQ 381
           AV NP MVVPSAGVHI+LPSFYCP+E+GLLDA TSDGRVMFFLPWQGKVLAGTTDIPMK 
Sbjct: 327 AVQNPHMVVPSAGVHIILPSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKT 386

Query: 382 IPENPTATEADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADSGSGSTQQLV 441
           +PENPTATEADIQDILKELQHYI FPVKREDVLSAWAGIRPLV+DPRK     G+TQ+LV
Sbjct: 387 VPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRKTPK-EGATQELV 445

Query: 442 RSHFLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNP 501
           RSHF+FTS   LVTI+GGKWTTYREMAEETID VVK G+FN KPC T+KLKL GGEN++P
Sbjct: 446 RSHFIFTSDHGLVTIAGGKWTTYREMAEETIDTVVKNGKFNVKPCSTRKLKLAGGENYDP 505

Query: 502 NLSALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVD 561
           NL+ALL+QKYHL S +SEHLANNYGTR+PLIC++F  D  N+LP+ LAG+E   V+G VD
Sbjct: 506 NLAALLAQKYHLPSKLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGTVD 565

Query: 562 YDSFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGW 621
           +DSFRYPY+I E+KY + +EYAR  LDFLMRR+R+AFLDAKQAL +VEGTVK+MGDEL W
Sbjct: 566 FDSFRYPYSIAEVKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNW 625

Query: 622 DSKKRQDEIQQATEYIKTFGV 642
           D ++R+ E   + EYIKTFGV
Sbjct: 626 DEERRKQETDYSIEYIKTFGV 646

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/630 (70%), Positives = 519/630 (82%), Gaps = 18/630 (2%)

Query: 27  MVNQSRDTNTLQNDVSV-STIKKSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXXXXXX 85
           ++  +   N + ND S  S +  ++V LPSR +LLS+L KT +FDV              
Sbjct: 32  LLTNNSSNNAVYNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAI 91

Query: 86  DASTRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAH 145
           DA+TRGLNVALVE ND+ASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNERAH
Sbjct: 92  DAATRGLNVALVEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAH 151

Query: 146 MLNTAPHLCKILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPM 205
           +L TAPHLCKILPIMIPVY YWQVPYFYVGTKMYDLFAGSQNLKSSYLLS S A E+APM
Sbjct: 152 LLYTAPHLCKILPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPM 211

Query: 206 LDASKLKAGLVYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIA 265
           LD+SKLKAGLVYHDGSFNDSRMN++LAI+AIEKGATVLNY+++KQLVK+++T K+ GAI 
Sbjct: 212 LDSSKLKAGLVYHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIV 271

Query: 266 VDRETGDEYQIKAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINENA---------- 315
            D ETG+ YQIKAKV+VNATGPYSD +LQMD +  GLPD  + +K  E            
Sbjct: 272 EDTETGETYQIKAKVIVNATGPYSDTILQMDNNKNGLPD--MFKKEIETGNLKTPLNVIT 329

Query: 316 --TVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAG 373
             ++S ++AV NP MVVPSAGVHI+LPS+YCP E+GLLDA T+DGRVMFFLPWQGKVLAG
Sbjct: 330 PESISKEVAVQNPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAG 389

Query: 374 TTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADSG 433
           TTDIPMK +PENPTATEADIQDILKELQHYI FPVKREDVLSAWAGIRPLV+DPR     
Sbjct: 390 TTDIPMKTVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV--QK 447

Query: 434 SGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKL 493
            G+TQ++VRSHF+FTS + LVTI+GGKWTTYREMAEETIDEVVK G+FN+KPC+T+KLKL
Sbjct: 448 GGATQEVVRSHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKL 507

Query: 494 VGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQEN 553
            G ENW+ NL+ALLSQKY++S+ M+EHLANNYGTR+P+ICE+  E   NKLPV LAG+EN
Sbjct: 508 AGAENWDANLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGREN 567

Query: 554 VSVF-GHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTV 612
            S+   HV YDSFRYPYTI ELKYS+ YEY R  LDFLMRRTRYAFLDAK+AL+AV GTV
Sbjct: 568 ESISNAHVGYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTV 627

Query: 613 KVMGDELGWDSKKRQDEIQQATEYIKTFGV 642
           K+MGD L WD+ +R+ E   AT+YIKTFGV
Sbjct: 628 KIMGDHLNWDNDRREREKVYATDYIKTFGV 657

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/606 (68%), Positives = 499/606 (82%), Gaps = 6/606 (0%)

Query: 43  VSTIKKSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDF 102
           VS +    V LP+R+ LL +L +  +FDV              DA+TRGL VALVE NDF
Sbjct: 49  VSPVDTLQVSLPTRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDF 108

Query: 103 ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIP 162
           ASGTSSKSTKMAHGGVRYLEKAF++LSK+QLDLVIEALNERAH+LNTAPHLCKILPI+IP
Sbjct: 109 ASGTSSKSTKMAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIP 168

Query: 163 VYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSF 222
           VY YWQVPYFY G K+YDLFAG+QNLK+SYLLS S A E+APML+A+ LKA LVYHDGSF
Sbjct: 169 VYTYWQVPYFYAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSF 228

Query: 223 NDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVV 282
           NDSR+N++LAITAIE+GATVLNYV++++L+K+ ETG + G    D ETGD   + +KVVV
Sbjct: 229 NDSRLNATLAITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVV 288

Query: 283 NATGPYSDRLLQMDQSPTGLPDDSVLQ-KINENATVSTKIAVPNPKMVVPSAGVHIVLPS 341
           NATGP+SD++LQMD++PTGLPDD  L  K+     +S+KIAV NP MVVPS+GVHI+LPS
Sbjct: 289 NATGPFSDKILQMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPS 348

Query: 342 FYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQ 401
           +YCPK++GLLD +TSDGRVMFFLPWQGKV+AGTTDIPM Q+PE P A EADIQDILKELQ
Sbjct: 349 YYCPKQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQ 408

Query: 402 HYINFPVKREDVLSAWAGIRPLVKDPRKADSGS----GSTQQLVRSHFLFTSPSNLVTIS 457
           HYI FPVKREDVLSAWAGIRPLV+DPR          GSTQ LVRSHF+FTS + LVTI+
Sbjct: 409 HYIKFPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIA 468

Query: 458 GGKWTTYREMAEETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSA 516
           GGKWTTYREMAEETIDEVVK G F ++KPC+T++LKL G E W+PN+SALLSQKY+L S 
Sbjct: 469 GGKWTTYREMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSM 528

Query: 517 MSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKY 576
           M+ +L++NYGTR+P+ICELF  D  NKLPV LAG+E   + G+ D+++FRYP TIGELKY
Sbjct: 529 MANYLSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKY 588

Query: 577 SLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEY 636
           S++YEYAR  LDFLMRRTR+AFLDAK+AL AV GTVK+MGDE  W S++RQ+E ++  ++
Sbjct: 589 SMRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQF 648

Query: 637 IKTFGV 642
           IK+FGV
Sbjct: 649 IKSFGV 654

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/618 (66%), Positives = 495/618 (80%), Gaps = 13/618 (2%)

Query: 36  TLQNDVSVSTIKKSNVDLPSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVA 95
           +L ++  +  I   +   PSR+ LLS L KT KFDV              DASTRGLNVA
Sbjct: 50  SLNSEEDLQKIANGSYKPPSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVA 109

Query: 96  LVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCK 155
           L+EMNDFAS TSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNER HML TAPHLCK
Sbjct: 110 LMEMNDFASATSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCK 169

Query: 156 ILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGL 215
           ILPIMIPVYNYW+VPYFY G KMYD FAGSQNLKS+YLLS + A ++APMLD  KLKA L
Sbjct: 170 ILPIMIPVYNYWEVPYFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAAL 229

Query: 216 VYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQ 275
           VYHDGSFND+RMN SLA+TAIE GATVLNY+++++L+K+ +TGK++GA   DRET  +Y 
Sbjct: 230 VYHDGSFNDARMNVSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYD 289

Query: 276 IKAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINENATV--------STKIAVPNPK 327
           + AKVVVN+TGP+SD +LQMD++ +G PD  +  K N + +          ++IAV NPK
Sbjct: 290 VMAKVVVNSTGPFSDNILQMDRNKSGYPD--IFDKANIDTSKLPSIDHDNLSRIAVDNPK 347

Query: 328 MVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPT 387
           MVVPSAGVHI+LPS+YCPK++G+LD +T+DGRVMFFLPWQ KVLAGTTDIPMK++PENP 
Sbjct: 348 MVVPSAGVHIILPSYYCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPV 407

Query: 388 ATEADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKA---DSGSGSTQQLVRSH 444
           ATEADI+DIL ELQHY  FPVKREDVLSAWAGIRPLV+DPRK      G  STQ LVRSH
Sbjct: 408 ATEADIEDILSELQHYCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSH 467

Query: 445 FLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLS 504
           F+FTS +NLVTI+GGKWTTYR MAEETIDE +KVGQ  +KP VTK L L GGENW PN +
Sbjct: 468 FIFTSENNLVTIAGGKWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTA 527

Query: 505 ALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDS 564
           ALLSQKYH+ S++S++L+ NYGTRAP+ICEL  +D +N+LPV LAG+E+  + G+VD+ +
Sbjct: 528 ALLSQKYHIPSSLSKYLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQA 587

Query: 565 FRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSK 624
            RYPYT+ E+KY +  EY+R  LDFL+RRTR+ FLDAK+A+NAVEGTV +MGDEL WDS+
Sbjct: 588 LRYPYTVAEVKYCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSE 647

Query: 625 KRQDEIQQATEYIKTFGV 642
           KR  EI+++ EYIKT GV
Sbjct: 648 KRSLEIKKSKEYIKTLGV 665

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/619 (66%), Positives = 504/619 (81%), Gaps = 11/619 (1%)

Query: 35  NTLQNDVS---VSTIKKSNVDLPSRANLLSRLSKTD-KFDVXXXXXXXXXXXXXXDASTR 90
           N  Q+D +   +S ++   ++LPSR+ L ++L+  D +FD+              DA+TR
Sbjct: 35  NNFQSDFNPYLISPVEDVEINLPSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATR 94

Query: 91  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTA 150
           GLNVALVE +DFASGTSSKSTKMAHGGVRYLEKAF + SK+QLDLVIEALNERAH+LNTA
Sbjct: 95  GLNVALVERDDFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTA 154

Query: 151 PHLCKILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASK 210
           PHLCKILPI+IPVYNYWQ+PYFY G K YD FAG QNLKSSYL+S   A E+APMLDA+ 
Sbjct: 155 PHLCKILPILIPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAAN 214

Query: 211 LKAGLVYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRET 270
           LKA LVYHDGSFNDSR+NSS+AITAIE GATVLNYV++++L+K+  + K+ G    D+ET
Sbjct: 215 LKAALVYHDGSFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKET 274

Query: 271 GDEYQIKAKVVVNATGPYSDRLLQMDQSPTGLPD-DSVLQKINENATVSTKIAVPNPKMV 329
           G+   +K+KV+VNATGPYSD +LQMD++ +GLPD  ++  K+ +   +S+KIAV NPKMV
Sbjct: 275 GEISNVKSKVIVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMV 334

Query: 330 VPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTAT 389
           VPS+GVHI+LPS+YCPK++GLLDA+T+DGRVMFFLPWQGKV+AGTTDIPM Q+P+ P A 
Sbjct: 335 VPSSGVHIILPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAK 394

Query: 390 EADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPR----KADSGSGSTQQLVRSHF 445
           E DIQDILKELQHYI FPV+REDVLSAWAGIRPLV+DPR     A    G+TQ LVRSHF
Sbjct: 395 ETDIQDILKELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHF 454

Query: 446 LFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFN--SKPCVTKKLKLVGGENWNPNL 503
           LFTS + L+TI+GGKWTTYREMAEETIDEVVK G F   +KPC TK LKL+G ENW+PNL
Sbjct: 455 LFTSDNGLITIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNL 514

Query: 504 SALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYD 563
            ALLSQK++LSS M+++L+ NYGTR+ +IC+LF  +  NKLPV LAG E+  + G+VD++
Sbjct: 515 VALLSQKFNLSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFN 574

Query: 564 SFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDS 623
           +FRYP TI ELKY++KYEYAR  LDFLMRRTR+A+LDA QAL AV+GTVKVMGDE GWDS
Sbjct: 575 TFRYPITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDS 634

Query: 624 KKRQDEIQQATEYIKTFGV 642
           K+R+ EI+ AT +I++FGV
Sbjct: 635 KRREQEIKNATLFIESFGV 653

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/600 (66%), Positives = 475/600 (79%), Gaps = 16/600 (2%)

Query: 55  SRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDFASGTSSKSTKMA 114
           SR +LL RL+KT +FDV              DA+TRGLNVALVE  DFASGTSSKSTKM 
Sbjct: 54  SRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 113

Query: 115 HGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYV 174
           HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+Y+ WQVPY Y+
Sbjct: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYM 173

Query: 175 GTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAIT 234
           G K YD FAGSQNLK SYLLS S   E APML    LKA LVYHDGSFNDSR+N++LAIT
Sbjct: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233

Query: 235 AIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQ 294
           A+E GATVLNYV++++L+K+  +GKV GA A D ET +  +I AK VVNATGPYSD +LQ
Sbjct: 234 AVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQ 293

Query: 295 MDQSPTGLPDDSVLQKINENATVST---KIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLL 351
           MD++P+GLPD      +N+N+ + +   +IAV +PKMV+PS GVHIVLPSFYCPK++GLL
Sbjct: 294 MDRNPSGLPD----SPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLL 349

Query: 352 DAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKRE 411
           D +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI FPVKRE
Sbjct: 350 DVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRE 409

Query: 412 DVLSAWAGIRPLVKDPRK--ADSGSGS-TQQLVRSHFLFTSPSNLVTISGGKWTTYREMA 468
           DVLSAWAG+RPLV+DPR   AD   GS TQ +VRSHFLFTS + L+TI+GGKWTTYR+MA
Sbjct: 410 DVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469

Query: 469 EETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGT 527
           EET+D+VV+VG F N KPC T+ +KL G E W  N  ALL+Q YHLSS MS +L  NYGT
Sbjct: 470 EETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGT 529

Query: 528 RAPLICELFNEDPRNKLPVALAGQENVSVFGH-----VDYDSFRYPYTIGELKYSLKYEY 582
           R+ +ICE F E   NKLP++LA +EN  ++       V++D+FRYP+TIGELKYS++YEY
Sbjct: 530 RSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEY 589

Query: 583 ARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642
            R  LDFL+RRTR+AFLDAK+ALNAV  TVKVMGDE  W  KKRQ E+++   +IKTFGV
Sbjct: 590 CRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/600 (66%), Positives = 474/600 (79%), Gaps = 16/600 (2%)

Query: 55  SRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDFASGTSSKSTKMA 114
           SR +LL RL+KT +FDV              DA+TRGLNVALVE  DFASGTSSKSTKM 
Sbjct: 54  SRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 113

Query: 115 HGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYV 174
           HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+YN WQVPY Y+
Sbjct: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYM 173

Query: 175 GTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAIT 234
           G K YD FAGSQNLK SYLLS S   E APML    LKA LVYHDGSFNDSR+N++LAIT
Sbjct: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233

Query: 235 AIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQ 294
           A+E GATVLNYV++++L+K+  +GKV GA A D ET +  +I AK VVNATGPYSD +LQ
Sbjct: 234 AVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQ 293

Query: 295 MDQSPTGLPDDSVLQKINENATVST---KIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLL 351
           MD++P+G P+      +N+N+ + +   +IAV +PKMV+PS GVHIVLPSFYCPK++GLL
Sbjct: 294 MDRNPSGQPN----SPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLL 349

Query: 352 DAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKRE 411
           D +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI FPVKRE
Sbjct: 350 DVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRE 409

Query: 412 DVLSAWAGIRPLVKDPRK--ADSGSGS-TQQLVRSHFLFTSPSNLVTISGGKWTTYREMA 468
           DVLSAWAG+RPLV+DPR   AD   GS TQ +VRSHFLFTS + L+TI+GGKWTTYR+MA
Sbjct: 410 DVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469

Query: 469 EETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGT 527
           EET+D+VV+VG+F N KPC T+ +KL G E W  N  ALL+Q YHLSS MS +L  NYGT
Sbjct: 470 EETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGT 529

Query: 528 RAPLICELFNEDPRNKLPVALAGQENVSVFGH-----VDYDSFRYPYTIGELKYSLKYEY 582
           R+ +ICE F E   NKLP++LA +EN  ++       V++D+FRYP+TIGELKYS++YEY
Sbjct: 530 RSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEY 589

Query: 583 ARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642
            R  LDFL+RRTR+AFLDAK+ALN+   TVKVMGDE  W  KKRQ E+++   +IKTFGV
Sbjct: 590 CRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/597 (66%), Positives = 471/597 (78%), Gaps = 10/597 (1%)

Query: 55  SRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDFASGTSSKSTKMA 114
           SR +LL RL KT +FDV              DA+TRGLNVALVE  DFASGTSSKSTKM 
Sbjct: 57  SRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 116

Query: 115 HGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYV 174
           HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+Y+  QVPY Y+
Sbjct: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176

Query: 175 GTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAIT 234
           G K YD FAGSQNLK SYLLS S   E APML    LKA LVYHDGSFNDSR+N++LAIT
Sbjct: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236

Query: 235 AIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQ 294
           A+E GATVLNYV++++L+K+  +GKV GA A D ET +  +IKAK VVNATGPYSD +LQ
Sbjct: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296

Query: 295 MDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDAQ 354
           MD++P+G P DS L   ++  +   +IAV +PKMV+PS GVHIVLPSFYCPK++GLLD +
Sbjct: 297 MDRNPSGQP-DSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVR 355

Query: 355 TSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDVL 414
           TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI FPVKREDVL
Sbjct: 356 TSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVL 415

Query: 415 SAWAGIRPLVKDPRK--ADSGSGS-TQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEET 471
           SAWAG+RPLV+DPR   AD   GS TQ +VRSHFLFTS ++L+TI+GGKWTTYR+MAEET
Sbjct: 416 SAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEET 475

Query: 472 IDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAP 530
           ID+VV+VG F N  PC T+ +KL G E W  N  ALL+Q YHLSS MS +L  NYGTR+ 
Sbjct: 476 IDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSS 535

Query: 531 LICELFNEDPRNKLPVALAGQENVSVFGH-----VDYDSFRYPYTIGELKYSLKYEYARN 585
           +ICE F E   NKLP++LA +EN  ++       V++D+FRYP+TIGELKYS++YEY R 
Sbjct: 536 IICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRT 595

Query: 586 CLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642
            LDFL+RRTR+AFLDAK+ALN+V  TVKVMGDE  W  KKRQ E+++   +IKTFGV
Sbjct: 596 PLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/593 (65%), Positives = 466/593 (78%), Gaps = 10/593 (1%)

Query: 54  PSRANLLSRLSKTDKFDVXXXXXXXXXXXXXXDASTRGLNVALVEMNDFASGTSSKSTKM 113
           P RA +L RL  T KFDV              DAS RGL VALVE  DFA+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 114 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFY 173
           AHGGVRYLEKA +ELSK QLDLV+EALNERAH+L  APHL KILPI+IPVY YW+VPYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 174 VGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAI 233
            G KMYD FAG+QNLKSSYLLS    S +APMLD  KLK GLVYHDG FNDSR+ ++LAI
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 234 TAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLL 293
           +A+E+GATV NYV ++QL+K+K TG + GA   D+ETG  + + AK+VVNATGPYSD++L
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 294 QMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDA 353
           QMD +P GLP+    +   ENA     IAV NPKMVVPS GVHI LPSFYCP E+GLLDA
Sbjct: 298 QMDANPQGLPEKEPEKATPENAL----IAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353

Query: 354 QTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDV 413
            TSDGRVMFFLPWQGKV+AGTTDIP+KQ+P +P+ TEADIQDIL+ELQHYI FPV+REDV
Sbjct: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413

Query: 414 LSAWAGIRPLVKDPRKAD--SGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEET 471
           LSAWAGIRPLV+DPR A+  +GSG T+ LVRSHF+FTSP+ LVTI+GGKWTTYREMAEET
Sbjct: 414 LSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEET 473

Query: 472 IDEVVKVGQFNS-KPCVTKKLKLVGGENWNPNLSALLSQKYH-LSSAMSEHLANNYGTRA 529
           +DEV+KVG+F   KPC T+K KL+G ++WN N  A L Q+Y  L  +++EHLANNYG RA
Sbjct: 474 VDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRA 533

Query: 530 PLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDF 589
           P+ICE+F  D  +KLPV L G  +  V  ++D ++F YP+TI ELKY +++EY R  LDF
Sbjct: 534 PIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALDF 592

Query: 590 LMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642
           L+RR+R+AFLDA++ALNAV+ TV ++GDELGWD++KR  E  +   YIKTFGV
Sbjct: 593 LLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/542 (66%), Positives = 434/542 (80%), Gaps = 16/542 (2%)

Query: 113 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYF 172
           M HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+YN WQVPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 173 YVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLA 232
           Y G K YD FAG QNLKSSYLLS S   E APML    LKA LVYHDGSFNDSR+N++LA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 233 ITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRL 292
           ITA+E GATVLNYV++++L+K+  +GKV GA A D ET +  +I AK VVNATGPYSD +
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 293 LQMDQSPTGLPDDSVLQKINENATVST---KIAVPNPKMVVPSAGVHIVLPSFYCPKEIG 349
           LQMD++ +G P+      +N+N+ + +   ++AV +P+MV+PS GVHIVLPSFYCPK+IG
Sbjct: 181 LQMDRNASGQPN----SPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIG 236

Query: 350 LLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVK 409
           LLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI FPVK
Sbjct: 237 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 296

Query: 410 REDVLSAWAGIRPLVKDPRKADSG---SGSTQQLVRSHFLFTSPSNLVTISGGKWTTYRE 466
           REDVLSAWAG+RPLV+DPR   +G     +TQ +VRSHFLFTS + L+TI+GGKWTTYR+
Sbjct: 297 REDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356

Query: 467 MAEETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNY 525
           MAEETID+VV+VG F N KPC T+ +KL G E W  N  ALL+Q YHLSS MS +L  NY
Sbjct: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416

Query: 526 GTRAPLICELFNEDPRNKLPVALAGQENVSVFGH-----VDYDSFRYPYTIGELKYSLKY 580
           GTR+ +ICE F +   NKLP++LA +EN +++ +     V++D+FRYP+TIGELKYS++Y
Sbjct: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476

Query: 581 EYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTF 640
           EY R  LDFL+RRTR+AFLDAK+ALN+V  TVKVMGDE  W  KKRQ E+++   +IKTF
Sbjct: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536

Query: 641 GV 642
           GV
Sbjct: 537 GV 538

>Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR410W
           (REAL)
          Length = 1144

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 338 VLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 383
           VL  F CPKE G+LDA+  D  ++  LP   ++L    D+  ++ P
Sbjct: 935 VLFDFICPKEYGILDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 980

>Skud_12.494 Chr12 (877731..881177) [3447 bp, 1148 aa] {ON} YLR410W
           (REAL)
          Length = 1148

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 338 VLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 383
           VL  F CPKE G+ DA+  D  ++  LP   ++L    D+  ++ P
Sbjct: 938 VLFDFICPKEYGISDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 983

>YLR410W Chr12 (937541..940981) [3441 bp, 1146 aa] {ON}
           VIP1Inositol hexakisphosphate (IP6) and inositol
           heptakisphosphate (IP7) kinase; IP7 production is
           important for phosphate signaling; involved in cortical
           actin cytoskeleton function, and invasive pseudohyphal
           growth analogous to S. pombe asp1
          Length = 1146

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 338 VLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 383
           VL  F CPKE G+ DA+  D  ++  LP   ++L    D+  ++ P
Sbjct: 937 VLFDFICPKEYGISDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 982

>KNAG0B06270 Chr2 (1231820..1235371) [3552 bp, 1183 aa] {ON} Anc_4.276
            YLR410W
          Length = 1183

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 338  VLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 383
            VL  F CPKE G+ DA+  D  ++  LP   ++L    D+  ++ P
Sbjct: 965  VLFDFICPKEYGIQDAEKLDIGLLTSLPLAKQILNDIDDMKNRESP 1010

>TPHA0G01580 Chr7 complement(322799..325111) [2313 bp, 770 aa] {ON}
           Anc_8.681 YPL158C
          Length = 770

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 46/98 (46%), Gaps = 24/98 (24%)

Query: 241 TVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQI----------------KAKVVVNA 284
           T+ +Y  IK+  ++++TGK E      +   DEY I                K KV+ N 
Sbjct: 524 TMKHYYPIKEETEDEDTGKSENEFG--KSETDEYIIDTSNGMHSVNSEKISNKLKVLENE 581

Query: 285 TGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKIA 322
           T  Y      ++ S + L DD+    +N+N+++ T++A
Sbjct: 582 TDSY------LEDSDSYLDDDTEFVSLNDNSSIETELA 613

>Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {ON}
           complement(65735..70255) [4521 nt, 1507 aa]
          Length = 1506

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 10/81 (12%)

Query: 502 NLSALLSQK-----YHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPV--ALAGQENV 554
           NLS L   K     Y +   + E+L++N     PLI ++ N DP  +L +   LA   ++
Sbjct: 294 NLSQLFKYKNSNNNYDIEKVLKENLSSNSIEILPLILDMINLDPSKRLSIDEILAKYRDI 353

Query: 555 ---SVFGHVDYDSFRYPYTIG 572
                F +  YD FR   T G
Sbjct: 354 IFPDYFYNFTYDYFRNLATAG 374

>KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]
           {ON} similar to uniprot|P15424 Saccharomyces cerevisiae
           YDR194C MSS116 DEAD-box protein required for efficient
           splicing of mitochondrial Group I and II introns
           presumed RNA helicase due to DEAD-box motif
          Length = 685

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 429 KADSGSGSTQQLVR---SHFLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKP 485
           KA +G+G T   +     H + T   N + +     T  R++A +   EV K+ Q N   
Sbjct: 182 KAKTGTGKTLAFLAPLFQHLISTKLQNPLAVKAVIVTPTRDLAIQIASEVKKLQQCNPSL 241

Query: 486 CVTKKLKLVGGENWNPNLSAL 506
              + L L+GG N + +L  L
Sbjct: 242 KSYRSLTLIGGTNLDKSLKDL 262

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,064,123
Number of extensions: 2706705
Number of successful extensions: 7602
Number of sequences better than 10.0: 34
Number of HSP's gapped: 7729
Number of HSP's successfully gapped: 34
Length of query: 642
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 526
Effective length of database: 40,180,143
Effective search space: 21134755218
Effective search space used: 21134755218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)