Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0A00396g5.712ON1012101248410.0
SAKL0E15136g5.712ON1037107221100.0
KLTH0E00814g5.712ON974102920910.0
Kwal_55.196455.712ON970102720810.0
NCAS0G001705.712ON1030105618640.0
CAGL0H06721g5.712ON108176315310.0
YIL156W (UBP7)5.712ON107187313681e-171
AFR296C5.712ON116944913161e-162
NDAI0F002005.712ON110545113061e-162
Ecym_40095.712ON151744212891e-155
TDEL0B020805.712ON102545212501e-154
ZYRO0B16544g5.712ON104484012501e-154
Kpol_2001.785.712ON40342111471e-147
TPHA0D046605.712ON104545111951e-146
Suva_9.305.712ON106248111851e-145
Skud_9.125.712ON106448311781e-144
Smik_9.135.712ON106048611571e-140
Smik_11.3625.712ON72145610291e-126
Suva_11.3355.712ON72444010161e-124
TBLA0E017605.712ON121255310461e-123
YKR098C (UBP11)5.712ON71746510021e-122
Skud_11.3385.712ON7124439991e-121
KAFR0D021605.712ON8464469711e-116
KAFR0H001505.712ON6564808631e-102
CAGL0G02563gsingletonON6314538313e-98
KNAG0L022005.712ON11612667958e-89
Kpol_304.65.712ON5624695605e-61
Ecym_61848.188ON8514472668e-23
TDEL0B042208.188ON8252412524e-21
TBLA0F036108.188ON11442442355e-19
KNAG0D019308.188ON9862432302e-18
Skud_4.3238.188ON9262392283e-18
Kpol_1032.288.188ON8822422273e-18
TPHA0C027708.188ON9702402265e-18
Smik_4.3078.188ON9292742231e-17
YDR069C (DOA4)8.188ON9262392221e-17
KAFR0C025908.188ON9782462193e-17
AFR007W8.188ON8482472184e-17
NDAI0C059008.188ON8265542158e-17
Suva_2.2288.188ON9272392151e-16
CAGL0G05247g8.188ON9472392113e-16
YER144C (UBP5)8.188ON8052442094e-16
KLLA0E10275g8.188ON7962482094e-16
SAKL0H18986g8.188ON8932532061e-15
NCAS0B042808.188ON9222442052e-15
ZYRO0G06798g8.188ON8772402023e-15
Smik_5.3098.188ON8053021971e-14
CAGL0I06765g8.188ON8872671943e-14
KLTH0H07678g8.188ON8612451933e-14
Suva_5.2728.188ON7882831827e-13
Skud_5.2818.188ON8231491755e-12
NDAI0A036808.188ON11161541721e-11
NCAS0A039108.188ON7952411612e-10
KNAG0G015908.188ON6712521551e-09
Kwal_14.20088.188ON4241461476e-09
Kpol_2001.541.137ON12231971381e-07
NCAS0I031401.137ON12011981382e-07
KAFR0F015601.137ON11711981382e-07
AFR627C1.137ON12871981362e-07
Suva_6.2761.137ON1256641362e-07
ZYRO0C17908g1.137ON12042031353e-07
TDEL0C056401.137ON11782031353e-07
ZYRO0B03300g7.390ON8131291334e-07
Smik_10.371.137ON1247731326e-07
CAGL0L01639g1.137ON11472071327e-07
Skud_10.221.137ON1255731327e-07
NDAI0B004801.137ON12531971328e-07
YJL197W (UBP12)1.137ON1254641311e-06
TBLA0J006001.137ON14621291292e-06
Suva_2.507.390ON7501241282e-06
Kwal_33.136281.137ON11601311272e-06
NCAS0D023905.18ON12111071272e-06
Smik_2.497.390ON7451271273e-06
Skud_2.387.390ON7481211263e-06
SAKL0C04246g1.137ON12971401263e-06
KLTH0F03674g1.137ON1198621245e-06
KNAG0C035807.390ON7761231237e-06
YBL067C (UBP13)7.390ON7471251228e-06
ABL145W2.69ON7492581229e-06
Ecym_81401.137ON12642351221e-05
KNAG0E012905.18ON11961161211e-05
TPHA0A025401.137ON1286771202e-05
NDAI0C059508.202ON10801711202e-05
KLLA0C06974g8.742ON4462321182e-05
CAGL0I06600g8.202ON8161711183e-05
KLLA0D08459g2.69ON7501121173e-05
ZYRO0D07062g5.18ON11931151174e-05
Kpol_1045.417.390ON7121121165e-05
NCAS0A143707.390ON7291221165e-05
KNAG0C021801.137ON12312011157e-05
TPHA0E008707.390ON715931149e-05
CAGL0M11198g8.742ON4611071131e-04
KNAG0A019708.540ON4711611121e-04
SAKL0H04994g8.742ON4541391121e-04
TPHA0L022905.18ON11931091131e-04
NDAI0A016707.390ON8461321121e-04
TBLA0B019308.202ON10191701122e-04
NDAI0I025305.18ON11971071122e-04
NCAS0E026107.390ON7171221112e-04
KLLA0C03476g1.137ON1252411122e-04
NDAI0F034102.69ON8701101112e-04
Smik_5.3188.202ON9091761112e-04
TBLA0H036008.540ON4824031102e-04
CAGL0A04477g7.390ON770661102e-04
ZYRO0B11044g8.202ON8261701102e-04
Smik_13.4318.742ON4711421092e-04
Kpol_534.231.369ON496841093e-04
TBLA0C012001.369ON503391093e-04
TPHA0P006807.390ON7271301093e-04
Suva_5.2177.390ON7541241084e-04
Ecym_11668.540ON6962271085e-04
CAGL0I05522g7.390ON7241361085e-04
AGR139C8.202ON7891431075e-04
CAGL0K10494g1.369ON495291066e-04
KNAG0B023707.390ON7531201076e-04
Ecym_46857.390ON7781311076e-04
CAGL0M13783g5.18ON11961061077e-04
NCAS0D006001.369ON493291067e-04
YER151C (UBP3)8.202ON9121741067e-04
TDEL0A016208.202ON7951691068e-04
TBLA0C070205.18ON12471051068e-04
KNAG0C019401.369ON499421040.001
SAKL0G02728g5.443ON1237391040.001
Kpol_513.255.18ON11901071040.001
KLTH0B09944g5.18ON11891151040.002
YFR010W (UBP6)1.369ON499421030.002
KAFR0I026005.18ON12131361030.002
Kpol_1018.937.390ON755611030.002
NDAI0C015505.443ON1295511030.002
NDAI0E041807.390ON8271301030.002
YER098W (UBP9)7.390ON7541441020.002
Suva_13.4955.18ON12301111010.003
TDEL0G004105.18ON11861151010.003
TDEL0C015707.390ON7651281010.003
AGL357W5.18ON11661371000.004
TDEL0D024001.369ON49486990.004
Kwal_34.162681.369ON449138990.004
KAFR0A042108.742ON440133980.005
Ecym_56715.18ON1176123990.005
Smik_7.3141.369ON49942980.005
KLLA0E20351g7.390ON697114990.005
CAGL0K10252g5.443ON126780990.005
AEL242W8.540ON61387980.005
Skud_5.2237.390ON74830980.006
Smik_13.5215.18ON1231112990.006
NCAS0A038408.202ON917156980.006
TBLA0D010708.742ON48354980.006
Skud_6.941.369ON49942980.006
YMR304W (UBP15)5.18ON1230142980.007
TPHA0E017105.443ON128327980.007
YMR223W (UBP8)8.742ON471142970.008
Suva_13.4078.742ON471142970.008
Suva_6.831.369ON50032970.008
TPHA0A025101.369ON50532960.009
SAKL0H00418g5.18ON1190105970.009
Skud_13.3928.742ON473144960.011
Skud_13.4785.18ON1231112960.011
Klac_YGOB_Anc_5.18b5.18ON1166101960.012
Kwal_26.91518.742ON454105950.012
KAFR0C045201.369ON49944950.013
TPHA0J026205.443ON122529960.013
ZYRO0G01188g1.369ON50029950.013
Suva_4.2953.270ON782200950.014
KNAG0G029308.742ON459102940.014
KAFR0L017307.390ON70131950.015
SAKL0F12430g7.390ON75427950.016
Kpol_1016.15.443ON125149950.016
Skud_5.2898.202ON910174950.017
SAKL0D10120g1.369ON49229940.017
Ecym_45145.443ON124627950.018
KAFR0K018107.390ON71427940.020
KNAG0J008003.270ON76563940.020
KLLA0A10791g1.369ON48430930.021
ZYRO0G01606g5.443ON130530940.022
KLTH0D12760g8.742ON453135930.023
CAGL0H05335g8.540ON48388930.025
Suva_8.1765.443ON127039930.027
TBLA0A064705.443ON132030930.029
Smik_5.2447.390ON74994930.029
ZYRO0D03982g8.540ON82181920.032
ACL164C5.443ON138931920.033
AEL029W1.369ON44689910.034
Smik_16.1638.540ON501132910.037
NDAI0H035501.369ON50244900.049
Kwal_26.95985.18ON1191115910.050
AGR370W7.390ON74027900.055
KLLA0E02377g5.443ON122030900.057
ZYRO0A05962g8.742ON465102890.058
KLTH0H13354g1.369ON49586890.062
TBLA0D006207.390ON117129900.062
YPL072W (UBP16)8.540ON499121890.064
SAKL0H18656g8.202ON772175890.070
KAFR0D050705.443ON122732890.071
Kwal_55.213935.443ON123330890.073
KLTH0F15862g5.443ON124126890.087
TDEL0D025805.443ON127230880.094
Skud_15.2865.443ON127839880.095
NCAS0C021108.540ON494227880.098
Ecym_27171.369ON48383870.099
NCAS0B005808.742ON466104870.11
ZYRO0F01276g3.270ON77620870.12
Smik_15.3015.443ON127230870.13
YOR124C (UBP2)5.443ON127230870.15
KLLA0E23387g8.540ON78291860.18
CAGL0H10186g3.270ON77819850.20
Kpol_1062.235.443ON126627850.24
TDEL0D035503.270ON78020850.24
Kpol_1024.448.540ON496228840.25
TDEL0B030608.540ON73481840.27
NCAS0H021005.443ON126930840.29
Ecym_55448.202ON83475840.29
KNAG0B041905.443ON126226840.30
KAFR0C004103.270ON76932840.31
NCAS0I016203.270ON79563840.33
YBR058C (UBP14)3.270ON781100830.42
KLTH0C06732g7.390ON71485820.54
KLTH0E12540g8.540ON75294810.60
Kpol_219.1singletonON24951790.77
TDEL0B036708.742ON463106800.81
TBLA0E025703.270ON78563800.84
KAFR0E009308.540ON498290790.90
KLLA0E08801g2.307ON77126791.0
Kpol_1064.488.742ON466106791.0
SAKL0H10076g8.540ON76781791.1
SAKL0D03322g3.270ON76563791.1
Skud_4.1332.307ON78744791.1
NDAI0A074103.270ON81019791.2
Kwal_27.108427.390ON711117791.2
NDAI0E008108.742ON493113781.3
NCAS0G018002.69ON87580791.3
Ecym_62488.742ON466105771.7
NDAI0B034302.307ON85630772.0
Kwal_14.19578.202ON444171762.0
CAGL0K03399g2.446ON70397762.3
Skud_2.1773.270ON78281762.3
Smik_2.1893.270ON78254753.1
NDAI0G007802.307ON48691753.1
Kpol_251.73.270ON48020743.7
Suva_16.2408.540ON523140743.9
KLTH0C07326g3.270ON76219744.0
Kwal_56.230843.270ON76220744.1
TPHA0A023201.367ON101546744.4
Skud_16.2098.540ON50395735.0
AGR023C3.270ON78020735.1
TPHA0G005608.742ON46336735.6
NDAI0H023402.446ON70659736.0
Kwal_27.120308.540ON74994719.1
Skud_14.1482.69ON77635719.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00396g
         (1012 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...  1869   0.0  
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   817   0.0  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   810   0.0  
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   806   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     722   0.0  
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   594   0.0  
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   531   e-171
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   511   e-162
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     507   e-162
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   501   e-155
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   486   e-154
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   486   e-154
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   446   e-147
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   464   e-146
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   461   e-145
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   458   e-144
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   450   e-140
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   400   e-126
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   395   e-124
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   407   e-123
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   390   e-122
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   389   e-121
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   378   e-116
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   337   e-102
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   324   3e-98
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   310   8e-89
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   220   5e-61
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   107   8e-23
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   101   4e-21
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    95   5e-19
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    93   2e-18
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...    92   3e-18
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    92   3e-18
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    92   5e-18
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    91   1e-17
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    90   1e-17
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    89   3e-17
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...    89   4e-17
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    87   8e-17
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    87   1e-16
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    86   3e-16
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...    85   4e-16
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    85   4e-16
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    84   1e-15
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     84   2e-15
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    82   3e-15
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    80   1e-14
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    79   3e-14
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    79   3e-14
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    75   7e-13
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    72   5e-12
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              71   1e-11
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     67   2e-10
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    64   1e-09
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    61   6e-09
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    58   1e-07
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    58   2e-07
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    58   2e-07
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    57   2e-07
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    57   2e-07
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    57   3e-07
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    57   3e-07
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    56   4e-07
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    55   6e-07
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    55   7e-07
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    55   7e-07
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    55   8e-07
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    55   1e-06
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    54   2e-06
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    54   2e-06
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    54   2e-06
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    54   2e-06
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    54   3e-06
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    53   3e-06
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    53   3e-06
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    52   5e-06
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    52   7e-06
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    52   8e-06
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    52   9e-06
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    52   1e-05
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    51   1e-05
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    51   2e-05
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    51   2e-05
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    50   2e-05
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    50   3e-05
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    50   3e-05
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    50   4e-05
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    49   5e-05
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    49   5e-05
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    49   7e-05
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    49   9e-05
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    48   1e-04
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    48   1e-04
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    48   1e-04
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    48   1e-04
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    48   1e-04
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    48   2e-04
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    48   2e-04
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    47   2e-04
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    48   2e-04
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    47   2e-04
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    47   2e-04
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    47   2e-04
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    47   2e-04
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    47   2e-04
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    47   2e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    47   3e-04
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    47   3e-04
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    47   3e-04
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    46   4e-04
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    46   5e-04
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    46   5e-04
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    46   5e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    45   6e-04
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    46   6e-04
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    46   6e-04
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    46   7e-04
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    45   7e-04
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    45   7e-04
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    45   8e-04
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    45   8e-04
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    45   0.001
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    45   0.001
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    45   0.001
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    45   0.002
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    44   0.002
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    44   0.002
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    44   0.002
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    44   0.002
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    44   0.002
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    44   0.002
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    44   0.003
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    44   0.003
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    44   0.003
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    43   0.004
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    43   0.004
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    43   0.004
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    42   0.005
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    43   0.005
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    42   0.005
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    43   0.005
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    43   0.005
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    42   0.005
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    42   0.006
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    43   0.006
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    42   0.006
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    42   0.006
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    42   0.006
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    42   0.007
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    42   0.007
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    42   0.008
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    42   0.008
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    42   0.008
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    42   0.009
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    42   0.009
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    42   0.011
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    42   0.011
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    42   0.012
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    41   0.012
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    41   0.013
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    42   0.013
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    41   0.013
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    41   0.014
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    41   0.014
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    41   0.015
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    41   0.016
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    41   0.016
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    41   0.017
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    41   0.017
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    41   0.018
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    41   0.020
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    41   0.020
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    40   0.021
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    41   0.022
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    40   0.023
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    40   0.025
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    40   0.027
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    40   0.029
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    40   0.029
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    40   0.032
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    40   0.033
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    40   0.034
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    40   0.037
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    39   0.049
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    40   0.050
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    39   0.055
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    39   0.057
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    39   0.058
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    39   0.062
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    39   0.062
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    39   0.064
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    39   0.070
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    39   0.071
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    39   0.073
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    39   0.087
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    39   0.094
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    39   0.095
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    39   0.098
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    38   0.099
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       38   0.11 
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    38   0.12 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    38   0.13 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    38   0.15 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    38   0.18 
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    37   0.20 
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    37   0.24 
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    37   0.24 
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    37   0.25 
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    37   0.27 
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    37   0.29 
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    37   0.29 
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    37   0.30 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    37   0.31 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    37   0.33 
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    37   0.42 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    36   0.54 
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    36   0.60 
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    35   0.77 
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    35   0.81 
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    35   0.84 
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    35   0.90 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    35   1.0  
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    35   1.0  
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    35   1.1  
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    35   1.1  
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    35   1.1  
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    35   1.2  
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    35   1.2  
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    35   1.3  
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      35   1.3  
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    34   1.7  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     34   2.0  
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    34   2.0  
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    34   2.3  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    34   2.3  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    33   3.1  
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               33   3.1  
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    33   3.7  
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    33   3.9  
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    33   4.0  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    33   4.1  
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    33   4.4  
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    33   5.0  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    33   5.1  
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    33   5.6  
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    33   6.0  
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    32   9.1  
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    32   9.8  

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score = 1869 bits (4841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 920/1012 (90%), Positives = 920/1012 (90%)

Query: 1    MSRLYTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKY 60
            MSRLYTPEYSDELLSFVQEVYSQDVKHYYA            QAESLFESYRESLSVEKY
Sbjct: 1    MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKY 60

Query: 61   EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120
            EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS
Sbjct: 61   EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120

Query: 121  VLNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKSFASTEWKA 180
            VLNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKSFASTEWKA
Sbjct: 121  VLNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKSFASTEWKA 180

Query: 181  PQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVSDKLLGSIHKPDLL 240
            PQLDPNDRLHL                     LYKEQDDTDALDSVSDKLLGSIHKPDLL
Sbjct: 181  PQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQDDTDALDSVSDKLLGSIHKPDLL 240

Query: 241  DRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMDSFDRSRTHRKDSYHSVYLGDELE 300
            DRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMDSFDRSRTHRKDSYHSVYLGDELE
Sbjct: 241  DRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMDSFDRSRTHRKDSYHSVYLGDELE 300

Query: 301  DLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVAPNLLNI 360
            DLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVAPNLLNI
Sbjct: 301  DLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVAPNLLNI 360

Query: 361  DPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKSFMHLTFNYELILFE 420
            DPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKSFMHLTFNYELILFE
Sbjct: 361  DPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKSFMHLTFNYELILFE 420

Query: 421  LLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSKSAPSDKTASKPSVQT 480
            LLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSKSAPSDKTASKPSVQT
Sbjct: 421  LLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSKSAPSDKTASKPSVQT 480

Query: 481  DNIIKSSPSILSKEHNDDTLISSTXXXXXXXXXXXXXXXXXXXTIVYNRPPVPLPINSPA 540
            DNIIKSSPSILSKEHNDDTLISST                   TIVYNRPPVPLPINSPA
Sbjct: 481  DNIIKSSPSILSKEHNDDTLISSTPPIPKVAPPPLPGSPLSAPTIVYNRPPVPLPINSPA 540

Query: 541  PLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYIN 600
            PLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYIN
Sbjct: 541  PLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYIN 600

Query: 601  SMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFLK 660
            SMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFLK
Sbjct: 601  SMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFLK 660

Query: 661  ACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKE 720
            ACHMLRPDFHIPT                    SEPTKVANDYPNLLLHDDEKLLVDNKE
Sbjct: 661  ACHMLRPDFHIPTDQQDTQEFLLFLLDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKE 720

Query: 721  YDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTF 780
            YDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTF
Sbjct: 721  YDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTF 780

Query: 781  SRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLS 840
            SRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLS
Sbjct: 781  SRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLS 840

Query: 841  VNGDHXXXXXXXXXXXXXXXXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILV 900
            VNGDH                    PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILV
Sbjct: 841  VNGDHKSRSKFFKLSSSRSGKRSLSPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILV 900

Query: 901  IHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKH 960
            IHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKH
Sbjct: 901  IHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKH 960

Query: 961  LSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
            LSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI
Sbjct: 961  LSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1072 (45%), Positives = 621/1072 (57%), Gaps = 106/1072 (9%)

Query: 5    YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
            YTPEYS+ELL FVQ+VY+QD+KHYY              AE LFESY   L     ED L
Sbjct: 5    YTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDAL 64

Query: 65   CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
              ++IGSFYV+LIIP S+QF  RNKSY IY DL+K YQDE +M+NVLLMV  KVD++L +
Sbjct: 65   TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124

Query: 125  NMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNAD------QKSVDDD----YKSFA 174
            + +         +RKRA+SV    +  QL +L LNN D      + S + D    Y    
Sbjct: 125  SRDF---DDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDY 181

Query: 175  STEWKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVSDKLLGSI 234
            +T W AP+L+P+D+L L                               +D  S K     
Sbjct: 182  TTIWSAPKLEPDDQLKLALNPPSKSSSATSSLSSF------------VMDQHSKKFSIGE 229

Query: 235  HKPDLLDRTGIIRKVPRHQSLPTE-----QHHKLYAQNDSSLMLEN---------MDSFD 280
               D  +       +P   + P+E     +HH + + ND+    ++         + + D
Sbjct: 230  SSSDEFEPIPTQEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVD 289

Query: 281  RSRTHRKDSYHSVYLGDELEDLN--NISTGLARHQQENTIDCFALFSLLKDAESRENLLL 338
            R  THRKDSYHSVY+ +E +D N  +    L+R Q++  I C  L  +L+  E R N+LL
Sbjct: 290  RYNTHRKDSYHSVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDILQSDE-RNNVLL 348

Query: 339  IDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLES-FEALKKIVANPILDKISQYDN 397
            +DLR+ KRF +NH+VAPNL+NIDP  L+D ++   + S  E  KK+ +       S++  
Sbjct: 349  VDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKY 408

Query: 398  IVYYTDYKSFMHLTFNYELILFELLFKKTGTAI---PKSLLGGYEQWKAFLNKQLRDSEF 454
            IVYYTD K+F+++ F+Y L+ F+LL+  + T +   PK+LLG YEQWK F+ +  +  + 
Sbjct: 409  IVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDI 468

Query: 455  DKSLFLFRK-SKSAPSDKTASKPSVQTDNIIKSSPSILSKEHNDDTLISSTXXXXXXXXX 513
                +LFR  + SA S K   KP           P           L S           
Sbjct: 469  VTGDYLFRPYASSAKSQKDKVKPISAPPVPATRPPPPPLPAQAPPALPSQAPP------- 521

Query: 514  XXXXXXXXXXTIVYNRPPV---------PLPINSPAPLLKPSIAKELRTPQRNDWTV--- 561
                      T+    PP          PLP  S A  L  S+A  ++ P     TV   
Sbjct: 522  ----------TLPSQAPPTQSIPAVHLPPLPPKS-AINLHYSVATGMQPPMPQVTTVSHA 570

Query: 562  ----------QTQHLHVP------FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQC 605
                      ++QH H         S+PTIE+S N +VSLSITGLRN+G+TCYINSMLQC
Sbjct: 571  HRHRYLSHSKRSQHQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQC 630

Query: 606  LFGCSQFRDLFLGGKYHRYLNPKRSNTI-ISKWFSLLFRKMYLNGGCSVVPNGFLKACHM 664
            LF   +FRD+FL  KYH Y++    +   IS+ F +LF+KMY+NGGCSVVP+GFLKAC+ 
Sbjct: 631  LFATRKFRDIFLSPKYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNS 690

Query: 665  LRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKW 724
            +RPDF IP                     S+P +VANDYP LLLHDD+ L VD KEYDKW
Sbjct: 691  MRPDFKIPNDQQDTQEFLLFLLDQLHDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKW 750

Query: 725  FDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSK 784
            F++ +  NGLSPID IFQGQMEN L+CQRCG +SYNYSTFYVLSLAIP  P   TF ++K
Sbjct: 751  FEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPT-PGTSTFGKTK 809

Query: 785  KIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLS---V 841
            K++ LEDCINL+T DE+L+GENAWDCP+CGT   S  GS    E   KKK+K  L    V
Sbjct: 810  KVL-LEDCINLFTSDEVLSGENAWDCPRCGT---SMSGS-GPGEGKAKKKRKFLLPHDHV 864

Query: 842  NGDHXXXXXXXXXXXXXXXXXXXXPFKSNSVK---PEKLHIKSKKMTTIKTLNFITMPNI 898
            N +                         ++     P     KSKK+TTIKT NFITMP I
Sbjct: 865  NNNRTSRFFKFRSKSRSRSSSPFNSSNGHNSGSSMPGSEKWKSKKLTTIKTFNFITMPPI 924

Query: 899  LVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVN 958
            LVIHLSRFFYDLTKKN T+I YPLIL++VLKNNE+A+YRLYGI+NHFGNL+SGHYTSLVN
Sbjct: 925  LVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVN 984

Query: 959  KHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIH 1010
            K L HEIR GQQKWYYFDDEVVK++ NHGDFD GI S+SS DVYVLFYERI+
Sbjct: 985  KDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/1029 (45%), Positives = 611/1029 (59%), Gaps = 79/1029 (7%)

Query: 1    MSRLYTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKY 60
            M+RLY+PEYS+ELL FV++VY+QD+ HY+              AE LFESYR +L+  + 
Sbjct: 1    MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60

Query: 61   EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120
            ED L  +V G FY++LIIP S+QF +R+KSY+IY+DLKK YQDE NM+NVLLMV   ++S
Sbjct: 61   EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120

Query: 121  VLNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKSF-----AS 175
            +    +E          RKRA+SV  P  +  +    L+ A+  +V+ D  +       +
Sbjct: 121  MSKDEVETARIM-----RKRAYSV--PYGKSPVTIQALSKANSATVEPDAPTETEFENGT 173

Query: 176  TEWKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVSDKLLGSIH 235
            T W AP+L+PND L +                       K  +++ +             
Sbjct: 174  TMWTAPELEPNDHLKVSLGSHHSSTSSASSNEQ----FPKIHNESHSF---------PFE 220

Query: 236  KPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMDSFDRSRTHRKDSYHSVYL 295
            +P+L     +     R  S+P     KL     S+    N    +R  THRKDSYHSV++
Sbjct: 221  EPEL-HALSLGGSRTRRSSVPARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHM 279

Query: 296  GDELEDLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVAP 355
             ++  D +  +  LAR Q+++ + C  L  +L  ++ R+NLLLIDLR  KRF++NH++AP
Sbjct: 280  SND--DYDAFTFNLARLQKQSVVTCDQLMRILC-SQDRDNLLLIDLRFSKRFQTNHILAP 336

Query: 356  NLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKSFMHLTFNYE 415
            NLLN+DP LL++  KG+ +ES   L++ + N +L+  SQ++ IVYYTD K+FM L F+Y+
Sbjct: 337  NLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQ 396

Query: 416  LILFELLF--KKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSKSAPSDKTA 473
            L+ F+L++   K     PK LLGGYEQWK FL+K    +  DK  FL+  + +  +    
Sbjct: 397  LVFFQLIYTSNKNLKCTPKVLLGGYEQWKKFLSKS-SQAYCDKDAFLYSSTNNGRNAPVT 455

Query: 474  SKPSVQTDNIIKSSPSILSKEHNDDTLISSTXXXXXXXXXXXXXXXXXXXTIVYNRPPVP 533
            S           S P     EH      S                        YNR P P
Sbjct: 456  SH----------SLP-----EHYPVAPPSIPPPPPPIAKTEEMTKTP------YNRAPFP 494

Query: 534  LPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPF-----------SIPTIERSPNEF 582
             P+           + +  T  +N    + Q   VP            +IPTIE+SPNE+
Sbjct: 495  TPLVQAQRADHFPASSQNHTRDKN----EIQKHSVPALSGNGNYSKHTAIPTIEQSPNEY 550

Query: 583  VSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSN-TIISKWFSLL 641
            V+LSITGLRN+G TCY+NSMLQCLF    FRDLFL  KY  Y + K +N   +SK+F++L
Sbjct: 551  VALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVL 610

Query: 642  FRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVAN 701
            F+KMY+NGGCSVVP GFLKAC+ LRPDF IP                     SE  +VAN
Sbjct: 611  FKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAN 670

Query: 702  DYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNY 761
            DYP LLLHDD+KL VD KEYD WF++ +  NG+SPID+IFQGQMEN L CQRCG +S+NY
Sbjct: 671  DYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNY 730

Query: 762  STFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSD 821
            S FYVLSLAIP+     TFS+ KK+ RLEDCINL+T DE LT ENAWDCPKCGT   S+ 
Sbjct: 731  SVFYVLSLAIPS--STSTFSQRKKV-RLEDCINLFTSDEQLTNENAWDCPKCGT---SAS 784

Query: 822  GSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXXXPFKSNSVKPEKLH-IK 880
            G+   +E   KKKK+  L+ +                       PF+  S + + L  +K
Sbjct: 785  GTGPEEE---KKKKRFLLNPDTRASGNRSRFFKLRSKSRSRSVSPFRKQSSQQQNLEKLK 841

Query: 881  SKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYG 940
            SKK+TTIKTLNFI++P +L IHLSRFFYDLTKKN  +I YPLIL +VLKN +I +YRLY 
Sbjct: 842  SKKLTTIKTLNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYA 901

Query: 941  IINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGD 1000
            I NHFGNL+SGHYTSLVNK L H++ KG+QKWYYFDDE VKK+ NHGD D GITSISS D
Sbjct: 902  IANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSD 961

Query: 1001 VYVLFYERI 1009
            VYVLFYE+I
Sbjct: 962  VYVLFYEKI 970

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
            (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1027 (45%), Positives = 604/1027 (58%), Gaps = 75/1027 (7%)

Query: 1    MSRLYTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKY 60
            M+ LY+PEYS+ELL FV+EVY+QD+ HYY              AE LFESYR SL  ++ 
Sbjct: 1    MNHLYSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQN 60

Query: 61   EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120
             + L  +V+G FY++LIIP S+QF +R+KSY+IY+DL+K YQDE NM+NVLLMV   ++S
Sbjct: 61   SELLTAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIES 120

Query: 121  VLNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKS---FASTE 177
            V    +E          RKRA+SV    +  ++  L L+     S +   ++     ST 
Sbjct: 121  VSRDELESAKIM-----RKRAYSVPHKKLSDKMQALTLSPETASSTNAGPETDNENDSTM 175

Query: 178  WKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVSDKLLGSIHKP 237
            W AP+L+PND L +                      +K  ++ ++  S SD +  ++H  
Sbjct: 176  WTAPELEPNDHLKVNLGGHNSSVSSRSSNEQA----FKVGNEGNS--SSSDDIEMAVHST 229

Query: 238  DLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENM--DSFDRSRTHRKDSYHSVYL 295
                R       PR  S+P +       QN     ++++     DR  THRK SYHSV++
Sbjct: 230  TQDQR-------PRRSSVPIKVEA---PQNSLQSTVDDIYCQKVDRYNTHRKGSYHSVHM 279

Query: 296  -GDELEDLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVA 354
             GDE +   + +   AR Q+++ I C  L  +L D+E  E LLL+DLR  KRFE+NH+VA
Sbjct: 280  TGDEYD---SFTFNTARLQKQSIITCDKLLRIL-DSEEAERLLLVDLRFIKRFETNHIVA 335

Query: 355  PNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKSFMHLTFNY 414
            PNL+N+DP  L+D  KG ++E    L+ +  N  L  +SQ+ +IVYYTD K+FM L F+Y
Sbjct: 336  PNLVNLDPMNLWDFAKGRAIEGDAPLEVLNKNHALKDLSQFKHIVYYTDMKTFMRLDFDY 395

Query: 415  ELILFELLFKKTG--TAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSKSAPSDKT 472
            +L+ F++L+      +  PK LLGGYEQWK FL K  +     K  FLFR        K 
Sbjct: 396  QLVFFQMLYTSNWRISCTPKVLLGGYEQWKKFLAKVPQSRVPIKEAFLFRL-------KP 448

Query: 473  ASKPSVQTDNIIKSSPSILSKEHNDDTLISSTXXXXXXXXXXXXXXXXXXXTIVYNRPPV 532
              K +V +  I + +              S+                    +  Y R P 
Sbjct: 449  GGKETVASAIIHQKA--------------STPLPPSIPPPPPPVEKVSKADSGSYTRAPF 494

Query: 533  PLPI------NSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLS 586
            PLP       +S   + +  I   L +   ++  +Q +  H   +IPTIE+S NE+V+LS
Sbjct: 495  PLPAKEMVIQSSLDSISRTQIPSHLESHYTHEKVLQNKMHHAEGTIPTIEQSSNEYVALS 554

Query: 587  ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNT-IISKWFSLLFRKM 645
            ITGLRNMGNTCYINSMLQCLF   +FRDLFL  KY  Y + + SN   +SK+F++LF+KM
Sbjct: 555  ITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFSKRYSNPHQLSKYFNILFKKM 614

Query: 646  YLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPN 705
            Y+NGGCSVVP GFLKAC+ LRPD  IP                     SE   VANDYPN
Sbjct: 615  YMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDELSESNHVANDYPN 674

Query: 706  LLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFY 765
            LLLHDDE L VD KEYDKWF+  +  NG+SPID IFQGQMEN L CQRCG +SYNYS FY
Sbjct: 675  LLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQMENGLLCQRCGHSSYNYSMFY 734

Query: 766  VLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGT--HSNSSDGS 823
            VLSLAIPA     +F + KK+ RLEDCINL+T DE LT ENAWDCPKCG+    N  DG 
Sbjct: 735  VLSLAIPA--SMSSFGQKKKM-RLEDCINLFTSDEKLTNENAWDCPKCGSAVSGNGPDG- 790

Query: 824  MNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXXXPF-KSNSVKPEKLHIKSK 882
                   DKKK+K   + +  +                    PF K +S  P     KSK
Sbjct: 791  -------DKKKRKFLSTSDNSNGRSRSRFFKLRSKSRSRSVSPFHKPSSQSPASEKWKSK 843

Query: 883  KMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGII 942
            K++TIKTLNF+++P++L IHLSRF YDLT KN  +I YPL L +VLKNNE+  YRLY I 
Sbjct: 844  KLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNNEVVNYRLYAIA 903

Query: 943  NHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVY 1002
            NHFGNL+SGHYTSLVNK LSH++  G+QKWYYFDDEV K++ NHG+ D GITS+SS DVY
Sbjct: 904  NHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDAGITSVSSSDVY 963

Query: 1003 VLFYERI 1009
            VLFYE+I
Sbjct: 964  VLFYEKI 970

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1056 (41%), Positives = 598/1056 (56%), Gaps = 86/1056 (8%)

Query: 5    YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
            +TPEYS+ELL  +Q VY +D+KHYY               E LFE +         +D L
Sbjct: 10   FTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDAL 69

Query: 65   CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
              +++G +Y+FLI+P S+QF +RNKSY IYSDLKKLY+++ +M+NVLLMV  +++++L +
Sbjct: 70   TSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEK 129

Query: 125  NMEI-LAKQHLDPSRKRAFSVEEP-IIRYQLHNLQLNNADQKS----------------- 165
              E  + + +    R+RA+SV +   +  QLH+L +++ + KS                 
Sbjct: 130  TAEREINETNNRIVRQRAYSVPDSNDLTEQLHSLSVSDRNLKSPPRKILMNNSFEHSDSD 189

Query: 166  VDDDYKSFASTEWKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDS 225
            V ++    +S  W AP L+P D+L L                         Q+ TD L  
Sbjct: 190  VINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLPPPVIPYEADI------QERTDLLK- 242

Query: 226  VSDKLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLE--NMDSF---- 279
                      +P + + +     +   +   +     +   ND  L+ E  N  SF    
Sbjct: 243  ----------QPSIPELSPTTTSLKNSKDFNSPFQSVISLDNDIPLVREPSNNRSFRETN 292

Query: 280  -DRSRTHRKDSYHSVYLGDE--------LEDLNNISTGLARHQQENTIDCFALFSLLKDA 330
             DRS+THRKDSYHSVY+ DE          D  +    L R Q+++ I    L S+L   
Sbjct: 293  ADRSQTHRKDSYHSVYMIDEESTDKLNQFYDSTDYIQDLQRLQKQSIITAQELLSILSCP 352

Query: 331  ESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILD 390
              R  LLLIDLR  KR   NH+VAPN+++IDP LL+D+   T + + E L+K++ N + +
Sbjct: 353  PERIKLLLIDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLLDNELFN 412

Query: 391  KISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTGTAI---PKSLLGGYEQWKAFLNK 447
            +  +++ +VYYTD K++MH  F+Y   LF LL  +T   +   P  LLGGY++WK FL+ 
Sbjct: 413  RRHEFEYVVYYTDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGYDKWKVFLHH 472

Query: 448  QLRDSEFDKSLFLFRKSKSAPSDKTASKPSVQTDNIIKSSPSILSKEHNDDTLISSTXXX 507
              ++ + +   +L+R    A   +T  +     +  +   PS    E             
Sbjct: 473  YAKEYDINIPDYLYRPYDKALKSETPEEFEETKNKHVLEPPSWRPPELPVRIRKRPPPPP 532

Query: 508  XXXXXXXXXXXXXXXXTIVYNRPPVPL-PINSPAPLLKPSIAKELRTPQRNDWTVQTQHL 566
                                NRP   L  ++S  PLL        R  Q      QT  L
Sbjct: 533  PALLPVPPSPPVKPRIVDDVNRPKKTLMNLHSARPLLHE------RNYQIPPHLQQTTTL 586

Query: 567  HVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN 626
                SIPTIERSPN +VSLSITGLRN+GNTCYINSMLQCLF   +FRDLFL  KY  +LN
Sbjct: 587  TRRPSIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLN 646

Query: 627  PKR--SNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXX 684
              +  ++ +IS  F+LLF+KMYLNGGCSVVP  FLK C++LRPD  IP            
Sbjct: 647  GSKFPNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMI 706

Query: 685  XXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQ 744
                     S   +V N+YP+L+L+D   L V ++EY  WF++ +  NGLSPID+IFQGQ
Sbjct: 707  ILDRLHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQGQ 766

Query: 745  MENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTG 804
            +EN L+CQRCG +S+NYSTFYVLSLAIP  P P  FSRSK+ ++LEDCIN++T DE+L+G
Sbjct: 767  IENGLQCQRCGHSSFNYSTFYVLSLAIPK-PSPTGFSRSKR-VKLEDCINMFTNDEMLSG 824

Query: 805  ENAWDCPKCGTHSNSSDG-SMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXX 863
            ENAWDCP CG  SN+ D   +N+D++V KK++                            
Sbjct: 825  ENAWDCPNCG--SNAQDRVRVNTDQSVKKKRQ--------GEEHRHKSRFFGLPTRPHRS 874

Query: 864  XXPFKS---------NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKN 914
              PF+          + +K E+   K+KK+ TIKTLNFI +P +LVIHLSRFFYDLTKKN
Sbjct: 875  LSPFRKSGSSSTNSTSKIKHEQ-QWKTKKLITIKTLNFIMLPPVLVIHLSRFFYDLTKKN 933

Query: 915  ETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYY 974
            +T+I YPLIL++VLKNNE+A+Y+LYGI+NH GNL+SGHYTSLVNK   H +   QQ+WYY
Sbjct: 934  KTVITYPLILNIVLKNNEVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNHNQQRWYY 993

Query: 975  FDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIH 1010
            FDDEVVK E NHGD D GI+ +SS DVYVLFYER++
Sbjct: 994  FDDEVVKAEGNHGDIDNGISKVSSKDVYVLFYERLY 1029

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/763 (42%), Positives = 454/763 (59%), Gaps = 56/763 (7%)

Query: 280  DRSRTHRKDSYHSVYLGDE--------LEDLNNISTGLARHQQENTIDCFALFSLLKDAE 331
            +R  THRKDSYHS+Y+ D+         +  N    GL R Q+++ I    LFS+L + E
Sbjct: 341  NRLITHRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPE 400

Query: 332  SRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDK 391
             R  LLLIDLRL KR  +NH+VAPN++NIDP  L+D E  + +     L++ + NP+ + 
Sbjct: 401  ERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNG 460

Query: 392  ISQYDNIVYYTDYKSFMHLTFNYELILFELLFK--KTGTAIPKSLLGGYEQWKAFLNKQL 449
              +YD IVYY+D K++M+  ++Y  ILF LL    K  +++P +LLGGYE+WK  +N  +
Sbjct: 461  RLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYV 520

Query: 450  RDSEFDKSLFLFRKSKSAPSDKTASKPSVQTDNIIKSSPS---ILSKEHNDDTLISSTXX 506
               + +   +L+R    APS+    + + Q  ++    P    ++ ++     +  S   
Sbjct: 521  SQYQIELDDYLYRPY--APSNNKGEQNNAQIPDVPTWKPPPVPVMVRKRPPPPVPVSIPI 578

Query: 507  XX-------XXXXXXXXXXXXXXXTIVYNRPPVPLPINSPAPLLKPSIAKELRTPQRNDW 559
                                       Y RPP  LPI++            L +P+    
Sbjct: 579  PPETPPPLPQKIKLESIEESAPSDNSQYIRPPAKLPIHA------------LHSPR---- 622

Query: 560  TVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGG 619
                Q L   FSIPTIE++ N +V+ S+TGLRN+GNTCYIN MLQ LF  ++ ++LF+ G
Sbjct: 623  ---NQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISG 679

Query: 620  KYHRYLNPKRSN--TIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXX 677
            KY  Y      N  + IS  F+ LF KMY+NGGC+VVP+GFLK C+ LRPD  IP     
Sbjct: 680  KYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQD 739

Query: 678  XXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPI 737
                            S    V NDYPNLLL+DD+K++VD ++Y KWFD+ +  NGLSP+
Sbjct: 740  TQEFLLFILNRLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPV 799

Query: 738  DDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYT 797
            D +FQGQMEN+L+CQRCG+ S NYSTFYVLSLA+P  P    F +S ++ +LEDCIN++T
Sbjct: 800  DGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPK-PSAPAFYKSGRV-KLEDCINMFT 857

Query: 798  QDELLTGENAWDCPKCGTH-------SNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXX 850
             DE+LTGENAWDCPKCG+        S +S  ++  +     KK K F    G       
Sbjct: 858  SDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSK 917

Query: 851  XXXXXXXXXXXXXXXPFKSNSVKPEKLH----IKSKKMTTIKTLNFITMPNILVIHLSRF 906
                             K + ++ +++     +KSKK+ TIKT+NFI++P +L+IHLSRF
Sbjct: 918  SPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRF 977

Query: 907  FYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIR 966
            +YDLTKKN+ +++YPL+L++VLKN EI RY+LY I+NH GNL+SGHYTSLVNK   H + 
Sbjct: 978  YYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLG 1037

Query: 967  KGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
              +QKWYYFDDEVVK E  HG+ D+GIT +SS +VYVLFYER+
Sbjct: 1038 NTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080

 Score = 85.5 bits (210), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 73/120 (60%), Gaps = 1/120 (0%)

Query: 5   YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
           +TPE+S +LL  +Q++Y  +++  +             QA+ + E Y   + V+  +  +
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDTSK-AV 62

Query: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
             ++ G FY++L++P S+QF  R+KSYS+Y++L+ LY+ +LNM+NV+ MV  +V  +  Q
Sbjct: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score =  531 bits (1368), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 339/873 (38%), Positives = 467/873 (53%), Gaps = 98/873 (11%)

Query: 5   YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
           +TPEYS+ELL  VQ++Y +D+KHYY               E LFE Y +S+  ++  D L
Sbjct: 17  FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPNDAL 76

Query: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
             ++IG +YVFLIIP S+QF  RNKSYSIY+DLKK+Y++E+NM+NV+LMV  ++  VL++
Sbjct: 77  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 136

Query: 125 NMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNAD------QKSVDDDYKSFASTEW 178
           +++  A      ++KRAFSV    +  Q+ +L L+ A       + +  +D    +S  W
Sbjct: 137 SVKHGAGIEHRITKKRAFSVPADDLSGQVASLSLDTAAPQDHGLKGTFTEDDAEQSSPVW 196

Query: 179 KAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVSDKLLGSIHKPD 238
            AP L+PND+L L                     L  E   T A      K         
Sbjct: 197 TAPNLEPNDQLKLA--------------------LLPEVIPTPAFREPERKT-------- 228

Query: 239 LLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMD----SFDRSRTHRKDSYHSVY 294
                     VP   S+  E    +Y ++D+S    N      + DRS THRKDSYHSVY
Sbjct: 229 ---------SVPVRPSVLLEDVPSIYHEDDTSFASLNPPFREITADRSVTHRKDSYHSVY 279

Query: 295 LGD------ELEDLNNIST-----GLARHQQENTIDCFALFSLLKDAESRENLLLIDLRL 343
           + D      + +DL N+        L   Q+++ I    LFS+L +   RE +LLIDLR+
Sbjct: 280 MVDSGNLKEDNDDLFNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRI 339

Query: 344 PKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVA-NPILDKISQYDNIVYYT 402
           P+R   NH+VAPNL+N+DP LL+D +  T +   + L+ ++  N      +++D IVYYT
Sbjct: 340 PQRSAINHIVAPNLVNVDPNLLWDKQTNTPIYKDDILEHLLKENENFINRNKFDYIVYYT 399

Query: 403 DYKSFMHLTFNYELILFELLF---KKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLF 459
           D K+FM + F+Y  I F L+    K   T +P +LLGGYE+WK  L+   ++       +
Sbjct: 400 DVKTFMTINFDYAFIFFYLMLTSQKTPLTTVPTTLLGGYEKWKKTLHSYAQEYHISIEDY 459

Query: 460 LFRK------------------------SKSAPSDKTASKPSVQTDNIIKSSPSILSKEH 495
           L+R                         S    S K    PS +  ++    P  L K  
Sbjct: 460 LYRPYSQKARLQQEQQQQQQQPDSQDSFSAKESSTKVPEPPSWKPPDL----PIRLRKRP 515

Query: 496 NDDTLISSTXXXXXXXXXXXXXXXXXXXTIVYNRPPVPLPINSPAPLLKPS-IAKELRTP 554
                +S                     + +  +PP+P   +     L  + I +  R  
Sbjct: 516 PPPPPVSMPTTPEIPPPLPPKIMVHSQVSSISRKPPIPAKQHVKKEQLNSNEIIQRKRQH 575

Query: 555 QRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRD 614
           Q   +  Q       ++IPTIERSPN +VSLSITGLRN+GNTCYINSM+QCLF    FR 
Sbjct: 576 QHQHYDQQILQPQRAYNIPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRT 635

Query: 615 LFLGGKYHRYLNPKRSNTI-----ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDF 669
           LF+  KY  YL P RSN       +S   S+LF KMYLNGGCSVVP GFLK  + LRPD 
Sbjct: 636 LFISSKYKSYLQPIRSNGSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDL 695

Query: 670 HIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGL 729
            IP                     S+   VANDYPNLLL++ + L V N EY  WFD+ +
Sbjct: 696 KIPDDQQDTQEFLMILLDRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNV 755

Query: 730 KNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIP--AMPPPKTFSRSKKII 787
             NG+SPIDDIFQGQMENSL+C+RCG+T++NYSTFYVLSLAIP  +M   K    ++K +
Sbjct: 756 IGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRV 815

Query: 788 RLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           +LEDCIN++T DE+L+GENAWDCP+CG  ++ S
Sbjct: 816 KLEDCINMFTSDEVLSGENAWDCPRCGPTASVS 848

 Score =  183 bits (465), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 109/131 (83%), Gaps = 2/131 (1%)

Query: 880  KSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLY 939
            K+KK+TT+KT+NF+T+P ILVIHLSRF+YDLTKKN T++ YPLIL+++LKNN+  +Y+L+
Sbjct: 942  KNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLF 1001

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
            G++NH G L+SGHYTSLVNK L H +  G+ KWYYFDDEVVK +  HG  D+ +  ISS 
Sbjct: 1002 GVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGS-DKNL-KISSS 1059

Query: 1000 DVYVLFYERIH 1010
            DVYVLFYER++
Sbjct: 1060 DVYVLFYERVY 1070

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  511 bits (1316), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 259/449 (57%), Positives = 316/449 (70%), Gaps = 17/449 (3%)

Query: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629
            FS+PTIE++PNE+++LSITGLRNM NTCYINSMLQCLF  ++FR+LFL  KY RYL  K 
Sbjct: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL--KS 785

Query: 630  SNTI-ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXX 688
            SN   +S+ F +LF+KMY+NGGCSVVP+GFLK C  L+PD  IP                
Sbjct: 786  SNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFLLDR 845

Query: 689  XXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENS 748
                 S    V NDYP LLLH+   L V++KEY  WFD+  + NGLSPID IFQGQ+E+ 
Sbjct: 846  LRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQ 905

Query: 749  LKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAW 808
            L CQRC F+SY+YSTFYVLSLA+P  P  K F ++KK+ RLEDCIN +T DE+LTG+N W
Sbjct: 906  LSCQRCDFSSYSYSTFYVLSLALPN-PGSKAFGKAKKL-RLEDCINFFTCDEVLTGQNPW 963

Query: 809  DCPKCGTHSNSSDGSMNSDETVDKKK------KKNFLSVNGDHXXXXXXXXXXXXXXXXX 862
            DCPKCG +S S D  MNS+++  K K        N  + N DH                 
Sbjct: 964  DCPKCGVNS-SGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLFKIGSKSRSRSSS 1022

Query: 863  XXXPFKSNSVKPEKLHIK--SKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINY 920
               PF S      K H K  +KK+ TIK+LNFIT+P IL+IHLSRF YDLTKKN T++ Y
Sbjct: 1023 ---PFISGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTY 1079

Query: 921  PLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
            PLIL++VLKNNE+A+YRLY  INHFG L+SGHYTSLVNK L HEIR+G+QKWYYFDDE+V
Sbjct: 1080 PLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139

Query: 981  KKEFNHGDFDRGITSISSGDVYVLFYERI 1009
            K + NHG++DRGITS+SS DVY+LFYERI
Sbjct: 1140 KLDPNHGNYDRGITSVSSSDVYLLFYERI 1168

 Score =  127 bits (320), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 108/199 (54%), Gaps = 10/199 (5%)

Query: 1   MSRLYTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKY 60
           MS  Y PEYS EL +FVQE Y Q V+  Y             +A +LFESY++ +   + 
Sbjct: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60

Query: 61  EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120
            + L  YVIG+FY++LIIP S++F  RN SYS+Y+DL+K Y+ E NM+NV+ MV  KVD+
Sbjct: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120

Query: 121 V-LNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQK---------SVDDDY 170
           V L Q  E   +      RKRA+SV E  +     +LQ    D K             + 
Sbjct: 121 VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV 180

Query: 171 KSFASTEWKAPQLDPNDRL 189
              A T W AP+L+ ND L
Sbjct: 181 AVQADTLWSAPKLEENDLL 199

 Score =  109 bits (273), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 131/264 (49%), Gaps = 21/264 (7%)

Query: 232 GSIHKPDLLDRTGIIRKVPRHQSLPTE---QHHKLYAQNDSSLMLENMDSFDRSRTHRKD 288
            S+H    L  TG   +  R   LP +        Y Q +S++  E  +  DR    R +
Sbjct: 368 ASVHSWSYLQTTG---QQSRWSVLPNDLPNAGQNKYNQ-ESAVSFEQQE-LDRPHNSRVE 422

Query: 289 SYHSVYLGDE--LEDLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKR 346
            Y+    G+   LE  N     L R  + ++I C  L  +L +++ ++ +L IDLR PKR
Sbjct: 423 PYNPFANGNAAGLESCN----PLTRLYETSSIKCSDLMIIL-ESDIQDRVLFIDLRPPKR 477

Query: 347 FESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKS 406
           +E NH+VA +L+NIDP LL+DTE+   + S    ++ + NP+     Q+  +V YTD  +
Sbjct: 478 YELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHT 537

Query: 407 FMHLTFNYELILFELLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSKS 466
            M++ F +EL  FEL++      + K L GGY+QW+ +L    +      S F++R    
Sbjct: 538 SMNMDFKFELTFFELVYMGKPRLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWR---- 593

Query: 467 APSDKTASKPSVQTDNIIKSSPSI 490
             ++      SV   N  +++P +
Sbjct: 594 --ANFLGRDTSVSDHNPFRATPPV 615

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  507 bits (1306), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 263/451 (58%), Positives = 315/451 (69%), Gaps = 16/451 (3%)

Query: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN-PK 628
            FSIPTIE+SPN +VSLSITGLRN+GNTCYINSMLQCLF    FRDLF+  K+  ++N  K
Sbjct: 660  FSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSK 719

Query: 629  RSNTI-ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXX 687
              NT  IS  F+LLF+KMYLNGGCSVVP  FLK C++LRPD  IP               
Sbjct: 720  FPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILD 779

Query: 688  XXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMEN 747
                  S   +V N+YPNLLL+D+  L V NKEY  WFD+ +  NGLSPID IF GQMEN
Sbjct: 780  RLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMEN 839

Query: 748  SLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENA 807
            SL+CQRCG +SYNYSTFYVLSLAIP  P   TFSRSK++ +LE+CIN++T DE+L+GENA
Sbjct: 840  SLQCQRCGNSSYNYSTFYVLSLAIPK-PSSTTFSRSKRV-KLEECINMFTSDEVLSGENA 897

Query: 808  WDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXXXPF 867
            WDCPKCG+ ++S+         V   KKKN  S N  H                    PF
Sbjct: 898  WDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSIS--PF 955

Query: 868  KS--------NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMIN 919
            +         +S K E    KSKK+ TIKTLNFI +P ILVIHLSRF+YDLTKKN T+I 
Sbjct: 956  RKKTSPAAVPSSTKNEPW--KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVIT 1013

Query: 920  YPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEV 979
            YPLIL++VLKNNE+A+YRLYGI+NH GNL+SGHYTSLVNK  +H++   +Q+WYYFDDE 
Sbjct: 1014 YPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDET 1073

Query: 980  VKKEFNHGDFDRGITSISSGDVYVLFYERIH 1010
            VK+E NHGD D+GI  +SS DVYVLFYERI+
Sbjct: 1074 VKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104

 Score =  130 bits (327), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 110/199 (55%), Gaps = 16/199 (8%)

Query: 280 DRSRTHRKDSYHSVYLGD--------ELEDLNNISTGLARHQQENTIDCFALFSLLKDAE 331
           DR+  HRKDSYHS+Y+ D        +  D N     L R Q++  I    LFS+L +  
Sbjct: 331 DRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYIHSLERLQKQCIITAQELFSILSNPI 390

Query: 332 SRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANP---- 387
            +  LLLIDLR PKRF SNH+VAPNL+ IDP LL++++  T +     L+ ++  P    
Sbjct: 391 EKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARK 450

Query: 388 ILDKISQYDNIVYYTDYKSFMHLTFNYELILFELLF----KKTGTAIPKSLLGGYEQWKA 443
           +L   +Q++ IV+YTD K++M+  F+Y    F LL      K   + P  LLGGY++WK 
Sbjct: 451 LLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKK 510

Query: 444 FLNKQLRDSEFDKSLFLFR 462
            L        F+   +L++
Sbjct: 511 VLYSYSEQYNFNMGDYLYK 529

 Score =  114 bits (286), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/224 (32%), Positives = 118/224 (52%), Gaps = 37/224 (16%)

Query: 5   YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFE-SYRESLSVEKYEDC 63
           +TPEYS+ELL  VQ +Y  D+KHYY               E L E  +  + +    +D 
Sbjct: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDV 68

Query: 64  LCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVL- 122
           L  +++G +Y+FLIIP S+QF ++NKSY IY++LKKLY++E +M+NVLLMV  ++++VL 
Sbjct: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128

Query: 123 -NQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNA-DQKSVDDDYKSF------- 173
            ++N       H    R+RA+S+    +  Q+ +L ++N+ DQ+ +++  ++        
Sbjct: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188

Query: 174 --------------------------ASTEWKAPQLDPNDRLHL 191
                                     AS  W AP L+P D+L L
Sbjct: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKL 232

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  501 bits (1289), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 248/442 (56%), Positives = 309/442 (69%), Gaps = 15/442 (3%)

Query: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629
            FSIPTIE S NE+V+LSITGLRNM NTCYINSMLQCLF  S FR+LFL  KY  YL    
Sbjct: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE 1146

Query: 630  SNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXX 689
             +T+ S+ F +LFRKMY+NGGCSVVP+GFLK C+ L+PD  IP                 
Sbjct: 1147 MDTM-SRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLDKL 1205

Query: 690  XXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSL 749
                S    V+NDY +LLLHD+ +L VD+ +Y+KWFD+ +  NGLSPIDD+FQGQMEN L
Sbjct: 1206 HDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265

Query: 750  KCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWD 809
             CQRCG++SY YSTFYVLSLA+P  P  K F ++KK+ RLEDCIN +T DE+L+ +NAWD
Sbjct: 1266 SCQRCGYSSYTYSTFYVLSLALPN-PVAKAFGKTKKL-RLEDCINFFTCDEVLSDQNAWD 1323

Query: 810  CPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXXXPFKS 869
            CP+C + S+     M+ D    +K   +F S+NG +                     F S
Sbjct: 1324 CPRCCSPSDY----MSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSS 1379

Query: 870  NSVKPEKLH--IKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV 927
                  KL   + + K  T+K+LNFITMP ILVIHLSRF YDLTKKN  +++YPLIL++V
Sbjct: 1380 ------KLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV 1433

Query: 928  LKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHG 987
            LKN+E+A++RLY I+NHFG L+SGHYTSLVNK L+HEI  G+QKWYYFDDE+VK + NHG
Sbjct: 1434 LKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHG 1493

Query: 988  DFDRGITSISSGDVYVLFYERI 1009
            D+D GI S+SS +VYVLFYERI
Sbjct: 1494 DYDNGIASVSSSNVYVLFYERI 1515

 Score =  204 bits (520), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 153/493 (31%), Positives = 240/493 (48%), Gaps = 58/493 (11%)

Query: 1   MSRLYTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKY 60
           M   Y PEYS EL  FV+EVY ++++  Y                 L ESYRE L   + 
Sbjct: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60

Query: 61  EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120
           E  +  YV+G+FY++LIIP S++F  RN SYSIY DLK+ Y+ + NM NV+L+V  KV S
Sbjct: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120

Query: 121 VLNQNMEILAKQHLDP---SRKRAFSVEE---PIIRYQLHNLQLNNAD------------ 162
           V+   +     +        RKRA+S++      +   L  L +  +             
Sbjct: 121 VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180

Query: 163 -----QKSVDDDYKSFASTEWKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQ 217
                Q+  DD+++    T W AP L+P+D+L L                          
Sbjct: 181 QGAFGQQQQDDEWED---TVWSAPNLEPDDQLKLAVSYSHSPSI---------------H 222

Query: 218 DDTDALDSVSDKLLGSIHKPDLLD-------RTGIIRKVPRHQSLPTEQHHKLYAQNDSS 270
           D +D+    S     S  +  +LD       R+G + +  +  S   + + +L +  D +
Sbjct: 223 DTSDSKTKDSGLENNSAAEFSVLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHN 282

Query: 271 LMLENMDSFDRSRTHRKDSYHSVYLGDELEDLNNISTGLARHQQENTIDCFALFSLLKDA 330
                 D  DR  TH +D  + +   D +    N  + +    + ++I C  L S L  +
Sbjct: 283 ------DVLDRFYTHGQDLRYPI-CNDGVVPCEN--SSIMWLYESSSIKCLDLLSKLTSS 333

Query: 331 ESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILD 390
           E R ++LLIDLRLPKR+E +H++A N++NIDP LL+D EKG  + S + L+ ++ N +  
Sbjct: 334 E-RSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFR 392

Query: 391 KISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTGTAIPKSLLGGYEQWKAFLNKQLR 450
              Q+  IV YTD  ++M + F++  +LF LL+      + K+L GGYEQWK+FL +  R
Sbjct: 393 SRRQFATIVCYTDNYTYMQIDFDFVFLLFRLLYLGRPQLVLKTLSGGYEQWKSFLKELKR 452

Query: 451 DSEFDKSLFLFRK 463
                 S FL+++
Sbjct: 453 TESIILSDFLWKR 465

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  486 bits (1250), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 311/452 (68%), Gaps = 29/452 (6%)

Query: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629
            +SIPTIE+S N +VSLSITGLRN+GNTCYINSMLQCLF  ++FRDLF+ GK+  + N   
Sbjct: 590  YSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEFFNQNY 649

Query: 630  SNTI-ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXX 688
            SN   +SK F++LFRKMY+NGGCSVVP  FLK    LRPD  IP                
Sbjct: 650  SNRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVTLDR 709

Query: 689  XXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENS 748
                 S    VAN+YP+LLL+D+ ++ V+ KEY KWF+E +  NGL+PID IFQGQ+EN 
Sbjct: 710  LHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQGQIENI 769

Query: 749  LKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAW 808
            L+CQRCG +S++YSTFYVLSLAIP  P   TFSR+K+ ++LEDCIN++T DE+L+GENAW
Sbjct: 770  LECQRCGNSSFSYSTFYVLSLAIPK-PSTSTFSRAKR-VKLEDCINMFTNDEILSGENAW 827

Query: 809  DCPKCGT--------HSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXX 860
            DCPKCG+        H   S     S+   +++ K  F  ++                  
Sbjct: 828  DCPKCGSAVTDMGPNHLKKSKKKKKSELGEERRSKSGFFRIHS---------------KS 872

Query: 861  XXXXXPFKSNSVKPEKLHI---KSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETM 917
                 PF+        L +   KSK+++T KTLNFI +P +L+IHLSRF+YDLTKKN+T+
Sbjct: 873  KRSKSPFRMLGSTKFPLAMEDWKSKELSTKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTI 932

Query: 918  INYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDD 977
            + YPL+L+++LKNNE ARYRLY ++NH GNL+SGHYTSLVNK   H++ KG+QKWYYFDD
Sbjct: 933  VTYPLVLNIILKNNETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDD 992

Query: 978  EVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
            EVVK+E  HG+ D+GI  +SS DVYVLFYER+
Sbjct: 993  EVVKEETKHGNIDQGILKVSSSDVYVLFYERL 1024

 Score =  248 bits (632), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 165/505 (32%), Positives = 253/505 (50%), Gaps = 53/505 (10%)

Query: 5   YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
           +TPEYS+ELL  VQ +Y  D+KHY+               E LFESY + L  +  +D L
Sbjct: 8   FTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQDAL 67

Query: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
             ++IG +Y++LI+P S++F  RNKSYSI++DL K+YQ++ NM+NVLLMV  +VDS+L++
Sbjct: 68  TAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSILDR 127

Query: 125 NMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKSFASTE------- 177
           N     +     +R RA+SV +     +L NL ++N +   + D   +  S +       
Sbjct: 128 NAREFKEFEHQKARTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSEQGREDMNN 187

Query: 178 ----------WKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDS-- 225
                     W AP L+PND+L +                              ALD   
Sbjct: 188 LQNDEDSSPVWTAPPLEPNDQLRIALDATPLSPSIM------------------ALDQPM 229

Query: 226 VSDKLLGSIHKPDLLDRTGIIRKVP---RHQSLPTEQHHKLYAQNDSSLMLENMDSFDRS 282
            + +L  S  +  L  R   +   P       +  +  +  Y +   +  L N +  DR 
Sbjct: 230 ATKELAISTSRKALSRRASAMGPTPYPIEELDISGQDGNSHYDELGFNKTLWNAN-VDRQ 288

Query: 283 RTHRKDSYHSVYL--GDELEDLNNIS----TGLARHQQENTIDCFALFSLLKDAESRENL 336
            THRKDSYHSVY+  G   + + +IS     GL R Q+++ I    LF++L  +E  E L
Sbjct: 289 TTHRKDSYHSVYMFEGGSDDHMPSISKDFTQGLERLQKQSIITAPELFTILSSSEESEKL 348

Query: 337 LLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYD 396
           LLID RL KR + NH++AP  + IDP  L+D +  T + +   L +I+  P   +   YD
Sbjct: 349 LLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKKPAFLERGSYD 408

Query: 397 NIVYYTDYKSFMHLTFNYELILFELLFKKTGT---AIPKSLLGGYEQWKAFLNKQLRDSE 453
            IVYYTD K++M + ++Y   LF LL         ++P  LLGGYE+WK  +     D  
Sbjct: 409 YIVYYTDMKTYMTIDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSVDHG 468

Query: 454 FDKSLFLFR---KSKSAPSDKTASK 475
            +   +++R   +SK A  D ++ +
Sbjct: 469 VNMDNYIYRPYGESKKALPDTSSKR 493

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  486 bits (1250), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 304/840 (36%), Positives = 440/840 (52%), Gaps = 49/840 (5%)

Query: 5   YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
           +TPEYS ELL  V+++Y  D+K +YA                L+ES+ + +     +D L
Sbjct: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67

Query: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
             Y+IG ++++LIIP S QF ARNK++ +++ LKKLY++++NM+NVLLMV  +VDSVL++
Sbjct: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127

Query: 125 NMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQL-----------NNADQKSVDDDYKSF 173
           +   L     D  RKRAFS  +  +  ++  L L              D    D ++ S 
Sbjct: 128 DFRKLK----DVERKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNFHSH 183

Query: 174 ASTE---WKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVSDKL 230
            +     WKAP L+PND+L L                     L           S S+  
Sbjct: 184 DTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKHKSKSELT 243

Query: 231 LGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMDSFDRSRTHRKDSY 290
           +     P         ++  RH     ++ H+L   +D     +     DR+  HRKDSY
Sbjct: 244 VEEKEHP---------QQDHRHHHGVQQETHQLGKDDDEQHFWDA--KVDRAVAHRKDSY 292

Query: 291 HSVYLGDELEDL--NNIST-------GLARHQQENTIDCFALFSLLKDAESRENLLLIDL 341
           HSVY+ D   D   N  +T        + R Q+++ I    LFS+L + + R  LLLIDL
Sbjct: 293 HSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDL 352

Query: 342 RLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYY 401
           RL  R++ N+++APN++ IDP +L+D    T +     L + + N I +K   +D IVYY
Sbjct: 353 RLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYY 412

Query: 402 TDYKSFMHLTFNYELILFELLFKKTGTAI---PKSLLGGYEQWKAFLNKQLRDSEFDKSL 458
           TD K++M + F+Y  + + L+      ++   P  LLGGYE+WKA L K L         
Sbjct: 413 TDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDD 472

Query: 459 FLFRKSKSAPSDKTASKPSVQTDNIIKSSPSILSKEHN--DDTLISSTXXXXXXXXXXXX 516
           +L+R   S    K  S  +   + +    P++  +  N       ++             
Sbjct: 473 YLYRPYSSNKEGKEKSANAKHIEPVPWKPPALPERMRNLPPPPPPATLPITKEMPPPVPP 532

Query: 517 XXXXXXXTIVYNRPPVPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIE 576
                      +  P    ++SPA + K  +A E +  Q + + ++ +     FS+PTIE
Sbjct: 533 KIQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPE-QLSQLDSYPMRQRQ----FSVPTIE 587

Query: 577 RSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNT-IIS 635
           RS N++V+LSITGLRN+G TCYINSMLQCLF  + FRDLF    Y R+ NP+  +T  +S
Sbjct: 588 RSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLS 647

Query: 636 KWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSE 695
           K FS+L RKMY+NGGCSVVP  FLK C+ LRPDF+IP                     S 
Sbjct: 648 KSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSN 707

Query: 696 PTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCG 755
            T+V N +P LLL+D E   V  +EY +WF+  L N   SPID IFQGQ+EN L C++CG
Sbjct: 708 QTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCG 767

Query: 756 FTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGT 815
           ++SY+YSTFY+LSLAIP        S     + LEDCIN++T DE+++ ENAWDCPKCG 
Sbjct: 768 YSSYSYSTFYILSLAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGV 827

 Score =  186 bits (472), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 104/124 (83%)

Query: 886  TIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHF 945
            +I+  NF+T+P +LVIHLSRF+YDLTKKNET+I YPLIL++VLKNNE  +YRLY ++NH 
Sbjct: 920  SIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHN 979

Query: 946  GNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLF 1005
            GNL+SGHYTSLVNK+  H++   +Q+WYYFDDEVVK E +HG+  +G+  +SS DVYVLF
Sbjct: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLF 1039

Query: 1006 YERI 1009
            YERI
Sbjct: 1040 YERI 1043

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  446 bits (1147), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 226/421 (53%), Positives = 287/421 (68%), Gaps = 29/421 (6%)

Query: 602  MLQCLFGCSQFRDLFLGGKYHRYLNPK--RSNTIISKWFSLLFRKMYLNGGCSVVPNGFL 659
            M+QCLFG    RDLF+  KY +YL+ +  RS+ + S+ FS+LF+KMYLNGGCSVVP  FL
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYLSKRIDRSSNL-SRSFSILFKKMYLNGGCSVVPTSFL 59

Query: 660  KACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNK 719
            K C+ LRPD  IP                     S    V  DYP+L+L+D  KL V+NK
Sbjct: 60   KTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNK 119

Query: 720  EYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKT 779
            EY KWFD+ +  NGLSPID IFQGQ+EN+L CQRCGF SYNYSTFYVLSLAIP  P   T
Sbjct: 120  EYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPK-PSSGT 178

Query: 780  FSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHS------NSSDGSMNSDETVDKK 833
            FSRSK++ +LEDCIN++T DE+L+GENAWDC  CG+ S           + N +E    +
Sbjct: 179  FSRSKRV-KLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGNGEEKKRSR 237

Query: 834  KKKNFL--SVNGDHXXXXXXXXXXXXXXXXXXXXPF-KSNSVKPEKLHIKSKKMTTIKTL 890
            K + FL  ++NG                      PF KS S +P    +K KK+ TIK++
Sbjct: 238  KSRLFLLPNING---------------RSSRSISPFRKSASPRPPHEKLKHKKLVTIKSM 282

Query: 891  NFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVS 950
            NFI++P  LVIHLSRF+YDL+KKNET++ YPLIL++VL NNE A+YRLYGI+NH GNL+S
Sbjct: 283  NFISLPPTLVIHLSRFYYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLIS 342

Query: 951  GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIH 1010
            GHYT+LVNK  +HE++K +QKWYYFDDEVVK+E NHG+ D G+  +SS  VYVLFYER++
Sbjct: 343  GHYTTLVNKEKNHELKKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERVY 402

Query: 1011 S 1011
            +
Sbjct: 403  N 403

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  464 bits (1195), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 235/451 (52%), Positives = 306/451 (67%), Gaps = 28/451 (6%)

Query: 572  IPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSN 631
            +PTIE++PN +VSLSITGLRN+GNTCYI+SMLQCLF  +  RDLF+  KY  Y+N K ++
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTD 668

Query: 632  TI-ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXX 690
             I +S+ FS+LFRKMYLNGGCSVVP  FLK C+ LRPD  IP                  
Sbjct: 669  KINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRLH 728

Query: 691  XXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLK 750
               S+   V NDY NLLL+D E++ V   +Y KWF+    + G+SPIDDIFQGQ+ENS+ 
Sbjct: 729  DELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIENSIN 788

Query: 751  CQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDC 810
            CQRCG++S+NYS+FYVLSLAIP +    +FSR+ ++ +LEDCIN++T+DE+L+GENAWDC
Sbjct: 789  CQRCGYSSFNYSSFYVLSLAIPKISV-MSFSRTNRV-KLEDCINMFTRDEVLSGENAWDC 846

Query: 811  PKCGTHSNS-----------SDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXX 859
             +CG+ S++              S  +D++   +K + FL                    
Sbjct: 847  SRCGSQSDNFVKTSHNDHHKEHTSETTDDSKQNRKSRLFL-------------LPKKYNP 893

Query: 860  XXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMIN 919
                  PF  +S        KSKKM TIK+LNFI MP ILVIHLSRFFYD++KKNET++ 
Sbjct: 894  TSRSLSPFGRHSSHKSSEKWKSKKMETIKSLNFIKMPKILVIHLSRFFYDMSKKNETVVA 953

Query: 920  YPLILDVVLKNNEIARYRLYGIINHFGNLV-SGHYTSLVNKHLSHEIRKGQQKWYYFDDE 978
            YPLIL++VLKN E+ +YRLY I+NH GN V SGHYT+LVNK+ +H++ K +Q+WYYFDDE
Sbjct: 954  YPLILNIVLKNEEVCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDE 1013

Query: 979  VVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
            VVK E NHG+ D G+  +SS  VYVLFYE+I
Sbjct: 1014 VVKHELNHGNIDEGVNKVSSSHVYVLFYEKI 1044

 Score =  236 bits (601), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 160/506 (31%), Positives = 254/506 (50%), Gaps = 70/506 (13%)

Query: 5   YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
           +TPEYS+ELL  V + Y+ ++K ++                 L ESY + L  +KY++CL
Sbjct: 7   FTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECL 66

Query: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
             Y++G FY++LIIP S QF  RNKS+ IY++LK LYQ++ NM+NVL +V ++VDS+L++
Sbjct: 67  SAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDE 126

Query: 125 NMEILAKQHLDPSRKRAFSVEEPIIR--YQLHNLQLN----NADQKSVDDDYKS-FASTE 177
           ++  L        R RA+S   P +    +   L +N    N +  S D+  +S F  T 
Sbjct: 127 SILELEGIEKVIKRDRAYSSPAPKVNNISKFSKLSINDNHHNGETISTDNKLQSHFPQTP 186

Query: 178 -------------------------------WKAPQLDPNDRLHLXXXXXXXXXXXXXXX 206
                                          W  P L+PND+L L               
Sbjct: 187 NYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIWHIPSLEPNDQLKLALEQPVEFSDEEIDA 246

Query: 207 XXXXXXLYKEQDDTDALDSVSDKLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQ 266
                 L +       L     K   SI    L         VP     P  ++ K++  
Sbjct: 247 SSISEPLGRRYS---PLSPYQKKRNSSISSAFL---------VP----FPHNENDKVH-- 288

Query: 267 NDSSLMLENMDSFDRSRTHRKDSYHSVYLGDELEDL---------NNISTGLARHQQENT 317
            D+S+++E++   DRS THRKDSYHSVY+ ++ E+          N+    + R Q++N 
Sbjct: 289 -DNSMLIEDL-PVDRSVTHRKDSYHSVYMNNQDEESDSGAHYGLSNSYIQSMDRLQKQNV 346

Query: 318 IDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESF 377
           I C  L+S+L     R+ LLL+DLR+PK   +NH++AP+++ IDP LL++ E  T + SF
Sbjct: 347 ITCSELYSILSSPTERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYSF 406

Query: 378 EALKKIVANPILDKISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTG---TAIPKSL 434
           E L K + NP++ +++++D IVYY+D ++FM   +++    F LL          +P +L
Sbjct: 407 EELVKRINNPLISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSLNLKQVPTNL 466

Query: 435 LGGYEQWKAFLNKQLRDSEFDKSLFL 460
           LGG+E+WK  L    ++   D + F+
Sbjct: 467 LGGFEKWKKVLKTYNKEYGIDITPFI 492

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score =  461 bits (1185), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/481 (50%), Positives = 307/481 (63%), Gaps = 43/481 (8%)

Query: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629
            + IPTIE+S N +VSLSITGLRN+GNTCYINSM+QCLF    FR LF+  KY  YL   R
Sbjct: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643

Query: 630  SNTI----ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXX 685
             N +    +S   ++LF KMYLNGGCSVVP GFLK  + LRPD  IP             
Sbjct: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703

Query: 686  XXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQM 745
                    S    VANDYPNLLL+D + L V NKEY  WFD+ +  NG+SPIDDIFQGQM
Sbjct: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763

Query: 746  ENSLKCQRCGFTSYNYSTFYVLSLAIP--AMPPPKTFSRSKKIIRLEDCINLYTQDELLT 803
            ENSL+C+RCG+T++NYSTFYVLSLAIP  +M   K    ++K ++LEDCIN++T DE+L+
Sbjct: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823

Query: 804  GENAWDCPKCGTHSNSSDGSM------NSDETVDKKKKKNFLSVN-----------GDHX 846
            GENAWDCP+CG  +++S  +       +S+    +KKK  F +++           GD  
Sbjct: 824  GENAWDCPRCGPTASTSLSASASALENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGD-S 882

Query: 847  XXXXXXXXXXXXXXXXXXXPFKSNSVKPEKLH-----------------IKSKKMTTIKT 889
                               PFK      ++ H                  K+KK+TT+KT
Sbjct: 883  SNESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFANSSNDGNNFNDFKNKKLTTVKT 942

Query: 890  LNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLV 949
            +NF+T+P ILVIHLSRF+YDLTKKN T+I YPLIL+++LKNN+  +YRL+G++NH G L+
Sbjct: 943  INFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLI 1002

Query: 950  SGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
            SGHYTSLVNK L H +  G+ KWYYFDDEVVK +  HG  D+ +  ISS D YVLFYER+
Sbjct: 1003 SGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060

Query: 1010 H 1010
            H
Sbjct: 1061 H 1061

 Score =  243 bits (619), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 166/484 (34%), Positives = 248/484 (51%), Gaps = 64/484 (13%)

Query: 5   YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
           +TPEYS+ELL  V+++Y +D+KHYY               E LFE Y +S+  E+  D L
Sbjct: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDAL 67

Query: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
             +VIG +YVFLIIP S+QF  RNKSYSIYSDLKK+Y++E+NM+NV+LMV  ++  VL+ 
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDD 127

Query: 125 NMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQK-------SVDDDYKSFASTE 177
           +++ +       ++KRAFSV    +  QL +L L+ A  +       S ++D    +S  
Sbjct: 128 SVKHVVGIEHRITKKRAFSVPGIDLSDQLASLSLDAAGPRGHLHKTSSTEEDADQ-SSPV 186

Query: 178 WKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVSDKLLGSIHKP 237
           W AP L+PND+L L                                      LL  +   
Sbjct: 187 WTAPNLEPNDQLKLA-------------------------------------LLPEVIPT 209

Query: 238 DLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMD----SFDRSRTHRKDSYHSV 293
                +G     P  QS+  E     +  ND +    +      + DRS THRKDSYHSV
Sbjct: 210 PAFPESGRKTSTPVRQSVLLEDVPYTHNDNDGTSASSDQPFGEITADRSVTHRKDSYHSV 269

Query: 294 YLGD------ELEDLNNIST-----GLARHQQENTIDCFALFSLLKDAESRENLLLIDLR 342
           Y+ D      + +DL ++ T      L   Q+++ I    LF++L +    E LLLIDLR
Sbjct: 270 YMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLR 329

Query: 343 LPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIV-ANPILDKISQYDNIVYY 401
           +P+R   N++VAPNL+ IDP LL+D +    +   + L++++  N       ++  +V Y
Sbjct: 330 IPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCY 389

Query: 402 TDYKSFMHLTFNYELILFELLFKKTGT---AIPKSLLGGYEQWKAFLNKQLRDSEFDKSL 458
           +D K+FM + F+Y  I F LL     T    +P +LLGGYE+WK  L+   +        
Sbjct: 390 SDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDD 449

Query: 459 FLFR 462
           +L+R
Sbjct: 450 YLYR 453

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (REAL)
          Length = 1064

 Score =  458 bits (1178), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 243/483 (50%), Positives = 306/483 (63%), Gaps = 45/483 (9%)

Query: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629
            ++IPTIE+S N +VSLSITGLRN+GNTCYINSM+QCLF    FR LF+   Y  YL P +
Sbjct: 583  YNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642

Query: 630  SN-----TIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXX 684
             +     + +S   ++LF KMYLNGGCSVVP GFLK  + LRPD  IP            
Sbjct: 643  GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702

Query: 685  XXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQ 744
                     S    VANDYPNLLL++ + L V N EY  WFD+ +  NG+SPIDDIFQGQ
Sbjct: 703  LLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 762

Query: 745  MENSLKCQRCGFTSYNYSTFYVLSLAIP--AMPPPKTFSRSKKIIRLEDCINLYTQDELL 802
            MENSL+C+RCG+T++NYSTFYVLSLAIP  +M   K    ++K ++LEDCIN++T DE+L
Sbjct: 763  MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVL 822

Query: 803  TGENAWDCPKCGTHSNSSDGSMNSDE------------------TVDKKKKKNFLSVNGD 844
            +GENAWDCP+CG  ++SS  S ++                    T+    K+  L   GD
Sbjct: 823  SGENAWDCPRCGPTASSSSASASASAFESESPIAKSKKKKSRFFTLHTGSKRRHLDFFGD 882

Query: 845  HXXXXXXXXXXXXXXXXXXXXPFK--------SNSVKP---------EKLHIKSKKMTTI 887
            +                    PFK        SNS  P              K+KK+TT+
Sbjct: 883  N-INESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFANNNNDGNNINDFKNKKLTTV 941

Query: 888  KTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGN 947
            KT+NF+T+P ILVIHLSRF+YDLTKKN T+I YPLIL+++LKNNE  +YRL+G++NH G 
Sbjct: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGT 1001

Query: 948  LVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYE 1007
            LVSGHYTSLVNK L H +  G+ KWYYFDDEVVK +  HG  D+ +  ISS DVYVLFYE
Sbjct: 1002 LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDVYVLFYE 1059

Query: 1008 RIH 1010
            R+H
Sbjct: 1060 RVH 1062

 Score =  261 bits (666), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 173/485 (35%), Positives = 262/485 (54%), Gaps = 60/485 (12%)

Query: 2   SRLYTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYE 61
           + L+TPEYS+ELL  VQ++Y +D+KHYY               E L+E Y +S+   +  
Sbjct: 5   TTLFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPN 64

Query: 62  DCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSV 121
           D L  ++IG +YVFLIIP S+QF  RNKSYSIY+DLKK+Y++E+NM+NV+LMV  ++  V
Sbjct: 65  DALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVV 124

Query: 122 LNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNAD------QKSVDDDYKSFAS 175
           L+++++         ++KRAFSV    +  Q+ +L L NA       + S  ++    +S
Sbjct: 125 LDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDAEQSS 184

Query: 176 TEWKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVSDKLLGSIH 235
             W AP L+PND+L L                     +Y E          S +   S  
Sbjct: 185 PVWTAPNLEPNDQLKL-----------ALLPEVIPTPIYPE----------SGRKTSSPV 223

Query: 236 KPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLE---NMDSFDRSRTHRKDSYHS 292
           +P +L     +  VP          +  Y    SS  L       + DRS THRKDSYHS
Sbjct: 224 RPSVL-----LEDVP----------YNCYDGGASSASLNPSFGEITVDRSITHRKDSYHS 268

Query: 293 VYLGD------ELEDLNNIST-----GLARHQQENTIDCFALFSLLKDAESRENLLLIDL 341
           +Y+ D      + +DL N+ T      L   Q+++ I    LFS+L ++  RE +LLIDL
Sbjct: 269 IYMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDL 328

Query: 342 RLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIV-ANPILDKISQYDNIVY 400
           R+P+R E NH+VAPNL+ IDP LL+D +  T +   + L+ ++  N I     +++ +VY
Sbjct: 329 RIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVY 388

Query: 401 YTDYKSFMHLTFNYELILFELLF---KKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKS 457
           YTD K+FM++ F+Y  I F L+    K   T++P +LLGGYE+WK  L+   ++ +    
Sbjct: 389 YTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIE 448

Query: 458 LFLFR 462
            +L+R
Sbjct: 449 DYLYR 453

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score =  450 bits (1157), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 240/486 (49%), Positives = 303/486 (62%), Gaps = 51/486 (10%)

Query: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629
            +SIPTIER+PN +VSLSITGLRN+GNTCYINSM+QCLF    FR LF+   Y  YL P  
Sbjct: 580  YSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLA 639

Query: 630  SNTI-----ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXX 684
            SN       +S   S+LF KMYLNGGCSVVP GFLK  + LRPD  IP            
Sbjct: 640  SNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 699

Query: 685  XXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQ 744
                     S    VANDYPNLLL++ + L V N EY  WFD+ +  NG+SPIDDIFQGQ
Sbjct: 700  LLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 759

Query: 745  MENSLKCQRCGFTSYNYSTFYVLSLAIP--AMPPPKTFSRSKKIIRLEDCINLYTQDELL 802
            MENSL+C+RCG+T++NYSTFYVLSLAIP  +M   K    ++K ++LEDCIN++T DE+L
Sbjct: 760  MENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVL 819

Query: 803  TGENAWDC----PKCGTHSNSSDGSMNSDE-------------TVDKKKKKNFLSVNGDH 845
            +GENAWDC    P     +++S  ++ ++              T+    K+  L + GD 
Sbjct: 820  SGENAWDCPRCGPTASFTASASASALENESSILKSKKKKSRFFTLHTGSKRRHLDIFGDS 879

Query: 846  XXXXXXXXXXXXXXXXXXXXPFK---------------------SNSVKPEKLHIKSKKM 884
                                PFK                     SN+        K+KKM
Sbjct: 880  NGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTG----DFKNKKM 935

Query: 885  TTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINH 944
            TT+KT+NF+T+P ILVIHLSRF+YDLTKKN T+I YPLIL+++LKNN+  +YRL+G++NH
Sbjct: 936  TTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNH 995

Query: 945  FGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVL 1004
             G L+SGHYTSLVNK L H +  G+ KWYYFDDEVVK +  HG  D+ +  ISS DVYVL
Sbjct: 996  TGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVYVL 1053

Query: 1005 FYERIH 1010
            FYER++
Sbjct: 1054 FYERVY 1059

 Score =  255 bits (651), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 175/486 (36%), Positives = 256/486 (52%), Gaps = 62/486 (12%)

Query: 2   SRLYTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYE 61
           + L+TPEYSDELL  VQ++Y +D+KHYY               E LFE Y +S+   +  
Sbjct: 5   TTLFTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPN 64

Query: 62  DCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSV 121
           D L  +VIG +YVFLIIP S+QF  RNKSYSIY+DLKK+Y++E+NM+NV+LMV  ++  V
Sbjct: 65  DALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVV 124

Query: 122 LNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKS------VDDDYKSFAS 175
           L+++++ +       ++KRAFSV    +  Q+ +L L+ A  +       + +D    +S
Sbjct: 125 LDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDMDQSS 184

Query: 176 TEWKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVSDKLLGSIH 235
             W AP L+PND+L L                     L  E   T   +    K   S  
Sbjct: 185 PVWTAPNLEPNDQLKL--------------------ALLPEVIPTSTFNEPERK-STSPA 223

Query: 236 KPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMD----SFDRSRTHRKDSYH 291
           +P +L     +  VP             Y  ND+S    N      + DRS THRKDSYH
Sbjct: 224 RPSVL-----LEDVP-----------CTYHDNDASTASLNPPFRDITADRSVTHRKDSYH 267

Query: 292 SVYL-------GDELEDLNNISTGLARH----QQENTIDCFALFSLLKDAESRENLLLID 340
           SVY+        D  E LN  + G  +     Q+++ I    LFS+L +   RE +LLID
Sbjct: 268 SVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLID 327

Query: 341 LRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVA-NPILDKISQYDNIV 399
           LR+P+R   NH+VAPNL+ +DP LL+D +  T +   + L+ ++  N       ++D IV
Sbjct: 328 LRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIV 387

Query: 400 YYTDYKSFMHLTFNYELILFELLF---KKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDK 456
           YY+D K+FM + F+Y  I F L+    K   T +P +LLGGYE+WK  L+   ++     
Sbjct: 388 YYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISV 447

Query: 457 SLFLFR 462
             +L+R
Sbjct: 448 EDYLYR 453

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  400 bits (1029), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/456 (47%), Positives = 287/456 (62%), Gaps = 20/456 (4%)

Query: 556  RNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            R   TV++  L+    +PTIE S +    LSITGL+N  NTCYINS++QCLFG + FRDL
Sbjct: 274  REKKTVRSSALN---KLPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDL 330

Query: 616  FLGGKYHRYLNPKR--SNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPT 673
            FL  KY  +L   +      +S+   +LF+KMYLNGG ++ PNGFLK C  LRPD +IP 
Sbjct: 331  FLTKKYRLFLQTDKYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPD 390

Query: 674  XXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNG 733
                                S  T V   YP+L+ +D     V+  +Y KW++  +  +G
Sbjct: 391  DQQDTQEFLLIILARLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDG 449

Query: 734  LSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCI 793
            LSPID IF+GQMEN LKCQRCG +S++YSTFYVLSLAIP +      S+SKK I+LEDCI
Sbjct: 450  LSPIDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKK-IKLEDCI 508

Query: 794  NLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXX 853
            NL+T DE L+G+N+WDCP CGT    +D     +E+  +KKK  F S +           
Sbjct: 509  NLFTSDEELSGDNSWDCPNCGT----TDLKTKINESTSQKKKSTFFSFHS-------RSR 557

Query: 854  XXXXXXXXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKK 913
                            N+ K  K    S+K+TT+K+ +FI +P ILVIHLSRF+YDLT+K
Sbjct: 558  SKSPHHHHHHHHHSHDNTEKHSK-KWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRK 616

Query: 914  NETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWY 973
            N T+I YPLIL+V+LKNN++ RY+LYG +NH GNLV+GHYTS VNK  +HEI   +Q W 
Sbjct: 617  NNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWI 676

Query: 974  YFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
             FDD+ +K+  +H DF+ G T +SS +VYVLFYER+
Sbjct: 677  TFDDDYIKQH-HHDDFEAGKTEVSSSEVYVLFYERM 711

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 74/134 (55%)

Query: 11  DELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCLCEYVIG 70
           D++++ V+ VY  D+K +Y+             A  LFE Y     + +  + L  ++IG
Sbjct: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65

Query: 71  SFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNMEILA 130
            +Y++L+IP S+QF  RN  YS Y+ LK  YQDE  MS VL +V  + + ++++ +    
Sbjct: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125

Query: 131 KQHLDPSRKRAFSV 144
           +     +RKRA+S+
Sbjct: 126 RISRTITRKRAYSL 139

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  395 bits (1016), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 214/440 (48%), Positives = 277/440 (62%), Gaps = 9/440 (2%)

Query: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629
            F +P IE S N    LSITGLRN  NTCYINSM+QCLF  + FRDLFL  KY  +L  ++
Sbjct: 278  FKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLENEK 337

Query: 630  --SNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXX 687
                  +S    +LF+KMYLNGG +++PNGFLK C  LRPD +IP               
Sbjct: 338  YPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMIILA 397

Query: 688  XXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMEN 747
                  S    V   Y +L+L+D   L V+  +Y KW +E + ++GLSPID IFQGQMEN
Sbjct: 398  RIHEELSN-NNVTKYYSDLILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQGQMEN 456

Query: 748  SLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENA 807
             LKCQRCG +SY+YSTFYVLSLAIP        S+SKKI +LEDCIN +T DE L+ +NA
Sbjct: 457  ILKCQRCGNSSYSYSTFYVLSLAIPKASLYSFTSKSKKI-KLEDCINFFTSDEELSDDNA 515

Query: 808  WDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXXXPF 867
            WDCPKC T    ++  +  DE + +KK+    +++                         
Sbjct: 516  WDCPKCRT----AEYKLKKDENLSQKKRSILFNLHSRPRSKSPRHRHHHHHHRHKNDDAK 571

Query: 868  KSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV 927
            K++         KSKK+TTIK+L+FI +P ILVIHLSRF+YDLTKKN T+I YPLIL+++
Sbjct: 572  KNDDATKNSKKWKSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNII 631

Query: 928  LKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEF-NH 986
            LKNN++ RY+LY  +NH GNL++GHYTS+VNK  SHEI   +Q W  FDD+V+K+   + 
Sbjct: 632  LKNNKVVRYKLYATVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDR 691

Query: 987  GDFDRGITSISSGDVYVLFY 1006
             DF+ G T ISS +VYVLFY
Sbjct: 692  DDFETGRTEISSNEVYVLFY 711

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%)

Query: 11  DELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCLCEYVIG 70
           +++LS V+EVY  D+K  Y+             A  LF+ Y   L   + ++ L  +++G
Sbjct: 6   NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVG 65

Query: 71  SFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNMEILA 130
            FY++L+IP S+QF  RN  YS Y+ LK  YQDE  MS VL +V  +   +++Q +    
Sbjct: 66  GFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSK 125

Query: 131 KQHLDPSRKRAFSV 144
           +      RKRA+S+
Sbjct: 126 RISRSMKRKRAYSL 139

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  407 bits (1046), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/553 (41%), Positives = 319/553 (57%), Gaps = 37/553 (6%)

Query: 280 DRSRTHRKDSYHSVYL-GDELEDLNNIS--------TGLARHQQENTIDCFALFSLLKDA 330
           DRS THRKDSYHSVY+  D  ED NN            L   Q+++ I C  LFSLL + 
Sbjct: 447 DRSVTHRKDSYHSVYMFNDSNEDNNNHGYDETSEYIESLEHIQKQDVITCPELFSLLSNN 506

Query: 331 ESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILD 390
             RE +LLIDLR P+RF  NH+VAPN+L ++P LL+D    T + + E L++I+ NP+  
Sbjct: 507 VEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQIINNPLFS 566

Query: 391 KISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTGT---AIPKSLLGGYEQWKAFLNK 447
           K   +  +VYY+D K++M++TF+Y   LF LL   T     ++P SLLGGYE+W   +N 
Sbjct: 567 KRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSLLGGYEKWYKVINS 626

Query: 448 QLRDSEFDKSLFLFRKSKSAPSDK---TASKPSVQTDNIIKSSPSILSKEHNDDTLISST 504
            +       + +++RK   A + +      KP ++    I + P +  +          +
Sbjct: 627 YVNQYSITMNDYVYRKDAGASAGRPLNNNEKPKME----IWTPPQLPIRIRKRAPPPPPS 682

Query: 505 XXXXXXXXXXXXXXXXXXXTIVYNRPPVPLPINSPAPLLKPSIAKELRTPQRN-DWTVQT 563
                                    PP+P  IN       P I   L     + D   Q 
Sbjct: 683 SLPKPNSGKMP--------------PPLPPKINLHGNPSLPPIHSPLENQVHSLDTHKQN 728

Query: 564 QHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHR 623
             +H  FSIP +E+S N++VSLSITGLRN+GNTCYINSMLQCLF  ++FR++FL  KY +
Sbjct: 729 GAIHRHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEK 788

Query: 624 YLNPK-RSNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXX 682
           Y++    +N  +SK F++LF+KMY+NGGCSVVP GFLK C++LRPD  IP          
Sbjct: 789 YMDHDIPTNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFL 848

Query: 683 XXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQ 742
                      S   +V  DYP+L+ +D + + V   +Y KW++E +K+NGLSPID +FQ
Sbjct: 849 MLILDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVFQ 908

Query: 743 GQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELL 802
           GQ E+ L CQRCG +S+ YSTFY+LSLAIP       F + K+ + LEDCI ++T DE+L
Sbjct: 909 GQTEDGLVCQRCGCSSFTYSTFYILSLAIPKA-STNAFGKIKR-VNLEDCIKMFTNDEIL 966

Query: 803 TGENAWDCPKCGT 815
           + ENAWDCP+CG+
Sbjct: 967 SDENAWDCPRCGS 979

 Score =  190 bits (483), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%)

Query: 881  SKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYG 940
            S KM TIK++NF+  P ILVIHLSRF+YDLTKKN T+I YPL L++ LKN E+ARY+LYG
Sbjct: 1083 SGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNGEVARYKLYG 1142

Query: 941  IINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGD 1000
            ++NH G LVSGHYTSLVNK   HE+   +QKW+YFDDE+VK+E NHGD + G+TSISS  
Sbjct: 1143 LVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVTSISSSH 1202

Query: 1001 VYVLFYERI 1009
            VYVLFY+RI
Sbjct: 1203 VYVLFYQRI 1211

 Score =  111 bits (278), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 87/147 (59%), Gaps = 7/147 (4%)

Query: 5   YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
           YTPEYSDELL  VQE+Y+ + K +Y              +  LFE+Y +SL    ++D L
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDAL 69

Query: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
             +++GSFY++ IIP S QF  +N+ Y +Y +LK LY+DELNM+NVL MV  ++  +L+ 
Sbjct: 70  SAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDS 129

Query: 125 NM----EILAKQHLDPS---RKRAFSV 144
           N     E      +D     R+RAFSV
Sbjct: 130 NYKSQNESSNNLFVDSKFIRRERAFSV 156

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  390 bits (1002), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/465 (44%), Positives = 288/465 (61%), Gaps = 20/465 (4%)

Query: 550  ELRTPQRNDWTVQTQHLHVP--FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLF 607
            ++  P+  +  ++      P  +++P IE S +    LSITGL+N  NTCYINS++QCLF
Sbjct: 258  KVEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLF 317

Query: 608  GCSQFRDLFLGGKYHRYLNPKR--SNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHML 665
            G + FRDLFL  KY  +LN  +      +S+   +LF+KMYLNGG +++PN FLK C  L
Sbjct: 318  GTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKL 377

Query: 666  RPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWF 725
            RPD +IP                     S    V   YP+L+ +D   L V+  +Y+KW+
Sbjct: 378  RPDLNIPDDQQDTQEFLLIVLARIHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWY 436

Query: 726  DEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKK 785
            +  +  +GLSPID I++GQ+EN LKCQRCG +SY+YSTFYVLSLAIP +      S+S+K
Sbjct: 437  ERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRK 496

Query: 786  IIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDH 845
            I +LEDCINL+T DE L+G+NAWDCP C      +D     +E   +KKK    ++ G H
Sbjct: 497  I-KLEDCINLFTGDEELSGDNAWDCPNCRI----TDSKSKKEEITSQKKKS---TIFGFH 548

Query: 846  XXXXXXXXXXXXXXXXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSR 905
                                  K+   +       SKK+TTIK+L+FI +P ILVIHLSR
Sbjct: 549  SRSRSKSPHHHHHHHHSSDDSTKNAKKR------NSKKLTTIKSLDFIVLPPILVIHLSR 602

Query: 906  FFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEI 965
            F+YDLTKKN T+I YPLIL+++LKN ++ RY+LYG +NH GNL++GHYTS+VNK  SHEI
Sbjct: 603  FYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEI 662

Query: 966  RKGQQKWYYFDDEVVKKEF-NHGDFDRGITSISSGDVYVLFYERI 1009
               +Q W  FDD+ +++   +  +F+ G T +SS +VYVLFYER+
Sbjct: 663  GLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYERM 707

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 71/134 (52%)

Query: 11  DELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCLCEYVIG 70
           D++L+ V++VY  D+K +Y+             A  LF  Y   L + +  + L  ++IG
Sbjct: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65

Query: 71  SFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNMEILA 130
            +Y++LIIP S+QF  RN  YS Y+ LK  YQDE  M  VL +V  +   ++++ +    
Sbjct: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125

Query: 131 KQHLDPSRKRAFSV 144
                  RKRA+S+
Sbjct: 126 GICRTIKRKRAYSL 139

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
            YKR098C (REAL)
          Length = 712

 Score =  389 bits (999), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/443 (47%), Positives = 273/443 (61%), Gaps = 17/443 (3%)

Query: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629
            F  PTIE S      LSITGL+N  NTCYINS++QCLFG + FRDLFL  KY  +L  + 
Sbjct: 274  FEPPTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEE 333

Query: 630  --SNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXX 687
                  +S+    LF+KMY NGG ++VPNGFLK C  LRPD +IP               
Sbjct: 334  YPKEVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILA 393

Query: 688  XXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMEN 747
                  S    V   Y +L+ +D   L V+  +Y KW++E +  +GLSPID IF+GQMEN
Sbjct: 394  RIHEELSNEN-VTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMEN 452

Query: 748  SLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENA 807
             LKCQRCG +S++YSTFYVLSLAIP        S+SKK I+LEDCINL+T DE LTG+NA
Sbjct: 453  ILKCQRCGNSSFSYSTFYVLSLAIPKNSVHSFTSKSKK-IKLEDCINLFTSDEELTGDNA 511

Query: 808  WDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXXXPF 867
            WDCP+C       D  + + E   +KK+    S    H                      
Sbjct: 512  WDCPECRI----DDSKLKTGENSSQKKRSPLFSF---HSRSRSKSPHHHHHYHHHGSDNT 564

Query: 868  KSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV 927
              NS K      KSK++TTIK+L+FI +P ILVIHLSRF+YDLTKKN  +I YPLIL+++
Sbjct: 565  TKNSNK-----WKSKRLTTIKSLDFIFLPPILVIHLSRFYYDLTKKNNAVITYPLILNII 619

Query: 928  LKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDE-VVKKEFNH 986
            LKNN++ RY+LYG +NH GNL++GHYTS+VNK  SHEI   +Q W  FDD+ +++   + 
Sbjct: 620  LKNNKVVRYKLYGTVNHSGNLITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQHHKDR 679

Query: 987  GDFDRGITSISSGDVYVLFYERI 1009
              F+ G T +SS +VYVLFYER+
Sbjct: 680  DGFEAGKTKMSSSEVYVLFYERM 702

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 83/150 (55%)

Query: 11  DELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCLCEYVIG 70
           D++L+ V++VY  D+K +Y+                LF+ Y   L + +  + L  ++IG
Sbjct: 6   DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIG 65

Query: 71  SFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNMEILA 130
            +Y++LIIP S+QF  R+  YS Y+ LK  YQDE  MS VL +V  +  S+++Q +    
Sbjct: 66  GYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLSDSN 125

Query: 131 KQHLDPSRKRAFSVEEPIIRYQLHNLQLNN 160
           +  +  +RKRA+S+    +   + +L ++N
Sbjct: 126 RITVTITRKRAYSLPLRPLPVHMASLSIHN 155

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
            YIL156W
          Length = 846

 Score =  378 bits (971), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/446 (45%), Positives = 274/446 (61%), Gaps = 29/446 (6%)

Query: 567  HVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN 626
            +  + +P +  S N +V LSI+GLRN+GNTCYINSMLQCLF  + FR+LFL  +Y  Y+ 
Sbjct: 425  YTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIG 484

Query: 627  PKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIP-TXXXXXXXXXXXX 685
             K  +  +S  F +LFRKMYLNGGC+V+P  FLK C+ LRPD  IP              
Sbjct: 485  TK-VDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLL 543

Query: 686  XXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNK-EYDKWFDEGLKNNGLSPIDDIFQGQ 744
                    S   ++ +++P+L+ +D + + V+N  EY KWF E L+N GLS I +IFQGQ
Sbjct: 544  DQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQ 603

Query: 745  MENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTG 804
            +ENSL+CQRC +TS NYS F  LSL+IP         + +K++ LEDCI+L+ ++E+LTG
Sbjct: 604  LENSLECQRCNYTSTNYSNFCTLSLSIPNKR-----RKFRKLVDLEDCISLFIENEMLTG 658

Query: 805  ENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXX 864
            ENAW+CPKC + SN++     S       K KN                           
Sbjct: 659  ENAWNCPKCSSSSNNNTSKRKSRGFFKFSKHKN-------------------RSHNDLTF 699

Query: 865  XPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINYPLI 923
              +  NS   + +    KK+ T K+ +FI +PN+L+IHLSRF    L  KN T I YP I
Sbjct: 700  SEYNHNS-SSDDVKFSKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAI 758

Query: 924  LDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKE 983
            L + LKN E  R++LYG++NHFGNL +GHYTSL+NK  SH++   +QKW+YFDDE VK++
Sbjct: 759  LTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQ 818

Query: 984  FNHGDFDRGITSISSGDVYVLFYERI 1009
            FN+ D D+ +  ISS DVYVLFYE+I
Sbjct: 819  FNYFDLDKNVNRISSSDVYVLFYEKI 844

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 81/165 (49%), Gaps = 4/165 (2%)

Query: 302 LNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVAPNLLNID 361
           +N+  T L    +E  I    LFS+L +   R  +L+IDLRL + F    + +PNL+  D
Sbjct: 199 INDEDTYLKHLYEECFITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNLIKFD 258

Query: 362 PCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKSFMHL-TFNYELILFE 420
           P  L++    T +    +L    +NP+  KI  +  I+ Y+D ++     +F Y    F+
Sbjct: 259 PIELWNNRDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNFSFFK 315

Query: 421 LLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSK 465
           LL   +    P  LLGG+E+W+  ++        + S ++F  +K
Sbjct: 316 LLMSSSMKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNNK 360

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 85/184 (46%), Gaps = 36/184 (19%)

Query: 10  SDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCLCEYVI 69
           SDEL   V  +Y+  +K  Y               E LFE +     ++   D L  ++I
Sbjct: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF-----LKGNTDSLDSFII 67

Query: 70  GSFYVFLIIPGSVQF--SARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNME 127
           G FY+ L+IP S     S+ N   +IY DLKK Y+ + N+S++L ++  + +++L     
Sbjct: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL----- 122

Query: 128 ILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKSFASTEWKAPQLDPND 187
                       ++F V+ P            ++  +  +D+    ++T W+AP L+PND
Sbjct: 123 ------------QSFDVDAP------------SSHSQHEEDNTADSSTTIWQAPFLEPND 158

Query: 188 RLHL 191
           +L L
Sbjct: 159 QLKL 162

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
            YIL156W possible pseudogene; NNN added to avoid internal
            stop codon
          Length = 656

 Score =  337 bits (863), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 272/480 (56%), Gaps = 32/480 (6%)

Query: 549  KELRTPQRNDWTVQTQHLHVPFS---------IPTIERSPNEFVSLSITGLRNMGNTCYI 599
            + L TP+R+  T+ T+ L    +         +P I+ + N    LS+ GLRN GNTCYI
Sbjct: 191  RTLSTPKRSS-TLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYI 249

Query: 600  NSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFL 659
            NSM+QCLFG    RDLF+    ++    K + T IS+ F+ L   MY NGG SV+P  FL
Sbjct: 250  NSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTMYENGGTSVIPKNFL 309

Query: 660  KACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTK-VANDYPNLLLHDDEKLLVDN 718
            +   +LRPD +IP                           ++N+Y    + DD  L    
Sbjct: 310  QQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNY----VSDDINL---G 362

Query: 719  KEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPK 778
            KEY  W    LK NG SPID IFQGQ+EN L+CQRCG TSYNYS FY+LSLAIP +    
Sbjct: 363  KEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAK-- 420

Query: 779  TFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKK-KKKN 837
                SK  ++LEDCIN +T DE+LTGENAW+CPKC   +  +    +S  TV+ + K K+
Sbjct: 421  --ENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKS 478

Query: 838  FLSVNGDHXXXXXXXXXXXXXXXXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPN 897
               +N                         KS+     K   K++K+ T+K LNFI +P 
Sbjct: 479  INPLNFFKLHKVLSPSSGNHHRHHHHHHHHKSDGK--NKNKYKNEKLITLKQLNFIKLPP 536

Query: 898  ILVIHLSRFFYDLTKKNETMINYPLILDVVLKNN-EIARYRLYGIINHFGNLVSGHYTSL 956
            ILVIHLSRF+Y+ TKKN  +I YPLIL++++KNN ++ +Y+LYG+INH G L  GHYTS+
Sbjct: 537  ILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSI 596

Query: 957  VNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGIT------SISSGDVYVLFYERIH 1010
            VNK L+H +   +Q+WY FDDEV+KK  ++   ++  +         S  VYVLFYERI 
Sbjct: 597  VNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 74/144 (51%), Gaps = 6/144 (4%)

Query: 11  DELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLS-VEKYEDCLCEYVI 69
           D+L S V  ++  D+K YY                 L + ++   S   +       +V 
Sbjct: 28  DDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATLAFVN 87

Query: 70  GSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNMEIL 129
           GSFY+FLIIP  VQF  +NK ++ Y DLK  Y+ +++M N+L  V  K  S+L Q++  +
Sbjct: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSGI 147

Query: 130 AKQHLDPSRKRAFSVEEPIIRYQL 153
            ++ L   +KRA++  EP IR  L
Sbjct: 148 NRRIL---KKRAYT--EPSIRSGL 166

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
            weakly similar to uniprot|P36026 Saccharomyces cerevisiae
            YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  324 bits (831), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 178/453 (39%), Positives = 254/453 (56%), Gaps = 11/453 (2%)

Query: 561  VQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGK 620
            +   H    +++P I  +  E   LS+ G+RNMGNTCY+NSMLQCLFG +QFRDLFL  K
Sbjct: 186  IDIDHDSKQYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDK 245

Query: 621  YHRYLNPKRSNTI-ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXX 679
            +  +     S ++ I+   SLLF+KMY NGGC+++P  F++ C  LRPDF IP       
Sbjct: 246  FEMFKAETNSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQ 305

Query: 680  XXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDD 739
                          +  +    D   +    + + L  NK Y +W++E +  N LSPID 
Sbjct: 306  EFLMFVLERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDL 365

Query: 740  IFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQD 799
            +F+G +E+ L C+ C  ++  +S+FY+LSL IP       F    K IRLEDCINL+T+ 
Sbjct: 366  LFRGDVESKLICKHCNESASTFSSFYILSLNIPKEKSSLFFK--SKTIRLEDCINLFTRK 423

Query: 800  ELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXX 859
            E+LTGEN+W CP C T +  +   +++D+T  +K                          
Sbjct: 424  EILTGENSWACPSCETKARYN--VIDNDKTYQQKHTNIGKHSKFPRFFSHIEAGKTERNS 481

Query: 860  XXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMIN 919
                    K ++++ E+ H + KK  TI +++F+++P ILVIHLSRF YD++KKN + I+
Sbjct: 482  GANKFSQLKYDNLENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYDISKKNTSNIS 541

Query: 920  YPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEV 979
            YP+ L V   +N    YRLYG INH G+   GHYT+LVNK  +H      QKW  FDD++
Sbjct: 542  YPMSLTVETLDNSSVTYRLYGTINHIGSPRGGHYTALVNKEKNHFTDLELQKWVEFDDDL 601

Query: 980  VKKEFNHGDFDRG---ITSISSGDVYVLFYERI 1009
            V   FN  DF +    I SI++ D YVLFYERI
Sbjct: 602  V---FNRTDFFKSKTEINSITNNDAYVLFYERI 631

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 2/90 (2%)

Query: 13  LLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKY-EDCLCEYVIGS 71
           L S V +V+   +K  Y             QA    +   E+L  EK  E     Y  G 
Sbjct: 13  LKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAKYLDK-TETLGQEKLLESSYMNYAAGC 71

Query: 72  FYVFLIIPGSVQFSARNKSYSIYSDLKKLY 101
           FY++L++P + QF   +  Y  Y  LK  Y
Sbjct: 72  FYIYLLVPNANQFQLEDTEYGTYLQLKNNY 101

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score =  310 bits (795), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 153/266 (57%), Positives = 187/266 (70%), Gaps = 9/266 (3%)

Query: 555 QRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRD 614
           Q+  +   T  LH  +SIPTIE++PN +VSLSITGLRN+GNTCYINSM+QCLF    FR+
Sbjct: 658 QQEPFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRN 717

Query: 615 LFLGGKYHRYLN---PK----RSNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRP 667
           LF+  KY  +L    PK     S  +IS+ F +LF+KMYLNGGCSVVP  FLK+C +LRP
Sbjct: 718 LFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRP 777

Query: 668 DFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDE 727
           DF IP                     S    V N+YP+L+L+D++KL V NKEY KWFD+
Sbjct: 778 DFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDK 837

Query: 728 GLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKII 787
            +  NGLSPIDDIFQGQMENSL CQRCG +S+NYSTFYVLSLAIP      TFSRSK+ +
Sbjct: 838 SVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKA-TSSTFSRSKR-V 895

Query: 788 RLEDCINLYTQDELLTGENAWDCPKC 813
            LE+C+N+YT DE+L+GENAWDCP C
Sbjct: 896 SLEECLNMYTSDEVLSGENAWDCPNC 921

 Score =  194 bits (494), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 88/138 (63%), Positives = 108/138 (78%)

Query: 872  VKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNN 931
            +K E    KSKK+ TIKTLNFI MP  L+IHLSRF+YDLTKKN T++ YPLIL++VLK+N
Sbjct: 1024 MKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSN 1083

Query: 932  EIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDR 991
            E+ +Y+LYG++NH GNL+SGHYTS+V+K L H +      WYYFDDEVVK+E  HGD   
Sbjct: 1084 EVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKH 1143

Query: 992  GITSISSGDVYVLFYERI 1009
            G+  ISS DVYVLFYERI
Sbjct: 1144 GVMKISSSDVYVLFYERI 1161

 Score =  127 bits (320), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 105/178 (58%), Gaps = 12/178 (6%)

Query: 280 DRSRTHRKDSYHSVYLGDELE---------DLNNISTGLARHQQENTIDCFALFSLLKDA 330
           DRS THRK+SYHSVY+ +E E         + N     L R Q+++ I    LFS+L + 
Sbjct: 351 DRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNE 410

Query: 331 ESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILD 390
           +  + LLLIDLRL  R+ ++ ++APN ++IDP +L+++  G  +     L+  + NP+ +
Sbjct: 411 QQSKQLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFN 470

Query: 391 KISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTG---TAIPKSLLGGYEQWKAFL 445
           +  ++D +VY++D K+FM L F+Y    F LL    G     +P  LLGGYE+WK  +
Sbjct: 471 RRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVI 528

 Score = 98.6 bits (244), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 106/229 (46%), Gaps = 43/229 (18%)

Query: 5   YTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKYEDCL 64
           +TPE SDEL   V +VY+ D+                   E L+E Y   L  ++  D L
Sbjct: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73

Query: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124
             ++ G FYV+L++P S+QF  RN+++++YSD++ LY+ ++NM+NVLLMV  +V  VL  
Sbjct: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133

Query: 125 NMEILAKQHLDPSRKRAFSV-EEPIIRYQLHNLQLNN----------------------- 160
             +  +     P R RA+SV +E  +   L  L L +                       
Sbjct: 134 QWDSASLNERIP-RNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192

Query: 161 -----------ADQK-------SVDDDYKSFASTEWKAPQLDPNDRLHL 191
                      A+Q        S   D    +S  W+APQL+PND+L L
Sbjct: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKL 241

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  220 bits (560), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 150/469 (31%), Positives = 236/469 (50%), Gaps = 54/469 (11%)

Query: 1   MSRLYTPEYSDELLSFVQEVYSQDVKHYYAXXXXXXXXXXXXQAESLFESYRESLSVEKY 60
            S  +TPEYS EL   VQ++Y  D+K                    L E++   L   +Y
Sbjct: 7   FSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRY 66

Query: 61  EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120
           +D L  Y++G +Y++LIIP S QF  +NKSYS+Y+D K LYQ+E NM+NV  MV ++VDS
Sbjct: 67  DDALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDS 126

Query: 121 VLNQNMEILAKQHLDPSRKRAFSVEEPI------IRYQLHNLQLNNADQK-SVDDDYKSF 173
           +L+++ +          R RAFSV++        I + +   + +   +  S+   Y S 
Sbjct: 127 ILDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSL 186

Query: 174 ------ASTEWKAPQLDPNDRLHLXXXXXXXXXXXXXXXXXXXXXLYKEQDDTDALDSVS 227
                 ++  W AP L+PND+L L                        EQ +    + +S
Sbjct: 187 PMELDDSTPLWTAPSLNPNDQLKLAL----------------------EQPELTLDEQLS 224

Query: 228 DKLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMDSFDRSRTHRK 287
           DK      + +L+D       +P    +P       +  +     ++ +   DRS THRK
Sbjct: 225 DKT-----QHNLIDDKYNNFTIPLPHQIPLPVKVTDFNHDKK---IQKIYPVDRSETHRK 276

Query: 288 DSYHSVYLGDEL--------EDLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLI 339
           DSYHSVY+ ++         ++ NN    L R Q++N I C  LFS+L D  +++++LLI
Sbjct: 277 DSYHSVYMDNDNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLI 336

Query: 340 DLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIV 399
            L LP+R +SN++VA N +NIDP +L+D E    +     L+KI+ + + +    +  +V
Sbjct: 337 YLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVV 396

Query: 400 YYTDYKSFMHLTFNYELILFELLFKKTGTAI---PKSLLGGYEQWKAFL 445
           YYTD K++M + F+Y   LF LL     + +   P SLLGG E+WK  +
Sbjct: 397 YYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVI 445

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
            Ashbya gossypii AFR007W
          Length = 851

 Score =  107 bits (266), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 111/447 (24%), Positives = 168/447 (37%), Gaps = 107/447 (23%)

Query: 589  GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRKM 645
            GL N GN+CY++ ++QCL G  +   +FL   Y  ++N      S  +++++FS L  +M
Sbjct: 487  GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQM 546

Query: 646  YLNGG----------CSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSE 695
            Y  G            +V+P  F  AC  +   F                         +
Sbjct: 547  YQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFR----DRSQQDCQEFCQFLLDGLHED 602

Query: 696  PTKVANDYP-NLLLHDDEKL-------LVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMEN 747
              +  N+ P   L    EK+       +  + E++++          S I D+FQGQ  +
Sbjct: 603  LNQCGNNPPLKELSEKAEKMREMMPMRIASSIEWERYL-----TTDFSVIVDLFQGQYAS 657

Query: 748  SLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENA 807
             L+C+ CG TS  Y  F VLS+ +P+       SR   II   DC   +T+ E L  +  
Sbjct: 658  QLRCKVCGRTSTTYQPFSVLSVPVPS-------SRQCTII---DCFTEFTKVETLDLDEQ 707

Query: 808  WDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXXXPF 867
            W CP C     S+             KK     +                          
Sbjct: 708  WSCPDCKKRQPST-------------KKITITRL-------------------------- 728

Query: 868  KSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFF---YDLTKKNETMINYPLIL 924
                  P  L I  K+   +   N + +    V++L+ F+   YD    N   +  P   
Sbjct: 729  ------PRNLIIHLKRFDNMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVELPSRG 782

Query: 925  DVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEF 984
             V   N     Y+LYG+  H G L  GHYT+ VNK  +         W Y+DD   ++  
Sbjct: 783  QVPPFN-----YQLYGVACHTGTLYGGHYTAYVNKGAT-------LGWCYYDDTNWRQ-- 828

Query: 985  NHGDFDRGITSISSGDVYVLFYERIHS 1011
                  R      S + YVLFY RIH 
Sbjct: 829  -----IRSSNEYISQNAYVLFYHRIHG 850

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 104/241 (43%), Gaps = 31/241 (12%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRK 644
            GL NMGN+CYIN ++QCL G  +  ++FL   Y R++N      S  +++K+F+ L   
Sbjct: 463 VGLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHINMNSRLGSKGVLAKYFAKLTHS 522

Query: 645 MYLNG-------GCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPT 697
           MY N        G  V P  F  AC  +   F                         +  
Sbjct: 523 MYQNASHKLNEKGKPVQPMEFKMACGTINSLFR----ESGQQDCQEFCQFLLDGLHEDLN 578

Query: 698 KVANDYPNLLLHDD-----EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQ 752
           +   + P   L D+     EKL +      +W  E       S I D+FQGQ  + L+CQ
Sbjct: 579 QCGGNPPLKELSDEAEKMREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASQLRCQ 636

Query: 753 RCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPK 812
            CG TS  Y  F VLS+ +P        ++S  II   DC   +T+ E L  +  W CP+
Sbjct: 637 VCGLTSTTYQPFSVLSVPVP-------HAKSCNII---DCFKEFTKVEKLETDEQWSCPR 686

Query: 813 C 813
           C
Sbjct: 687 C 687

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 67/152 (44%), Gaps = 36/152 (23%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV--LKNNEIAR---- 935
            KK  + K L    +P  L+IHL RF  ++  KN   + YP  LD+     N+   R    
Sbjct: 689  KKQPSTKKLTITRLPRNLIIHLKRF-DNMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPG 747

Query: 936  ---------------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
                           Y+LYGI +H G+L  GHYTS V+K         ++ W YFDD   
Sbjct: 748  VTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDK-------GPKRGWCYFDDTSF 800

Query: 981  KKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
            +         R  T   + + YVLFY R++ +
Sbjct: 801  RPV-------RNATECITPNAYVLFYHRVYQV 825

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score = 95.1 bits (235), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 100/244 (40%), Gaps = 35/244 (14%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRKM 645
           GL NMGN+CY+N ++QCL    +   +FL   Y +++N      S  I++K F+ L   M
Sbjct: 736 GLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHININSKLGSKGILAKSFARLVHSM 795

Query: 646 YLNGGCS-----------VVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXS 694
           Y NG  S           V P  F  AC  +   F                         
Sbjct: 796 YQNGTLSIKNHSNKKNPPVQPITFKTACGSINSLF----KGSNQQDCQEFCQFLLDGLHE 851

Query: 695 EPTKVANDYPNLLLHDD-----EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSL 749
           +  +   + P   L  +     EKL +      +W  E       S I D++QGQ  + L
Sbjct: 852 DLNQCGANPPLKELSTEAERMREKLSLRIASSIEW--ERFLTTDFSVIIDLYQGQYASQL 909

Query: 750 KCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWD 809
           KCQ CG TS  Y TF VLS+ +P            K I L DC N +T+ E L  +  W 
Sbjct: 910 KCQVCGTTSTTYQTFSVLSVPVPK----------NKSIHLLDCFNEFTKTEFLGKDELWS 959

Query: 810 CPKC 813
           C +C
Sbjct: 960 CTEC 963

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 57/121 (47%), Gaps = 29/121 (23%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDV--------------- 926
            KK  + KTL    +P  L+IHL RF  ++  KN   + YPLILD+               
Sbjct: 965  KKQPSTKTLTITRLPKNLIIHLKRF-DNMLHKNNVFVKYPLILDLTNYWANDFDGKLPPG 1023

Query: 927  ----VLKNNEIA--RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
                +    +I   +Y L G+  H G+L  GHYT+ VNK L       +  WYYFDD V 
Sbjct: 1024 VTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNKGL-------KNGWYYFDDTVY 1076

Query: 981  K 981
            +
Sbjct: 1077 R 1077

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 106/243 (43%), Gaps = 30/243 (12%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFR 643
           + GL NMGN+CY+N ++QCL G ++   +FL   + +Y+N      S  +++++FS L  
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 644 KMYLN------GG--CSVVPNGFLKACHMLRPDFHIPTXXXXXXXXX-----XXXXXXXX 690
            MY N      GG    V P  F  AC  +   F   +                      
Sbjct: 679 TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFKGGSQQDCQEFCQFLLDGLHEDLNQC 738

Query: 691 XXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLK 750
                  ++  +  NL     EKL +      +W  E       S I D+FQGQ  + L+
Sbjct: 739 GGNKRLAELTEEAENL----REKLSLRIASSIEW--ERFLTTDFSVIGDLFQGQYASRLQ 792

Query: 751 CQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDC 810
           C+ CG TS  Y  F VLS+ +P+    K  S+   I    DC + +T+ E L  +  W C
Sbjct: 793 CKTCGKTSTTYQPFSVLSIPVPS----KHISKCSII----DCFDEFTKVENLEVDEQWSC 844

Query: 811 PKC 813
           P+C
Sbjct: 845 PRC 847

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 74/152 (48%), Gaps = 36/152 (23%)

Query: 880  KSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV------------ 927
            KSK+ +T K L    +P  L+IHL RF   L K N  ++ YP  LD+             
Sbjct: 848  KSKQPST-KKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWANDFDGKLP 905

Query: 928  LKNNEIA--------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEV 979
            L  +E+          Y+LYG+  HFG+L  GHYT+ V+K     I+ G   WYYFDD  
Sbjct: 906  LNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKG----IKNG---WYYFDDTS 958

Query: 980  VKKEFNHGDFDRGITSISSGDVYVLFYERIHS 1011
             +   N  +    ITS      YVLFY+RI+ 
Sbjct: 959  CRPIKNSME---PITS----SAYVLFYKRIYG 983

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 103/239 (43%), Gaps = 26/239 (10%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRK 644
            GL N+GN+CY+N ++QC+ G  +   +FL   Y +++N      S  I++K+F+ L   
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 645 MY-----LNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKV 699
           MY      +   S+ P  F  AC  +   F   +                     +  + 
Sbjct: 622 MYKEQVDASKKISISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLH----EDLNQC 677

Query: 700 ANDYPNLLLHDD-----EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRC 754
            ++ P   L  +     EKL +      +W  E       S I D+FQGQ  + LKC+ C
Sbjct: 678 GSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKIC 735

Query: 755 GFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
           G TS  Y  F VLS+ IP   P       +  I +EDC   +T+ E L  +  W CP C
Sbjct: 736 GHTSTTYQPFTVLSIPIPRKVP-------QNEITIEDCFKEFTKCENLEVDEQWLCPHC 787

 Score = 74.7 bits (182), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 75/157 (47%), Gaps = 38/157 (24%)

Query: 878  HIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV---------- 927
            H K ++ +T K L    +P  L+IHL RF  +L  KN   + YP +LD+           
Sbjct: 786  HCKKRQPST-KQLTVTRLPRNLIIHLKRF-DNLLNKNNDFVKYPFLLDLTPFWANDFDGV 843

Query: 928  ----LKNNEIA--------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYF 975
                + ++E+         +Y LYG+  HFG L  GHYT+ V K L    RKG   W YF
Sbjct: 844  FPPGVNDDELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL----RKG---WLYF 896

Query: 976  DDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
            DD   K   N  D       +++ + YVLFY R++ +
Sbjct: 897  DDTKFKPVKNKTD-------VTNSNAYVLFYHRVYGV 926

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 100/242 (41%), Gaps = 32/242 (13%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRK 644
            GL NMGN+CY+N ++QCL    +   +FL   Y +++N      S  +++K+F+ L   
Sbjct: 519 VGLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVHT 578

Query: 645 MYLNGGCS--------VVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEP 696
           MY  G           + P  F  AC  +   F   T                     + 
Sbjct: 579 MYREGSFKRPLEKNKPIQPIQFKMACGSINSLFKDNTQQDSQEFCQFLLDGLH----EDL 634

Query: 697 TKVANDYPNLLLHDD-----EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKC 751
            +   + P   L +D     EKL +      +W  E       S I D+FQGQ  + LKC
Sbjct: 635 NQCGANPPLKELSEDAEKMREKLSMRIASSIEW--ERFLTTDFSVIVDLFQGQYASQLKC 692

Query: 752 QRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCP 811
           + CG TS  Y TF VLS+ +P +              + DC N +T+ E L  +  W CP
Sbjct: 693 KVCGCTSTTYQTFSVLSVPVPHV----------SSCHILDCFNEFTKVEKLGTDELWSCP 742

Query: 812 KC 813
            C
Sbjct: 743 TC 744

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 69/152 (45%), Gaps = 36/152 (23%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVL------------- 928
            KK  + K L    +P  L+IHL RF  ++  KN   + YP +LD+               
Sbjct: 746  KKQPSTKKLTITRLPRNLIIHLKRF-DNMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPG 804

Query: 929  KNNEIA--------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
              +E+         RY+L  + +H G+L  GHYT+ VNK     I +G   W+YFDD   
Sbjct: 805  VTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKG----INRG---WHYFDDTSY 857

Query: 981  KKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
            +   N        T   + + YVLFY R++ +
Sbjct: 858  RPIKNE-------TECITPNAYVLFYHRVYGV 882

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 47/97 (48%), Gaps = 9/97 (9%)

Query: 335 NLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANP-----IL 389
           +LLLID+R    F+S H+ A +++ ++P    ++     +E     K ++ +P     + 
Sbjct: 185 SLLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNSFTDLEVEK----KSLITSPQKEIALF 240

Query: 390 DKISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKT 426
               +Y+ IV YT          + +L+L ++L  K+
Sbjct: 241 QARDKYNYIVIYTQQSEKTQFYMHQQLVLLDILMNKS 277

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 91.7 bits (226), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 100/240 (41%), Gaps = 30/240 (12%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRKM 645
           GL NMGN+CY+N ++QCL    +F  +FL   Y +++N K    S  ++++ F+ L   M
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTM 668

Query: 646 YLNGG--------CSVVPNGFLKAC----HMLRPDFHIPTXXXXXXXXXXXXXXXXXXXX 693
           Y  G           V P  F  AC     + R D    +                    
Sbjct: 669 YTEGSEQSKNDRNGPVKPAQFKLACGSINSIFRSDLQQDSQEFCQFLLDGLHEDLNQCGA 728

Query: 694 SEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQR 753
           + P K  +     +       +  + E++++          S I D FQGQ  + L+C+ 
Sbjct: 729 NPPLKELSPNAEKMREKLSLRIASSIEWERYL-----TTDFSVIVDQFQGQYASQLRCKV 783

Query: 754 CGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
           CG TS  Y  F VLS+ +P         +S  II   DC N +T+ E L  +  W CP C
Sbjct: 784 CGGTSTTYQAFSVLSVPVPR-------GKSCNII---DCFNEFTKVENLETDELWACPHC 833

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 72/156 (46%), Gaps = 38/156 (24%)

Query: 878  HIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV--LKNNEIAR 935
            H K K+ +T K L    +P  L+IHL RF  ++  KN   + YP +LD+     N+   R
Sbjct: 832  HCKKKQPST-KKLTITRLPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGR 889

Query: 936  -------------------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFD 976
                               Y+L  +  HFG+L  GHYTS V+K        G+  W YFD
Sbjct: 890  LPPGVTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFD 941

Query: 977  DEVVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
            D  ++   N  +    ITS    + YVLFY R++ +
Sbjct: 942  DTKIRPLKNSYE---CITS----NAYVLFYHRVYGV 970

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 9/100 (9%)

Query: 334 ENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANP-----I 388
           + LL+ID+R    FE +H+   N++ I+P      E  T LE  +  K ++ +P      
Sbjct: 198 DTLLVIDVRPRMEFEESHIKCKNIICIEPVSF--NESFTDLELQK--KSMITSPSDEVKT 253

Query: 389 LDKISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTGT 428
             K   ++ IV  TD         + +L+L +LL  K+ T
Sbjct: 254 FAKKDTFNYIVICTDTDEKKQFYLHQQLVLLDLLMNKSFT 293

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 115/274 (41%), Gaps = 30/274 (10%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRK 644
            GL N+GN+CY+N ++QC+ G  +   +FL   Y +++N      S  I++K+F+ L   
Sbjct: 565 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 624

Query: 645 MY-----LNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKV 699
           MY      +   S+ P  F  AC  +   F   +                     +  + 
Sbjct: 625 MYKEQVDSSKKISISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLH----EDLNQC 680

Query: 700 ANDYPNLLLHDD-----EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRC 754
            ++ P   L  +     EKL +      +W  E       S I D+FQGQ  + L+C+ C
Sbjct: 681 GSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLRCKVC 738

Query: 755 GFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCG 814
             TS  Y  F VLS+ IP          S+  I +EDC   +T+ E L  E  W CP C 
Sbjct: 739 NHTSTTYQPFTVLSIPIPK-------KNSQNKITIEDCFKEFTKCENLEVEEQWLCPHCK 791

Query: 815 THSNSSD----GSMNSDETVDKKKKKNFLSVNGD 844
               S+       +  +  V  K+  NFL+ N D
Sbjct: 792 QRQPSTKQLTVTRLPRNLIVHLKRFDNFLNKNND 825

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 76/157 (48%), Gaps = 38/157 (24%)

Query: 878  HIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV---------- 927
            H K ++ +T K L    +P  L++HL RF   L K N+  + YP +LD+           
Sbjct: 789  HCKQRQPST-KQLTVTRLPRNLIVHLKRFDNFLNKNND-FVRYPFLLDLTPFWANDFDGV 846

Query: 928  ----LKNNEIA--------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYF 975
                + ++E+         +Y LYG+  HFG L  GHYT+ V K L    +KG   W YF
Sbjct: 847  FPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL----KKG---WLYF 899

Query: 976  DDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
            DD   K   N  D      +I+S + YVLFY R++ +
Sbjct: 900  DDTKYKPVKNQTD------AINS-NAYVLFYHRVYGV 929

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 104/239 (43%), Gaps = 26/239 (10%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRK 644
            GL N+GN+CY+N ++QC+ G  +   +FL   Y +++N      S  I++K+F+ L   
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 645 MY---LNGG--CSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKV 699
           MY   ++G    S+ P  F  AC  +   F   +                     +  + 
Sbjct: 622 MYKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLH----EDLNQC 677

Query: 700 ANDYPNLLLHDD-----EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRC 754
            ++ P   L  +     EKL +      +W  E       S I D+FQGQ  + LKC+ C
Sbjct: 678 GSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKVC 735

Query: 755 GFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
             TS  Y  F VLS+ IP          S+  I +EDC   +T+ E L  +  W CP C
Sbjct: 736 SHTSTTYQPFTVLSIPIPK-------KNSRNNITIEDCFREFTKCENLEVDEQWLCPHC 787

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 74/153 (48%), Gaps = 37/153 (24%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV-------------- 927
            K+  + K L    +P  L++HL RF   L K N+ +I YP +LD+               
Sbjct: 789  KRQPSTKQLTITRLPRNLIVHLKRFDNLLNKNNDFVI-YPFLLDLTPFWANDFDGVFPPG 847

Query: 928  LKNNEIA--------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEV 979
            + ++E+         +Y LYG+  HFG L  GHYT+ V K L    +KG   W YFDD  
Sbjct: 848  VNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL----KKG---WLYFDDTK 900

Query: 980  VKKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
             K   N  D      +I+S + YVLFY R++ +
Sbjct: 901  YKPVKNKAD------AINS-NAYVLFYHRVYGV 926

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 103/246 (41%), Gaps = 29/246 (11%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFR 643
           I GL NMGN+CY+N ++QC+ G      +FL   Y +++N      S  +++K F+ L  
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIH 663

Query: 644 KMYLNGGCSVV------------PNGFLKAC----HMLRPDFHIPTXXXXXXXXXXXXXX 687
            MY++   S +            P  F  AC     + R      +              
Sbjct: 664 TMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFRDSQQQDSQEFCQFLLDGLHED 723

Query: 688 XXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMEN 747
                 + P K  +     L  +    +  + E++++          S I D+FQGQ  +
Sbjct: 724 LNQCGGNPPLKELSLEAERLRENLSLRIASSIEWERYL-----TTDFSVIVDLFQGQYAS 778

Query: 748 SLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENA 807
            L+C+ C  TS  Y +F VLS+     P PK F    + I L DC N +T+ E L  +  
Sbjct: 779 RLECKVCHHTSTTYQSFSVLSV-----PLPKKFDPQTRKIDLIDCFNEFTKIENLEVDEQ 833

Query: 808 WDCPKC 813
           W CP C
Sbjct: 834 WSCPTC 839

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 72/152 (47%), Gaps = 36/152 (23%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV-------------- 927
            KK  + K L    +P  L+IHL RF  ++  KN + I+YP  LD+               
Sbjct: 841  KKQPSTKKLTITRLPRNLIIHLKRF-DNMLNKNNSFIDYPFNLDLTEFWADDFDGNLPPG 899

Query: 928  LKNNEIAR-------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
            + N   AR       YRLYG+  HFG+L  GHYT+ V+K + +        WYYFDD   
Sbjct: 900  VSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGN-------GWYYFDDTTY 952

Query: 981  KKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
            +   N  +       ISS   YVLFY R++ +
Sbjct: 953  RPLKNDKE------PISSS-AYVLFYTRVYGV 977

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 103/243 (42%), Gaps = 35/243 (14%)

Query: 265 AQNDSSLMLENMDSFDRSRTHRKDSYHSVYLGDELEDLNNISTGLARHQQENTIDCFALF 324
           A++++   ++N      S    K+S ++ Y  D +++L+  S G       + I    L 
Sbjct: 140 AKDENIAQIKNFIKHHASNEELKNSDYNKYRNDIIKNLHLPSNG-------SFISTIQLN 192

Query: 325 SLLKDAESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIV 384
            L+++    ++LL+ID+R    F  +H+ + N++ I+P    D+     LE     K I+
Sbjct: 193 ELMRNFN--DSLLIIDIRSRSEFIKSHIKSKNIICIEPISFKDSYSDYELER----KSII 246

Query: 385 ANP-----ILDKISQYDNIVYYTDY-----KSFMHLTFNYELILFELLFKKTGTAIPKSL 434
            +P     + +    +  IV YT+      K+  H     +++L  +L K++        
Sbjct: 247 TSPNNEIRLFNNRQSFKFIVLYTEILDTKNKNNSHFYNERQILLLNILLKRSFEKPLNEC 306

Query: 435 LGGYEQWKAFLNKQLRDSEFDKSLFLFRKSKSAPS-------DKTASKPSVQTDNIIKSS 487
            G +     F N   +  E +       KS   PS       +   S+ S+Q  N+ K S
Sbjct: 307 TGIFVLNNGFSNWVAKGGELES---FEAKSNGLPSTDDSVYINGNTSRLSLQ--NLPKMS 361

Query: 488 PSI 490
           PSI
Sbjct: 362 PSI 364

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 102/247 (41%), Gaps = 40/247 (16%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRK 644
            GL N GN+CY++ ++QCL G  +   +FL   Y  ++N      S  +++++FS L  +
Sbjct: 488 VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQ 547

Query: 645 MYLNGG----------CSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXS 694
           MY  G            +V+P  F  AC  +   F   T                     
Sbjct: 548 MYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFKDNTQQDCQEFCQFLLDGLH----E 603

Query: 695 EPTKVANDYP-NLLLHDDEKL-------LVDNKEYDKWFDEGLKNNGLSPIDDIFQGQME 746
           +  +  N+ P   L  + EK+       L    E++++          S I D+FQGQ  
Sbjct: 604 DLNQCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYL-----TTDFSVIVDLFQGQYA 658

Query: 747 NSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGEN 806
           + L+C+ C  TS  Y  F VLS+ +P          S +   L DC   +T+ E L  E 
Sbjct: 659 SQLQCKVCQRTSTTYQPFSVLSVPVP----------STRTCTLTDCFTEFTKIETLEQEE 708

Query: 807 AWDCPKC 813
            W CP C
Sbjct: 709 QWSCPSC 715

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (45%), Gaps = 28/116 (24%)

Query: 882 KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV----------LKNN 931
           K+  + K +    +P  L+IHL RF  ++  KN   ++YP +LD+           + NN
Sbjct: 717 KRQPSTKKITITRLPRNLIIHLKRF-DNMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNN 775

Query: 932 EIA----------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDD 977
            +            Y+LYGI  H G L +GHYT+ VNK            W Y+DD
Sbjct: 776 NVELPSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNK-------GAVLGWCYYDD 824

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 135/554 (24%), Positives = 208/554 (37%), Gaps = 75/554 (13%)

Query: 312 HQQENTIDCFALFSLLKD--AESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTE 369
           HQ  N  D F L   L D  +  + NLLLID+R  K F++ H+ AP +L I P     T 
Sbjct: 159 HQVTNLSDSFILPEKLHDLLSSHKRNLLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTF 218

Query: 370 KGTSLESFEALKKIVANP-ILDKISQYDNIVYYTDYKSFMHLTFNYELILFELLF----K 424
               +E    L           K +Q+  IV YT   +     +   + LF +L     K
Sbjct: 219 TDLQIEQTSLLTSTFQERNYFKKRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASK 278

Query: 425 KTGTAIPKSLL---GGYEQW-------KAFLNKQLRDSEFDKSLFLFRKSKS-----APS 469
           +    I  S+    GG   W       K  L  +  + +++++LF   K  S     A S
Sbjct: 279 RNIDQICPSIFILKGGITSWVQHSYECKTNLTGKTAN-QYNQNLFKRSKDSSIYKHVALS 337

Query: 470 DKTASKPSVQTDNIIKSS-----PSILSKEHNDDTLI----SSTXXXXXXXXXXXXXXXX 520
           D + ++ S   + I+ +S     P+ +   H+  T+                        
Sbjct: 338 DNSLNEGSKTCNPIVPASVQTVIPNFIPPSHSKSTICLMKNEQPQALYNHQVIPNLIHRA 397

Query: 521 XXXTIVYNRPPVPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPN 580
              T   N   VP+   +P P +          P+ N        L  P   PT   +P 
Sbjct: 398 PLDTESNNTQNVPMGFKNPIPQM-------YEIPKYNPSVNSGPKL--PLLPPTA--NPQ 446

Query: 581 EFV-SLSI---TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTI 633
           + V  L +   TGL N+ N+CY+N ++QCL        L+L   +   +N +    S   
Sbjct: 447 QIVPKLDLDFTTGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQINVENKLGSKGF 506

Query: 634 ISKWFSLLFRKMYLNGGCS---------VVPNGFLKACHMLRPDFHIPTXXXXXXXXX-- 682
           +SK F+ L + MY               V P  F  AC M+   +   T           
Sbjct: 507 LSKNFANLIQTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMNSIYAESTEQDCQEFCEFL 566

Query: 683 ---XXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDD 739
                           P +++ +   L     E L +      +W  E       SPI +
Sbjct: 567 LDGLHEDLNQCSGNPRPKELSANEAEL----RESLSMRIASEIEW--ESFLTTNFSPIIN 620

Query: 740 IFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQD 799
           +FQGQ  + L+C  C  TS  Y  F +LS+ +P+M     FS   +   + DC   +T+ 
Sbjct: 621 LFQGQYASRLQCLICQHTSTTYQPFSLLSIPVPSM----VFSNG-QTCNILDCFKEFTKC 675

Query: 800 ELLTGENAWDCPKC 813
           E L  +  W CPKC
Sbjct: 676 ERLDNDEKWFCPKC 689

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 64/150 (42%), Gaps = 36/150 (24%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV-LKNNEIA------ 934
            +K  + K L    +P  L+IH  RF  +   KN   + YP  LD+  L  N+        
Sbjct: 691  RKQISTKQLKITRLPKNLIIHFKRF-DNFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPN 749

Query: 935  --------------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
                          +Y+L  +  H GNL SGHYT+ V+K L        + W+ FDD   
Sbjct: 750  FNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGL-------YRGWFRFDDASY 802

Query: 981  KKEFNHGDFDRGITSISSGDVYVLFYERIH 1010
            +         +  T   + D Y+LFY+RI+
Sbjct: 803  RPV-------KFGTEFLTPDAYLLFYQRIY 825

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 105/239 (43%), Gaps = 26/239 (10%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRK 644
            GL N+GN+CY+N ++QC+ G  +   +FL   Y +++N      S  I++K+F+ L   
Sbjct: 563 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 622

Query: 645 MY-----LNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKV 699
           MY      +   S+ P  F  AC  +   F   +                     +  + 
Sbjct: 623 MYKKQVDSSKKDSISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLH----EDLNQC 678

Query: 700 ANDYPNLLLHDD-----EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRC 754
            ++ P   L  +     E+L +      +W  E       S I D+FQGQ  + LKC+ C
Sbjct: 679 GSNPPLKELSQEAETRRERLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKTC 736

Query: 755 GFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
             TS  Y  F VLS+     P PK  S++K  I +EDC   +T+ E L  +  W CP C
Sbjct: 737 NHTSTTYQPFTVLSI-----PIPKKNSQNK--ITIEDCFKEFTKCENLEIDEQWLCPHC 788

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 72/153 (47%), Gaps = 37/153 (24%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV-------------- 927
            K+  + K L    +P  L+IHL RF  +L  KN   + YP +LD+               
Sbjct: 790  KRQPSTKQLTITRLPRNLIIHLKRF-DNLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPG 848

Query: 928  LKNNEIA--------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEV 979
            + ++E+         +Y LYG+  HFG L  GHYTS V K LS       + W YFDD  
Sbjct: 849  VNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKKGLS-------RGWLYFDDTK 901

Query: 980  VKKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
             +   N  D      +I+S + YVLFY R++ +
Sbjct: 902  YRPAKNQTD------AINS-NAYVLFYHRVYGV 927

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 100/239 (41%), Gaps = 28/239 (11%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRKM 645
           GL NMGN+CY+N +LQC+ G ++   +FL   Y +++N      S  +++++F+ L   M
Sbjct: 584 GLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININSKLGSKGVLARYFARLAHIM 643

Query: 646 YLNG------GCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKV 699
           +            V P  F  A   +   F                         +  + 
Sbjct: 644 HQTSYDQEKKAAIVRPTQFRMAIASINSMFR----NTNQQDCQEFCQFLLDGLHEDLNQC 699

Query: 700 ANDYPNLLLHDD-----EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRC 754
            N+ P   L ++     E L +      +W  E       S I D+FQGQ  + LKC  C
Sbjct: 700 GNNPPLKELSEEAEKKRELLSLRIASSIEW--ERFLTTNFSVIIDLFQGQYASRLKCSVC 757

Query: 755 GFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
             TS  Y  F VLS+ +P        + +K  + L DC N +T+ E L  +  W+CP C
Sbjct: 758 SNTSTTYQPFSVLSVPLP--------TGTKSSVNLMDCFNEFTKCEKLEHDEYWNCPTC 808

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 75/156 (48%), Gaps = 43/156 (27%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVL-----KNNEIA-- 934
            KK  + K L    +P  L+IHL RF   + K N  +I+YP  LD+       K++ +   
Sbjct: 810  KKQPSTKQLTITRLPRNLIIHLKRFDNRMNK-NTKLIDYPFNLDLTSFWANDKDDRLPPG 868

Query: 935  ---------------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDE- 978
                           +Y LY + NHFG+L  GHYTS VNK LS       + WYYFDD+ 
Sbjct: 869  VSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLS-------RGWYYFDDQN 921

Query: 979  --VVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
              +VKK           + + + + YVLFY R+H I
Sbjct: 922  YRLVKK----------TSEVVNSNAYVLFYRRVHGI 947

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 102/244 (41%), Gaps = 34/244 (13%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN---PKRSNTIISKWFSLLFR 643
           I GL N+GN CY+N +LQCL G      +FL   Y  ++N    + S  +++K F++L  
Sbjct: 445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVN 504

Query: 644 KMYLNGGCSVVPN---------GFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXS 694
            M+ +G  +  PN          F K C  + P +                         
Sbjct: 505 NMHRHGAFTP-PNVRTIPVQTIQFKKICGHINPMYSDSMQQDCQEFCQFLLDGLHEDLNQ 563

Query: 695 EPTK-----VANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSL 749
             +K     ++++   +     EK+ +      +W  E       S I D+FQGQ  + L
Sbjct: 564 NGSKKHLKQLSDEEERM----REKMSIRKASALEW--ERFLLTDFSAIIDLFQGQYASRL 617

Query: 750 KCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWD 809
           +CQ C  TS  Y TF VLS+ +P +          K   + DC   +T+ E L  +  W 
Sbjct: 618 QCQVCEHTSTTYQTFSVLSVPVPRV----------KTCNILDCFREFTKCERLGVDEQWS 667

Query: 810 CPKC 813
           CPKC
Sbjct: 668 CPKC 671

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 67/147 (45%), Gaps = 34/147 (23%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDV-----------VLKN 930
            KK  + K L    +P  L+I+L RF   + K N   + YP  LD+            + N
Sbjct: 673  KKQPSTKQLKITRLPKKLIINLKRFDNQMNKNN-VFVQYPYSLDLTPYWARDFNHEAIVN 731

Query: 931  NEIA--------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
             +I         RYRLYG+  H G+L  GHYTS V K      +KG   WY+FDD + + 
Sbjct: 732  EDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKG----PKKG---WYFFDDSLYRP 784

Query: 983  EFNHGDFDRGITSISSGDVYVLFYERI 1009
                 +F        +   YVLFYERI
Sbjct: 785  ITFSTEF-------ITPSAYVLFYERI 804

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 102/248 (41%), Gaps = 43/248 (17%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRKM 645
           GL N+GN+CY+N ++QCL GC +   +FL   Y +++N      S  +++ +FS L +KM
Sbjct: 433 GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFSQLVQKM 492

Query: 646 YLNG-----------GCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXS 694
           Y  G             +V P  F  AC  +   F                         
Sbjct: 493 YQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLF-----KGKQQQDCQEFCQFLLDGLH 547

Query: 695 EPTKVANDYPNL--LLHDDEKL-------LVDNKEYDKWFDEGLKNNGLSPIDDIFQGQM 745
           E        P L  L  + EK+       +    E++++          S I D+FQGQ 
Sbjct: 548 EDLNQCGTNPPLKELSPEAEKMRETMPMRIASAIEWERYL-----TTDFSVIVDLFQGQY 602

Query: 746 ENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGE 805
            + L+C+ C  TS  Y  F VLS+ +P        +RS  I    DC   +T+ E L  +
Sbjct: 603 ASQLRCKICAHTSTTYQAFSVLSVPVPR-------ARSCTIY---DCFKEFTKLETLEKD 652

Query: 806 NAWDCPKC 813
             W CP C
Sbjct: 653 ELWYCPYC 660

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 70/150 (46%), Gaps = 37/150 (24%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDV-----------VLKN 930
            ++  + K +    +PN L+IHL RF  ++  KN   +NYP  LD+           + K+
Sbjct: 662  QRQPSTKQIIITRLPNNLIIHLKRF-DNMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKD 720

Query: 931  NEIA----------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
            N ++           YRL+ + +H G L  GHYTS V+        KG+  W  FDD   
Sbjct: 721  NGVSLPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVD--------KGRVGWCSFDDVSW 772

Query: 981  KKEFNHGDFDRGITSISSGDVYVLFYERIH 1010
            +K     ++   IT     + YVLFY R++
Sbjct: 773  RKIRRKDEY---ITP----NAYVLFYRRVN 795

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 100/253 (39%), Gaps = 48/253 (18%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRKM 645
           GL N+GN+CY+N ++QCL G  +   +FL   Y  ++N      S  +++K+FS L   M
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKGVLAKYFSQLVHNM 583

Query: 646 YLNGGC----------------SVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXX 689
           Y                     +V P  F  AC  +   F                    
Sbjct: 584 YRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFR-----DCSQQDCQEFCQFL 638

Query: 690 XXXXSEPTKVANDYPNL--LLHDDEKL-------LVDNKEYDKWFDEGLKNNGLSPIDDI 740
                E        P L  L  + EK+       +  + E++++          S I D+
Sbjct: 639 LDGLHEDLNQCGGNPRLKELSEEAEKIREKLSMRIASSIEWERYL-----TTDFSVIVDL 693

Query: 741 FQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDE 800
           FQGQ  + LKCQ CG TS  Y  F VLS+ +P++          K   + DC   +T+ E
Sbjct: 694 FQGQYASQLKCQVCGRTSTTYQPFSVLSVPLPSL----------KSCNILDCFQEFTKVE 743

Query: 801 LLTGENAWDCPKC 813
            L  +  W CP C
Sbjct: 744 TLEKDEQWSCPDC 756

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 65/150 (43%), Gaps = 35/150 (23%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV--LKNNEIAR---- 935
            K+  + K +    +P  L+IHL RF  ++  KN   ++YP  LD+     N+   R    
Sbjct: 758  KRQPSTKKITITRLPRNLIIHLKRF-DNMMNKNNVFVSYPHTLDLTPFWANDFDGRLPPG 816

Query: 936  --------------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVK 981
                          Y+LY + +H G L  GHYT+ V+K         Q+ W YFDD   +
Sbjct: 817  VTELPTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHK-------GSQRGWCYFDDTNWR 869

Query: 982  KEFNHGDFDRGITSISSGDVYVLFYERIHS 1011
            +        R      + + YVLFY R++ 
Sbjct: 870  RS-------RSDNECITSNAYVLFYHRVYG 892

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 104/244 (42%), Gaps = 20/244 (8%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFR 643
           I GL+N+GN+CY+N ++QCL G  +   +FL   Y R++N      S  +++K+F+ L  
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLIH 617

Query: 644 KMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXX--XXXXXXXXSEPTKVAN 701
            M+ N     + N +++          + T                       +  +  +
Sbjct: 618 LMH-NHANPKLKNNYVRPAQFKMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHEDLNQCGS 676

Query: 702 DYP-----NLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGF 756
           + P     +    + EKL +      +W  E       S I D+FQGQ  + L+C+ C  
Sbjct: 677 NPPLKELSSAAEKNREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLQCEVCKH 734

Query: 757 TSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTH 816
           TS  Y  F VLS+ IP +P           + + DC   +T+ ELL  +  W CP C   
Sbjct: 735 TSTTYQPFSVLSVPIPRVPKGVK-------VNILDCFKDFTKLELLDTDEQWLCPTCKKK 787

Query: 817 SNSS 820
             S+
Sbjct: 788 QRST 791

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 71/152 (46%), Gaps = 36/152 (23%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVL------------- 928
            KK  + K L    +P  L+IHL RF  +   KN   I+YP ILD+               
Sbjct: 786  KKQRSTKKLTITRLPRNLIIHLKRF-DNNLNKNNNFIDYPFILDLTQFWVDDFDGKLPPG 844

Query: 929  ------KNNEIA--RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
                  K  +I   +Y+LYG+ +HFG+L  GHYT+ V+K   H        WYYFDD   
Sbjct: 845  VRDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKH-------GWYYFDDTNY 897

Query: 981  KKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
            +   N  +    ITS      Y+LFY RI+ +
Sbjct: 898  RSIKNKNE---PITS----SAYLLFYHRIYDL 922

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 98/240 (40%), Gaps = 29/240 (12%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRK 644
            GL NMGN+CYIN ++QCL G  +  ++FL   Y R++N      S  +++K F+ L  +
Sbjct: 515 VGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQ 574

Query: 645 MYLNGGC-------SVVPNGFLKAC----HMLRPDFHIPTXXXXXXXXXXXXXXXXXXXX 693
           M+ +          +V P  F  AC     + R      +                    
Sbjct: 575 MHQSAAFKKSDKNKAVRPYEFKMACGSINSLFRESGQQDSQEFCQFLLDGLHEDLNQCGG 634

Query: 694 SEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQR 753
           + P K  ++    +       +  + E++++          S I D+FQGQ  + L+C+ 
Sbjct: 635 NPPLKELSEEAEKMRERLSMRIASSIEWERYLTR-----DFSVIVDLFQGQYASQLRCKV 689

Query: 754 CGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
           C  TS  Y  F +L+  +P            K   L DC   +T+ E L  +  W CP C
Sbjct: 690 CNHTSTTYQPFSILAAPVP----------HAKSCYLLDCFKEFTKLEQLEKDEEWLCPYC 739

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 73/152 (48%), Gaps = 36/152 (23%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDV--------------- 926
            KK  + K L    +P  L+IHL RF  +L  KN  ++NYP  LD+               
Sbjct: 741  KKQPSTKKLTITRLPRNLIIHLKRF-DNLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPG 799

Query: 927  ----VLKNNEIA--RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
                +    ++A  +Y+LY + +H G+L  GHYT+ V+K L+    KG   WYYFDD   
Sbjct: 800  VTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLN----KG---WYYFDDTGY 852

Query: 981  KKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
            +         R  T   + + YVLFY R++ +
Sbjct: 853  RPM-------RTPTECITSNAYVLFYHRVYGV 877

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 12/100 (12%)

Query: 335 NLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANP-----IL 389
           N+LL+D+R    FE  H+ A N++ I+P     +     LE     K ++ +P     I 
Sbjct: 169 NILLVDVRQRSEFEETHIKASNVICIEPISFKSSYTDLELEK----KSMITSPNVEIDIF 224

Query: 390 DKISQYDNIVYYTDY-KSFMHLTF--NYELILFELLFKKT 426
            + +++  ++ YTD  K   H  F    E++L +LL  ++
Sbjct: 225 KRRNEFTFVILYTDGNKENGHHNFYIQQEMVLLDLLINRS 264

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
            YER144C (REAL)
          Length = 805

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/302 (28%), Positives = 121/302 (40%), Gaps = 83/302 (27%)

Query: 712  EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAI 771
            EK+ +      +W  E       S I D+FQGQ  + L+CQ C  TS  Y TF VLS+ +
Sbjct: 582  EKMTIRKASALEW--ERFLLTDFSAIIDLFQGQYASRLQCQACDRTSTTYQTFSVLSVPV 639

Query: 772  PAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVD 831
            P +              + DC   +T+ E L  +  W CP+C     S+           
Sbjct: 640  PRI----------TTCNILDCFREFTKCEKLGIDELWSCPRCLKKQPST----------- 678

Query: 832  KKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLN 891
            K+ K   L                                  P+KL I  K+       N
Sbjct: 679  KQLKITRL----------------------------------PKKLIINLKRFD-----N 699

Query: 892  FITMPNILVIHLSRFFYDLTKKNETMINYPLILDV-VLKNNEIARYR--LYGIINHFGNL 948
             +   N+ V +   +F DLT       N+  I++  +    +I  +R  LYG+  H G+L
Sbjct: 700  QMNKNNVFVQY--PYFLDLTPYWARDFNHEAIVNEDIPTRGQIPPFRYRLYGVACHSGSL 757

Query: 949  VSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK-EFNHGDFDRGITSISSGDVYVLFYE 1007
              GHYTS V K      +KG   WY+FDD + +   FN    D  IT     + YVLFYE
Sbjct: 758  YGGHYTSYVYKG----PKKG---WYFFDDSIYRPIRFN----DEFITP----NAYVLFYE 802

Query: 1008 RI 1009
            RI
Sbjct: 803  RI 804

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN---PKRSNTIISKWFSLLFR 643
           I GL N GN CY+N +LQCL G      +FL   Y  ++N    K S  +++K F+ L R
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGSKGLLAKNFATLVR 504

Query: 644 KMYLNGG 650
            M+ N  
Sbjct: 505 NMHRNSA 511

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 106/267 (39%), Gaps = 61/267 (22%)

Query: 578 SPNEFVSLSIT-GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTI 633
           S N+ +  S T GL NMGN+CYIN ++QC+F  ++   +FL G Y +++N +    S  +
Sbjct: 514 SCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHINKQSKLGSKGV 573

Query: 634 ISKWFSLLF-------------------RKMYLNGGCSVVPNGF--------LKACHMLR 666
           +S  F+ L                    + +     C+ V + F        L+ C  L 
Sbjct: 574 LSHNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDASQQDCLEFCQFLL 633

Query: 667 PDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFD 726
              H                       + P K  +     +  +    +  + E++++  
Sbjct: 634 DGLH---------------EDLNQCGANPPLKELSPEAEKMRENLSLRVASSIEWERYL- 677

Query: 727 EGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKI 786
                   S I D+FQGQ  + L+C+ C  TS  Y  F VLS+ +P          S K 
Sbjct: 678 ----TTDFSIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPVP----------SGKS 723

Query: 787 IRLEDCINLYTQDELLTGENAWDCPKC 813
             L DC   +T+ E L  +  W CP C
Sbjct: 724 CGLLDCFIEFTKTENLEVDEQWFCPSC 750

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 67/152 (44%), Gaps = 38/152 (25%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV-------------- 927
            KK  + K L    +P  L+IHL RF  ++  KN   + YP ILD+               
Sbjct: 752  KKQPSTKKLTITRLPRNLIIHLKRF-DNMMNKNNIFVRYPQILDLTPFWANDSDGKLPPG 810

Query: 928  LKNNEIAR-------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQK-WYYFDDEV 979
            + +   AR       YRLYG   HFG L  GHYTS V+        KG +K W YFDD V
Sbjct: 811  ITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVD--------KGPEKGWIYFDDTV 862

Query: 980  VKKEFNHGDFDRGITSISSGDVYVLFYERIHS 1011
             +      +F        S   YVLFY RI S
Sbjct: 863  YRPVRFQNEF-------ISPSAYVLFYHRITS 887

 Score = 38.9 bits (89), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 57/114 (50%), Gaps = 11/114 (9%)

Query: 318 IDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESF 377
           I C  L SL+K  E  ++LLLID+R    ++++H+   N++ I+P    ++     +E  
Sbjct: 190 ISCSELLSLMKMKE--DSLLLIDVRPKLEYDAHHIKTKNIICIEPISFKESYSDQQIEK- 246

Query: 378 EALKKIVANP-----ILDKISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKT 426
                ++ +P     +  + S++  I+ YTD +   +  F     L E+L +++
Sbjct: 247 ---TSMIPSPKHEIQLFQRRSEFQYIILYTDLEEKSNFYFQQLKSLLEILLQRS 297

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 96/245 (39%), Gaps = 37/245 (15%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKY--HRYLNPK-RSNTIISKWFSLLFRKM 645
           GL N+GN+CY+N ++QCL G  +   +FL   Y  H  LN K  S  +++K+FS L   M
Sbjct: 496 GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHTM 555

Query: 646 YLNGG-----------CSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXS 694
                            +V P  F  AC  +   F                         
Sbjct: 556 QQQAASASTKQNSGDKTAVQPLHFKVACGSINSLFR-----SSSQQDCQEFCQFLLDGLH 610

Query: 695 EPTKVANDYPNLL-LHDD-----EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENS 748
           E        P L  L ++     EKL +      +W  E       S I D+FQGQ  + 
Sbjct: 611 EDLNQCGGNPALKELSEEAEGIREKLCMRIASSIEW--ERYLTTDFSVIVDLFQGQYASQ 668

Query: 749 LKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAW 808
           L C+ CG TS  Y  F VLS+ +P          S     + DC   +T+ E L  +  W
Sbjct: 669 LTCKVCGRTSTTYQPFSVLSVPVP----------SGSKCDIIDCFKEFTKVETLEKDEQW 718

Query: 809 DCPKC 813
            CP+C
Sbjct: 719 SCPRC 723

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 67/150 (44%), Gaps = 35/150 (23%)

Query: 883  KMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV--LKNNEIAR----- 935
            K  + K +    +P  LVIHL RF  +L  KN   ++YP  LD+     N+   R     
Sbjct: 726  KQPSTKKITITRLPRNLVIHLKRF-DNLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGV 784

Query: 936  -------------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
                         Y LY +  HFG L  GHYTS V+K         +  W YFDD   +K
Sbjct: 785  AELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDK-------GDKAGWCYFDDTSWRK 837

Query: 983  EFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
              + G+      ++S+   YVLFY R +++
Sbjct: 838  AKSQGE----CITLSA---YVLFYHRKYNV 860

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 334 ENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANP-----I 388
           +N LLIDLR   +F  +H+    ++ I+P    D+   T +      + ++ +P     +
Sbjct: 176 QNALLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEI----TRRSLITSPNEEVQL 231

Query: 389 LDKISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKT-----GTAIPKSLLGGYEQW 441
             +  ++D IV YTD           +  L +LL  ++        I  +L GG+E W
Sbjct: 232 FQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQRTIILTLQGGFENW 289

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
            YER144C (REAL)
          Length = 788

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 108/283 (38%), Gaps = 87/283 (30%)

Query: 734  LSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCI 793
             S + D+FQGQ  + L+CQ C  TS  Y TF VLS+ +P +              + DC 
Sbjct: 585  FSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRI----------MTCNVLDCF 634

Query: 794  NLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXX 853
              +T+ E L     W C +C     S+           K+ K   L              
Sbjct: 635  REFTKCEKLGIGEQWSCSRCLKKQPST-----------KQLKITRL-------------- 669

Query: 854  XXXXXXXXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLN--FITMPNILVIHLSRFFYDLT 911
                                P+KL I  K+       N  F+  P  L         DLT
Sbjct: 670  --------------------PKKLIINLKRFDNQMHKNNVFVQYPCFL---------DLT 700

Query: 912  KKNETMINYPLILDV-VLKNNEIARYR--LYGIINHFGNLVSGHYTSLVNKHLSHEIRKG 968
                   N+  I+D  +    +I  +R  LYG+  H G+L  GHYTS V         KG
Sbjct: 701  PYWARDFNHEAIIDEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYV--------YKG 752

Query: 969  QQK-WYYFDDEVVK-KEFNHGDFDRGITSISSGDVYVLFYERI 1009
             QK WY+FDD + +   FN+           + + YVLFYERI
Sbjct: 753  PQKGWYFFDDTIYRLIRFNN--------EFITPNAYVLFYERI 787

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 88/354 (24%), Positives = 139/354 (39%), Gaps = 59/354 (16%)

Query: 334 ENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILD--- 390
           +  LL+D+R    F   H+   +++ IDP    D+   T +E       + A+P L+   
Sbjct: 163 DAFLLVDVRPRPEFIKAHIKCKHIMCIDPASFKDSYTDTLVERVS----LAASPQLEIEL 218

Query: 391 --KISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTGTAIPKSLLGGYEQW----KAF 444
             K + + NIV YTD +           IL  +L + +   +   L  G+  W     AF
Sbjct: 219 FSKRNTFKNIVLYTDTQLQGDFQQRQTRILANILTRHSVAKV-SILENGFSNWVKLGGAF 277

Query: 445 LNKQLRDSEFD-------KSLFLFRKSKSAP---------SDKTASKP---SVQTDNIIK 485
              Q + +           S  LF ++  +P         S K  S+P   ++QT  +  
Sbjct: 278 STGQPQLASLSSSVSSPRTSAGLFSQNSRSPPKGKSPTLVSMKAQSQPLQATLQTPQVPL 337

Query: 486 SSPSILSKEH-NDDTLISSTXXXXXXXXXXXXXXXXXXXTIVYNRPPVPLPINS-----P 539
             P + +  H N D    S+                   T V+ +      +NS     P
Sbjct: 338 YYPEVPTLSHFNKD----SSALHTLSPHPLIAVPKEKPSTFVHGK------VNSIEALSP 387

Query: 540 APLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYI 599
            P L  +     R P      +  Q+L V  S P I+ S   F    I GL NMGN CY+
Sbjct: 388 GPQLPQANVIPPRIP-----PLPQQNLLV--SKPPIQNSTQMFDLDFIVGLENMGNCCYM 440

Query: 600 NSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRKMYLNGG 650
           N +LQCL G      +FL   Y  ++   N + S  +++K F+ L   M+ +G 
Sbjct: 441 NCILQCLVGTHDLTRMFLDNTYLNFINFDNMRGSKGLLAKNFANLVHTMHRHGA 494

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
            YER144C (REAL)
          Length = 823

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 69/149 (46%), Gaps = 38/149 (25%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV-----------LKN 930
            KK  + K L    +P  L+I+L RF   + K N   + YP  LD+            + N
Sbjct: 691  KKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWARDFNHESIVN 749

Query: 931  NEIA--------RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQK-WYYFDDEV-V 980
             +I         RYRLYG+  H G+L  GHYTS V         KG QK WY+FDD V  
Sbjct: 750  EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYV--------YKGPQKGWYFFDDSVYC 801

Query: 981  KKEFNHGDFDRGITSISSGDVYVLFYERI 1009
               FN    D  IT     + YVLFYERI
Sbjct: 802  PIRFN----DEFITP----NAYVLFYERI 822

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 734 LSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCI 793
            S I D+FQGQ  + L+CQ C  TS  Y TF VLS+ +P +          +   + DC 
Sbjct: 620 FSAIIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRI----------RTCNILDCF 669

Query: 794 NLYTQDELLTGENAWDCPKC 813
             +T+ E L  +  W C KC
Sbjct: 670 REFTKCEKLGVDEQWSCSKC 689

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFR 643
           I GL NMGN CY+N +LQCL G      +FL   Y  ++   N + S  +++K ++ L  
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGSKGLLAKNYATLVH 522

Query: 644 KMYLNGG 650
            M+ +G 
Sbjct: 523 NMHRHGA 529

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 75/154 (48%), Gaps = 37/154 (24%)

Query: 880  KSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVL----------- 928
            KSK+ +T K L    +P  L+IHL RF  +   KN  +I+YP ILD+             
Sbjct: 979  KSKQPST-KKLTITRLPRNLIIHLKRF-DNNLNKNNNLIDYPFILDLTQFWADDFDGELP 1036

Query: 929  --------KNNEIA--RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDE 978
                    K  +I   +YRLYG   HFG+L  GHYT+ VNK     IR G   WYYFDD 
Sbjct: 1037 PGVTDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNK----GIRNG---WYYFDDT 1089

Query: 979  VVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI 1012
                  N+         ISS + YVLFY RI+ +
Sbjct: 1090 ------NYRPIKNEREPISS-NAYVLFYHRIYGV 1116

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 43/87 (49%), Gaps = 10/87 (11%)

Query: 734 LSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCI 793
            S I D+FQGQ  + L+C+ C  TS  Y  F VLS+ IP           KK + L DC 
Sbjct: 909 FSVIVDLFQGQYASRLQCKTCIHTSTTYQPFSVLSVPIPK----------KKNLNLLDCF 958

Query: 794 NLYTQDELLTGENAWDCPKCGTHSNSS 820
             +T+ E L  +  W CP C +   S+
Sbjct: 959 KDFTKIENLEVDEQWFCPNCKSKQPST 985

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFR 643
           I GL+NMGN+CY+N ++QCL G  +   +FL   + RY+N      S  +++K  S L  
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 644 KMY 646
            MY
Sbjct: 806 LMY 808

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 97/241 (40%), Gaps = 25/241 (10%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFR 643
           I GL NM N+CY+N ++QCL    +   + L   + +++N +    S  +I K F+ L +
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 644 KMY---LNGGCS-----VVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSE 695
            M+   +  G S     V    F  AC  +   +                         +
Sbjct: 488 DMHSQQVKTGRSLFSYPVKTIDFKNACASVSSIY----SGSQQQDCQEFCEFLLDGLHED 543

Query: 696 PTKVANDYPNLLLHDDEKLLVDN---KEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQ 752
             +   + P   L D E+ L +    +       E   +N  S I D+F GQ  + L+C 
Sbjct: 544 LNQCGGNPPARELTDQEERLREGLCMRVASSMAWENFLHNNFSLIIDLFAGQYGSQLRCC 603

Query: 753 RCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPK 812
            C +TS  Y  F +LS+ +P        SR   I    DC   +T+ E L  +  W CP+
Sbjct: 604 VCQYTSTTYQPFTLLSVPVPL---SSRVSRCSII----DCFQEFTKCERLDKDEEWFCPQ 656

Query: 813 C 813
           C
Sbjct: 657 C 657

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 65/155 (41%), Gaps = 43/155 (27%)

Query: 882  KKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDV--------------- 926
            +K  + K L    +P  L+IH  RF  ++  KN   I YP  LD+               
Sbjct: 659  RKQPSTKQLKITRLPKNLIIHFKRF-DNMMNKNNIFIQYPYELDLTPFWVNDFNGELPLG 717

Query: 927  -----VLKNNEIA--RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDD-- 977
                 + K  ++   +Y+L  +  H G L SGHYT+ VNK            WYYFDD  
Sbjct: 718  MTNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNK-------GPDVGWYYFDDSS 770

Query: 978  -EVVKKEFNHGDFDRGITSISSGDVYVLFYERIHS 1011
              +VK            T   + D Y+LFY R+++
Sbjct: 771  HRIVKIA----------TEYMNPDAYLLFYHRVYN 795

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 103/252 (40%), Gaps = 30/252 (11%)

Query: 579 PNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPK----RSNTII 634
           PN      I G++N GN CY+N ++QCL    +F + FL   Y   +N          ++
Sbjct: 335 PNYTSPTVIKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVNSRLGHQGLVV 394

Query: 635 SKWFSLL---FRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXX 691
             W  ++   F+    N   +V    F +    L P++                      
Sbjct: 395 KNWAKIIQAFFQVSQENIQPAVSITEFREQWANLFPEYG--KYQQHDCSEFCLRLLEEIH 452

Query: 692 XXSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKC 751
             S   +  N         D  + VD  +Y + ++   K N  S I D F+GQ+++ L C
Sbjct: 453 EDSNWGRPQNS--------DAAMQVD--DYREAWNLYRKGNS-SYIVDTFKGQIKSQLTC 501

Query: 752 QRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCP 811
           Q C   S NY  F +L+L IP +           +  + DC+    +  +LTG++ W C 
Sbjct: 502 QVCQTQSNNYEPFSILNLPIPLV----------SMCHIYDCMKELFKVHVLTGDDRWYCS 551

Query: 812 KCGTHSNSSDGS 823
            C T ++S+ G+
Sbjct: 552 TCKTKTHSTLGT 563

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 62/133 (46%), Gaps = 21/133 (15%)

Query: 880  KSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIAR---- 935
            K+K  +T+ T     +P +L+IH +RF  +L  K E  + YP +LD+   N  + +    
Sbjct: 554  KTKTHSTLGT-TITNVPEVLIIHFNRF-DNLLNKKECFVKYPYLLDLSQGNGLLGKCDVP 611

Query: 936  YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITS 995
            Y+L  +  H G L SGHYT+          +  +  WY+FDD   K   N          
Sbjct: 612  YKLVAVACHTGTLFSGHYTAYC-------FKNSENGWYHFDDTQCKPVSN--------GE 656

Query: 996  ISSGDVYVLFYER 1008
              S   Y+LFY++
Sbjct: 657  CISQSAYLLFYQK 669

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
            (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 61/146 (41%), Gaps = 35/146 (23%)

Query: 883  KMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVV--------------- 927
            K  + K +    +P  L+IHL RF  +L  KN   ++YP  LD+                
Sbjct: 289  KQPSTKKITITRLPRNLIIHLKRF-DNLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKGV 347

Query: 928  -----LKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
                         Y LY +  HFG L  GHYT+ VNK    E + G   W YFDD   +K
Sbjct: 348  AELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNK----EDKNG---WCYFDDTCWRK 400

Query: 983  EFNHGDFDRGITSISSGDVYVLFYER 1008
              +    D  IT+      YVLFY R
Sbjct: 401  AKSE---DECITT----SAYVLFYHR 419

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 47/102 (46%), Gaps = 12/102 (11%)

Query: 712 EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAI 771
           EKL +      +W  E       S I D+FQGQ  + L C+ CG TS  Y  F VLS+ +
Sbjct: 197 EKLCMRIASSIEW--ERYLTTDFSVIVDLFQGQYASQLMCKVCGRTSTTYQPFSVLSVPV 254

Query: 772 PAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
           P         R  +   L DC   +T+ E L  +  W CP+C
Sbjct: 255 P---------RGAR-CNLLDCFEEFTKIETLEKDEQWSCPRC 286

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR---SNTIISKWFSLLFRKM 645
           GL N+GN+CY+N ++QCL G  +   +FL   Y  ++N      S  +++K+FS L   M
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHNM 116

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 78/197 (39%), Gaps = 18/197 (9%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRKM 645
           GL N+GNTCY+NS LQCL    Q RD FL   + + +   NP      +++ F++L + +
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLDNPLGYQGHVARSFAILIQNL 402

Query: 646 Y---LNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVAND 702
           +   L    S  P  F          F                            K   +
Sbjct: 403 FKDELLPSLSYSPTTFKSTVGHFNSMFSGYLQQDSQEFIAFLLDGLHEDLNRITNKPVVE 462

Query: 703 YPNLLLHDDEKLLVDNKEY------DKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGF 756
            P+L   DD    V N+E       D W    L+N+ +  I DIF G  +++L C  C  
Sbjct: 463 KPSLKPEDD----VSNQEVIKKLADDTWNSHLLRNDSI--ITDIFVGLYKSTLHCPECDN 516

Query: 757 TSYNYSTFYVLSLAIPA 773
            S  +  +  L+L +P 
Sbjct: 517 LSVTFDPYNDLTLPLPV 533

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 64/129 (49%), Gaps = 23/129 (17%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLI-LDV---VLKNNEIAR--YRLY 939
            K L   + P+IL+IHL RF      + K +  + +P+  LD+   V+ N+E     Y L 
Sbjct: 943  KQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLV 1002

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+ V   +        +KWYYFDD  V +       +R I    +G
Sbjct: 1003 SVDNHYGGLGGGHYTAYVKNFV-------DKKWYYFDDSRVTETVP----ERSI----AG 1047

Query: 1000 DVYVLFYER 1008
              Y+LFY R
Sbjct: 1048 SAYLLFYMR 1056

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 783 SKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
            +K I L+DC+NL+ + E+L   ++W CP C  H  ++
Sbjct: 905 GEKKITLDDCLNLFAKKEVLGMNDSWYCPTCKEHRQAT 942

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 81/198 (40%), Gaps = 10/198 (5%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSL 640
           SL ITGL N+GNTCY+NS LQC+     FR+ FL   Y + L   NP      +++ FS 
Sbjct: 317 SLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAEAFSE 376

Query: 641 LFRKMY---LNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPT 697
           L R ++   L    +  PN F          F                            
Sbjct: 377 LIRCLFGDKLVQFSAYAPNHFKATIGHFNSMFSGYLQQDSQEFLAFLLDSLHEDLNRIDK 436

Query: 698 KVANDYPNLLLHDD--EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCG 755
           K   + P+L    D  +  +V     D W    L+N+ +  I D+F G  +++L+C  C 
Sbjct: 437 KPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRNDSV--ITDLFVGLYKSTLECPECQ 494

Query: 756 FTSYNYSTFYVLSLAIPA 773
             S  +  +  L+L +P 
Sbjct: 495 NISITFDPYNDLTLPLPV 512

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 56/129 (43%), Gaps = 23/129 (17%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLI-LDV----VLKNNEIAR-YRLY 939
            K +     P++L+IHL RF      + K + ++ +P+   D+    V K++     Y L 
Sbjct: 930  KQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYDLI 989

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+               KWYYFDD  V +               +G
Sbjct: 990  AVDNHYGGLGGGHYTAYAK-------NSTDGKWYYFDDSRVTETVAENSI--------TG 1034

Query: 1000 DVYVLFYER 1008
              Y+LFY R
Sbjct: 1035 AAYLLFYLR 1043

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 778 KTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           K      K I L DC+NL+++ E+L+  ++W CP C  H  ++
Sbjct: 887 KDLEEKNKEITLNDCLNLFSKPEILSLNDSWYCPTCKEHRQAT 929

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 80/198 (40%), Gaps = 17/198 (8%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTI-----ISKWFSLLFR 643
           GL N+GNTCY+NS LQCL    Q RD FL   Y   LN    N I     ++K FS L +
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELN--TDNLIGYKGYVAKAFSSLVQ 381

Query: 644 KMYLN------GGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPT 697
            ++ +         S  PN F          F                            
Sbjct: 382 NLFGDTITKQGTNSSFGPNHFKSTVGHFNSMFSGYLQQDSQEFLAFLLDSLHEDLNRIIN 441

Query: 698 KVANDYPNLLLHDD--EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCG 755
           K + + P+L   DD  +  ++ +   + W    L+N+  S I D+F G  +++L+C  C 
Sbjct: 442 KPSTEKPSLKEGDDYNDPAVIKSLADETWKMHLLRND--SVITDLFVGMYKSTLECPECT 499

Query: 756 FTSYNYSTFYVLSLAIPA 773
             S  +  +  L+L +P 
Sbjct: 500 NVSITFDPYSDLTLPLPV 517

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 67/139 (48%), Gaps = 24/139 (17%)

Query: 878  HIKSKKMTTIKTLNFITMPNILVIHLSRFF--YDLTKKNETMINYP---LILDVVLKNNE 932
            H K  +  + K +     P++L+IHL RF      + K +  +N+P   L +   L + +
Sbjct: 897  HCKEHRQAS-KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFPIENLDMSPYLVHKD 955

Query: 933  IAR---YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDF 989
              R   Y LY + NH+G L  GHYT+ V   + +       KWYYFDD  V +     D 
Sbjct: 956  DPRGTVYDLYAVDNHYGGLGGGHYTAYVKNFIDN-------KWYYFDDSRVYE----TDP 1004

Query: 990  DRGITSISSGDVYVLFYER 1008
            ++ +    SG  Y+LFY R
Sbjct: 1005 EKSV----SGSAYLLFYLR 1019

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 746 ENSLKCQRCGFTS---YNYSTFYVL-SLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDEL 801
           E SL+  R  F+     N+    VL ++ +  +   +    S K I L DC+NL+++ E+
Sbjct: 827 EWSLESSRLAFSEEKVINWENPGVLQNVELEELKTQREVDGSDKEITLNDCLNLFSKREV 886

Query: 802 LTGENAWDCPKCGTHSNSS 820
           L   ++W CP C  H  +S
Sbjct: 887 LGLNDSWYCPHCKEHRQAS 905

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 78/198 (39%), Gaps = 10/198 (5%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSL 640
           S    GL N+GNTCY+NS LQCL    +F+D FL   Y + +   NP      I+  F+ 
Sbjct: 342 SKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFAS 401

Query: 641 LFRKMYL---NGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPT 697
           + + ++    +   S  P  F      L   F                            
Sbjct: 402 MVQALFGKRHSAATSYSPRNFKNTIGHLNSMFSGYQQQDSQEFLAFLLDGLHEDLNRIIE 461

Query: 698 KVANDYPNLLLHDD--EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCG 755
           K   + P L   DD  E  ++     D W    L+N+ +  I D+F G  +++L C  C 
Sbjct: 462 KPYVEKPELTSTDDTAEFKVIKKLADDTWGKHKLRNDSV--ITDLFVGLYKSTLICPVCK 519

Query: 756 FTSYNYSTFYVLSLAIPA 773
            TS  +  +  L+L +P 
Sbjct: 520 KTSVTFDPYNDLTLPLPV 537

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 61/129 (47%), Gaps = 24/129 (18%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLI-LDV----VLKNNEIAR-YRLY 939
            K +     P+IL+IHL RF      + K    +++P+  LD+    V KN +    Y L 
Sbjct: 996  KQIELWNAPDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLI 1055

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+ V        +    KWYYFDD  V +       +R I    +G
Sbjct: 1056 AVDNHYGGLGGGHYTAYV--------KNIDGKWYYFDDSRVSETLP----ERSI----AG 1099

Query: 1000 DVYVLFYER 1008
              Y+LFY R
Sbjct: 1100 SAYLLFYRR 1108

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 778 KTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           K  +  +K I L DC+ L++  E+L   ++W CP C  H  ++
Sbjct: 953 KRRASGEKKITLHDCLTLFSTPEVLGATDSWFCPNCKEHRQAT 995

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 3/64 (4%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRK 644
           TGL N+GNTCY+NS LQCL    Q RD FL   Y + +   NP   +  +++ FS L +K
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYHGYVARAFSDLIQK 420

Query: 645 MYLN 648
           ++ N
Sbjct: 421 LFQN 424

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLI-LD----VVLKNNEIAR-YRLY 939
            K +     P+IL+IHL RF      + K +  +N+P+  LD    VV K++     Y LY
Sbjct: 995  KQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNFPITDLDLSEHVVYKDDPRGSIYDLY 1054

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+ V   + +       KWYYFDD  V +               +G
Sbjct: 1055 AVDNHYGGLGGGHYTAYVKNFMDN-------KWYYFDDSRVTETVPENSV--------AG 1099

Query: 1000 DVYVLFYER 1008
              Y+LFY R
Sbjct: 1100 SAYLLFYIR 1108

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 784 KKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           ++ I L DC+ L+++ E+L   ++W CP C  H  ++
Sbjct: 958 ERTITLNDCLQLFSKPEILGLNDSWYCPTCKEHRQAT 994

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 81/203 (39%), Gaps = 15/203 (7%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSL 640
           S  ITGL N+GNTCY+NS LQCL    + RD FL   +   +   NP      +++ FS 
Sbjct: 289 SSGITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGYVARAFSG 348

Query: 641 LFRKMY----LNGGCSVV----PNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXX 692
           L + ++    L+ G ++     P GF          F                       
Sbjct: 349 LVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFNSMFSGYMQQDSQEFITFLLDGLHEDL 408

Query: 693 XSEPTKVANDYPNLLLHDDEK--LLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLK 750
                K   + P+L   DD     ++     D W     +N+ +  I D+F G  E++L+
Sbjct: 409 NRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTWKLHLQRNDSV--ITDLFVGLYESTLQ 466

Query: 751 CQRCGFTSYNYSTFYVLSLAIPA 773
           C  C   S  +  +  L+L +P 
Sbjct: 467 CPECNNVSITFDPYNDLTLPLPV 489

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 60/129 (46%), Gaps = 23/129 (17%)

Query: 888  KTLNFITMPNILVIHLSRF--FYDLTKKNETMINYPLI-LDV--VLKNNEIAR---YRLY 939
            K +     P++L+IHL RF      + K + ++++P+  LD+   L N    R   Y L 
Sbjct: 914  KQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYDLV 973

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+               KWYYFDD  V +       +RGI S    
Sbjct: 974  AVDNHYGGLGGGHYTAYAKN-------VDDSKWYYFDDSRVTETTP----ERGIAS---- 1018

Query: 1000 DVYVLFYER 1008
              Y+LFY R
Sbjct: 1019 SAYLLFYVR 1027

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%)

Query: 784 KKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           +K I L DC+ L+++ E+L   ++W CP C  H  ++
Sbjct: 877 EKKITLHDCLKLFSKREVLGMNDSWYCPSCKEHRQAT 913

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 84/203 (41%), Gaps = 18/203 (8%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSL 640
           S  ITGL N+GNTCY+NS LQCL    + RD FL   +   +   NP      I+K FSL
Sbjct: 298 SQGITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIAKAFSL 357

Query: 641 LFRKMYLNGGCSV-----VPNGF---LKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXX 692
           L + ++     S       PN F   +  C+ +   +                       
Sbjct: 358 LVKSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYMQQDSQEFLAFLLDGLHEDLNRV 417

Query: 693 XSEPTKVANDYPNLLLHDD--EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLK 750
             +P     + P+L  + D  ++  +     D W    L+N+ +  + D+F    E++L+
Sbjct: 418 HDKPYI---EKPSLSPNSDVTDRDTIKKLAEDTWKMHLLRNDSI--VTDLFVALYESTLE 472

Query: 751 CQRCGFTSYNYSTFYVLSLAIPA 773
           C  C   S  +  +  L+L +P 
Sbjct: 473 CPECRNVSITFDPYNDLTLPLPV 495

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 24/128 (18%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPL-ILDV----VLKNNEIARYRLYG 940
            K +   + P++L+IHL RF      + K +  +++P+  LD+    V ++   + Y L  
Sbjct: 904  KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIA 963

Query: 941  IINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGD 1000
            + NHFG L  GHYT+ V         K   KW+YFDD  V +        +  +SI +G 
Sbjct: 964  VDNHFGGLGGGHYTAYV---------KTNDKWFYFDDSRVTET-------KPESSI-AGS 1006

Query: 1001 VYVLFYER 1008
             Y+LFY R
Sbjct: 1007 AYLLFYLR 1014

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 50/123 (40%), Gaps = 24/123 (19%)

Query: 710 DDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSL 769
           +DE ++V+        D  L+NN +SP D I             C +++      +    
Sbjct: 793 NDENIIVETDSNTDTGDRSLRNNIISPRDVII------------CEWSASRVGEVFNEDT 840

Query: 770 AIPAMPPPKTF------------SRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHS 817
            I    P K               + K+ I L DC+ L+++ E+L+  ++W CP C  H 
Sbjct: 841 QINWNKPAKLVNNEVEARKKEAEGQEKRAISLHDCLKLFSKKEVLSMNDSWYCPTCKDHR 900

Query: 818 NSS 820
            ++
Sbjct: 901 QAT 903

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 56/129 (43%), Gaps = 15/129 (11%)

Query: 888  KTLNFITMPNILVIHLSRFFYDLTKKNE----TMINYPLILDV--VLKNNEIARYRLYGI 941
            +++    +P+ L +HL RF Y  TK +       ++YPL LDV     N+   +Y L GI
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGI 663

Query: 942  INHFGNLVS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGD 1000
            + H G     GHY SL         +     W  FDDE V+        D    S +   
Sbjct: 664  VVHMGGGPQHGHYVSLC--------KNDNFGWLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1001 VYVLFYERI 1009
             YVLFY  +
Sbjct: 716  AYVLFYREL 724

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           + G  N GNTCY NS+LQCL+  ++FR
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFR 156

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRK 644
           TGL N+GNTCY+NS LQCL    Q RD FL   Y   +   NP   +  +++ FS L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPLGYHGYVARAFSDLIQK 423

Query: 645 MYLNGGCSVVPNG 657
           ++ N    +  NG
Sbjct: 424 IFQNRLSVMQRNG 436

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 60/130 (46%), Gaps = 25/130 (19%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLILDVVLKNNEIAR-------YRL 938
            K +     P+IL+IHL RF      + K +  +N+P I D+ L  N + +       Y L
Sbjct: 992  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSKNVVYKDDPRGSIYDL 1050

Query: 939  YGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISS 998
            Y + NH+G L  GHYT+ V    ++       KWYYFDD  V +               +
Sbjct: 1051 YAVDNHYGGLGGGHYTAYVKNFANN-------KWYYFDDSRVTETVPENSI--------A 1095

Query: 999  GDVYVLFYER 1008
            G  Y+LFY R
Sbjct: 1096 GSAYLLFYIR 1105

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 24/37 (64%)

Query: 784 KKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           ++ I L+DC+ L+++ E+L   ++W CP C  H  ++
Sbjct: 955 ERTITLDDCLQLFSKPEILGLSDSWYCPTCKEHRQAT 991

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 80/207 (38%), Gaps = 20/207 (9%)

Query: 580 NEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISK 636
           N      I GL N+GNTCY+NS LQCL    + RD F  G Y + +   NP   N  ++ 
Sbjct: 281 NPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVAT 340

Query: 637 WFSLLFRKMY-----LNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXX 691
            F  L + +Y          S  PN F          F                      
Sbjct: 341 AFGNLIQNLYSYHWNQQQYQSYSPNRFKMTLGQANSMF-----AGYMQQDSQEFLAFLLD 395

Query: 692 XXSEPTKVANDYPNL---LLHDDEKLLVDN---KEYDKWFDEGLKNNGLSPIDDIFQGQM 745
              E     +D P +    L   E+L  +N   +   K +D  L  N  S I+D+F G  
Sbjct: 396 SLHEDLNRIHDKPYIEKPTLETSEELADENAVKQLAKKTWDAHLARND-SVINDLFVGMY 454

Query: 746 ENSLKCQRCGFTSYNYSTFYVLSLAIP 772
           +++LKC  C   S  +  +  L+L +P
Sbjct: 455 KSTLKCPTCKNISITFDPYNDLTLPLP 481

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 72/153 (47%), Gaps = 37/153 (24%)

Query: 873  KPEKLHI---------KSKKMTTIKTLNFITMPNILVIHLSRFF--YDLTKKNETMINYP 921
            KPE L I         K  +  T K L     P IL+IHL RF      + K + ++++P
Sbjct: 856  KPEVLGINDSWYCPKCKEHRQAT-KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFP 914

Query: 922  L--------ILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWY 973
            +        ++D V+++  I  Y L+ + NH+G L  GHYTS V  ++ +       +WY
Sbjct: 915  IEGLDMTPYVVDSVVEDGCI--YDLFAVDNHYGGLGGGHYTSYVKNNIDN-------RWY 965

Query: 974  YFDDEVVKKEFNHGDFDRGITSISSGDVYVLFY 1006
            YFDD  V       D  + +    +G  Y+LFY
Sbjct: 966  YFDDSRVSS----TDPKKSV----AGSAYLLFY 990

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 781 SRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           S S  II L+ C+ L+++ E+L   ++W CPKC  H  ++
Sbjct: 839 SASPNIITLDSCLKLFSKPEVLGINDSWYCPKCKEHRQAT 878

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRK 644
           TGL N+GNTCY+NS LQCL    Q RD FL   Y   +   NP   +  +++ FS L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 645 MYLNGGCSVVPNG 657
           ++ N   S+  N 
Sbjct: 424 LFHNKLSSMQRNA 436

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 59/129 (45%), Gaps = 23/129 (17%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLI-LD----VVLKNNEIAR-YRLY 939
            K +     P+IL++HL RF      + K +  +N+P+  LD    VV K++     Y LY
Sbjct: 998  KQIQLWNTPDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYDLY 1057

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+ V             KWYYFDD  V +               SG
Sbjct: 1058 AVDNHYGGLGGGHYTAYVKNF-------ADSKWYYFDDSRVTETVPENSI--------SG 1102

Query: 1000 DVYVLFYER 1008
              Y+LFY R
Sbjct: 1103 SAYLLFYIR 1111

 Score = 39.3 bits (90), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 25/37 (67%)

Query: 784 KKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           ++II L+DC+ L+++ E+L   ++W CP C  H  ++
Sbjct: 961 ERIITLDDCLQLFSKPEILGLNDSWYCPTCKEHRQAT 997

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 79/197 (40%), Gaps = 18/197 (9%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRKM 645
           GL N+GNTCY+NS LQC+     FRD FL G + + +   NP      +++ FS L + +
Sbjct: 331 GLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMARAFSDLIQSL 390

Query: 646 Y---LNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVAND 702
           +   +    +  P+ F          F                            K   +
Sbjct: 391 FGDNITSTTAYSPSYFKSTLGHFNSMFSGYLQQDSQEFLAFLLDSLHEDLNRIDKKPYVE 450

Query: 703 YPNLLL------HDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGF 756
            P+L L       D  K L D    D W    L+N+ +  I D+F    +++LKC  C  
Sbjct: 451 KPSLPLTANLNDFDVVKRLAD----DTWKAHLLRNDSV--ITDLFVAMYKSTLKCPECQN 504

Query: 757 TSYNYSTFYVLSLAIPA 773
           TS  +  +  L+L +P 
Sbjct: 505 TSVTFDPYNDLTLPLPV 521

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 62/145 (42%), Gaps = 30/145 (20%)

Query: 878  HIKSKKMTTIKTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLI-LDVV--LKNNE 932
            H K  +  T K +     P+IL+IHL RF      + K    + +P+   D+   L   E
Sbjct: 964  HCKEHRQAT-KQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKE 1022

Query: 933  IARYRLYGII---NHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDF 989
              R  +Y +I   NH+G L  GHYT+               KWYYFDD  V         
Sbjct: 1023 DPRGNVYDLIAVDNHYGGLGGGHYTAYAK-------NANDNKWYYFDDSRV--------- 1066

Query: 990  DRGITSIS---SGDVYVLFYERIHS 1011
               +T+     +G  Y+LFY R +S
Sbjct: 1067 --SVTAPEKSIAGSAYLLFYVRRNS 1089

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 26/39 (66%)

Query: 782 RSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           + ++ I L+DC+ L+++ E+L+  ++W CP C  H  ++
Sbjct: 934 QEERHITLDDCLKLFSKPEILSSNDSWYCPHCKEHRQAT 972

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 3/64 (4%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRK 644
           TGL N+GNTCY+NS LQCL    Q RD FL   Y   +   NP   +  +++ FS L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSDLVQK 423

Query: 645 MYLN 648
           ++ N
Sbjct: 424 LFQN 427

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 60/131 (45%), Gaps = 23/131 (17%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLI-LD----VVLKNNEIAR-YRLY 939
            K +     P+IL+IHL RF      + K +  +N+P+  LD    VV K++     Y LY
Sbjct: 996  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGLIYDLY 1055

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+ V             KWYYFDD  V +               +G
Sbjct: 1056 AVDNHYGGLGGGHYTAYVKNF-------ADNKWYYFDDSRVTETAPENSI--------AG 1100

Query: 1000 DVYVLFYERIH 1010
              Y+LFY R H
Sbjct: 1101 SAYLLFYIRRH 1111

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 772 PAMPPPKTFSRSK--------KIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           PA  P K    +K        + I L+DC+ L+++ E+L   ++W CP C  H  ++
Sbjct: 939 PATLPNKELENAKLERSNAKERTITLDDCLQLFSKPEILGLTDSWYCPTCKEHRQAT 995

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1.137
            YJL197W
          Length = 1462

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 63/129 (48%), Gaps = 23/129 (17%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLI-LD----VVLKNNEIAR-YRLY 939
            K +     P+IL+IHL RF      + K + ++N+P+  LD    +V  + E +  Y L 
Sbjct: 1104 KQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLI 1163

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+ V   +        QKWYYFDD  V       D  R I    SG
Sbjct: 1164 AVDNHYGGLGGGHYTAYVKNFV-------DQKWYYFDDSRVSL----ADPQRSI----SG 1208

Query: 1000 DVYVLFYER 1008
              Y+LFY R
Sbjct: 1209 SAYLLFYVR 1217

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSL 640
           S    GL N+GNTCY+NS LQCL    +F + FL   Y + +   NP      ++  F  
Sbjct: 410 STGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANAFGK 469

Query: 641 LFRKMY 646
           L  K++
Sbjct: 470 LIHKLF 475

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 25/37 (67%)

Query: 784  KKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
            +K I L+DC+ L+++ E+L  +++W CP C  H  ++
Sbjct: 1067 EKTILLDDCLRLFSKPEILGLQDSWYCPTCKDHRQAT 1103

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 60/124 (48%), Gaps = 17/124 (13%)

Query: 895  MPNILVIHLSRFFYDLTKKNETM-----INYPLILDVVLK-NNEIA-RYRLYGIINHFGN 947
            +P+ L +HL RF Y   K+N  +     I YPL L+V    N+E+  +Y+L GI+ H G 
Sbjct: 558  LPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAGIVVHMGG 616

Query: 948  LVS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFY 1006
                GHY SL      HE    +  W  FDDE V+        +    S +    YVLFY
Sbjct: 617  GPQHGHYVSLC----KHE----KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 668

Query: 1007 ERIH 1010
            + +H
Sbjct: 669  KAMH 672

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           + G  N GNTCY NS+LQCL+  S  R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 170

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
            (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
            114] FULL
          Length = 1160

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 62/131 (47%), Gaps = 23/131 (17%)

Query: 886  TIKTLNFITMPNILVIHLSRF--FYDLTKKNETMINYPLI-LD-----VVLKNNEIARYR 937
              K +     P+IL IHL RF   +  + K   ++++P+  LD     V    N+ + Y 
Sbjct: 904  ATKQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFPITGLDMSEHLVCHDPNQNSMYD 963

Query: 938  LYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSIS 997
            L  + NH+G L  GHYT+ V   +         KWYYFDD  V +     + +R I    
Sbjct: 964  LIAVDNHYGGLGGGHYTAYVKNFM-------DGKWYYFDDSRVSE----TEAERAI---- 1008

Query: 998  SGDVYVLFYER 1008
            SG  Y+LFY R
Sbjct: 1009 SGAAYLLFYRR 1019

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 77/196 (39%), Gaps = 10/196 (5%)

Query: 586 SITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLF 642
            I GL N+GN+CY+NS LQCL    + RD FL G + + +   NP      I++ F+ L 
Sbjct: 296 GIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALV 355

Query: 643 RKMYLNGGCSV---VPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKV 699
           + ++ +   ++    P  F          F                            K 
Sbjct: 356 KSLFDDKASALQAFSPRAFKSIIGHHNGMFAGFLQQDSQELLAFLLDGLHEDLNRIMKKP 415

Query: 700 ANDYPNLLLHDD--EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFT 757
             + P L   DD  +  ++ N     W    L+N  +  I D+F G  +++L C  C   
Sbjct: 416 FVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNESV--IVDLFVGLYKSTLTCPACDRV 473

Query: 758 SYNYSTFYVLSLAIPA 773
           S  +  F  L+L +P 
Sbjct: 474 SVTFDPFSDLTLPLPV 489

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 782 RSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           + K  I L DC+ L+++ E+L   ++W CP C  H  ++
Sbjct: 867 QEKGHISLTDCLELFSKSEVLGAADSWYCPNCKEHRQAT 905

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 19/107 (17%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDV--------VLKNNEIAR 935
           K + F + P IL + L RF YD        IN    +P  +DV        + +N E  +
Sbjct: 384 KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
           Y L+G++ H G++ +GHY +++   L       Q +WY FDDE V K
Sbjct: 444 YTLHGVLVHTGDISTGHYYAMIKPDL-------QDQWYRFDDEKVWK 483

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  F    FR L
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKL 234

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 61/127 (48%), Gaps = 21/127 (16%)

Query: 895  MPNILVIHLSRFFYDLTKKNETM-----INYPLILDVVLK-NNEIA-RYRLYGIINHFGN 947
            +P+ L +HL RF Y   K+N  +     I+YPL L+V    N+E+  +Y L GI+ H G 
Sbjct: 555  LPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAGIVVHMGG 613

Query: 948  LVS-GHYTSLVNKHLSHEIRKGQQK--WYYFDDEVVKKEFNHGDFDRGITSISSGDVYVL 1004
                GHY SL  KH         QK  W  FDDE V+        +    S +    YVL
Sbjct: 614  GPQHGHYVSLC-KH---------QKFGWLLFDDETVEAVKEETVLEFTGESANMATAYVL 663

Query: 1005 FYERIHS 1011
            FY+ + S
Sbjct: 664  FYKAVCS 670

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           + G  N GNTCY NS+LQCL+  S  R+  L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRENIL 169

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 48/113 (42%), Gaps = 15/113 (13%)

Query: 701 NDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYN 760
           N+    + H+++K     K   K  + G  N   + I+D+F+G + N +KC  C   +  
Sbjct: 443 NELSEYIEHENQK-----KATSKIKNNGFLNTSTNFINDLFKGTLTNQIKCLTCDNVTSR 497

Query: 761 YSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
              F    + +          + ++   ++  +  Y Q E+L G N + C +C
Sbjct: 498 DEPFLDFPIEV----------KGEEETDIQAILKSYHQREMLNGSNKFYCDEC 540

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 58/121 (47%), Gaps = 17/121 (14%)

Query: 895  MPNILVIHLSRFFYDLTKKNETM-----INYPLILDVVLK-NNEIA-RYRLYGIINHFGN 947
            +P+ L +HL RF Y   K+N  +     I+YPL L+V    N+E+  +Y L GI+ H G 
Sbjct: 557  LPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSGIVVHMGG 615

Query: 948  LVS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFY 1006
                GHY SL      HEI      W  FDDE V+        +    S +    YVLFY
Sbjct: 616  GPQHGHYVSLC----KHEIF----GWLLFDDETVEAVKEEAVLEFTGESPNMATAYVLFY 667

Query: 1007 E 1007
            +
Sbjct: 668  K 668

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           + G  N GNTCY NS+LQCL+  S  R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVRENIL 170

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 62/140 (44%), Gaps = 32/140 (22%)

Query: 886  TIKTLNFITMPNILVIHLSRF--FYDLTKKNETMINYPLI-LDV-----------VLKNN 931
              + +   + P IL++HL RF   Y  T K    +++PL  LD+               +
Sbjct: 965  ATRQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDGDGDGD 1024

Query: 932  EIARYRLYGII---NHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGD 988
            +  R  +Y +I   NHFG L SGHYT+ V   +         KWY FDD  V+       
Sbjct: 1025 DGGRENVYDLIAVDNHFGGLGSGHYTAYVKNPV-------DDKWYLFDDSEVR------- 1070

Query: 989  FDRGITSISSGDVYVLFYER 1008
             +    S++S   Y+LFY R
Sbjct: 1071 -EVDAESVASSFGYLLFYRR 1089

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 29/47 (61%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRS 630
           S    GL N+G+TC+INS+LQCL   ++ RD FL   +   LN + S
Sbjct: 347 SSGTMGLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNS 393

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 781 SRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
            R K+   LEDC++L+T  E+L   ++W CP C
Sbjct: 927 GRQKQETTLEDCLDLFTAPEVLNTADSWYCPAC 959

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRK 644
           TGL N+GN+CY+NS LQCL    + +D FL G Y   +   NP     ++++ F+ L + 
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQAFAALIKS 393

Query: 645 MY 646
           ++
Sbjct: 394 LF 395

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 59/134 (44%), Gaps = 29/134 (21%)

Query: 886  TIKTLNFITMPNILVIHLSRF--FYDLTKKNETMINYP---------LILDVVLKNNEIA 934
              K +     P+IL IHL RF   +  + K   ++++P         L+ +   +NN   
Sbjct: 935  ATKQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNN--- 991

Query: 935  RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGIT 994
             Y L  + NH+G L  GHYT+     +         KWYYFDD  V +           T
Sbjct: 992  LYDLVAVDNHYGGLGGGHYTAFAKNPVDG-------KWYYFDDSRVSETDPE-------T 1037

Query: 995  SISSGDVYVLFYER 1008
            S+ SG  Y+LFY R
Sbjct: 1038 SV-SGAAYLLFYRR 1050

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 24/39 (61%)

Query: 782 RSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
             ++ I L DC+ L+++ E+L+  ++W CP C  H  ++
Sbjct: 898 EGERRISLFDCLKLFSKPEVLSAADSWYCPTCREHRQAT 936

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 53/123 (43%), Gaps = 15/123 (12%)

Query: 894  TMPNILVIHLSRFFYDLTKKNETM----INYPLILDV--VLKNNEIARYRLYGIINHFGN 947
            ++P  L +HL RF Y   K         I+YPLIL+      ++    YRL G++ H GN
Sbjct: 563  SLPKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQGVVVHMGN 622

Query: 948  LV-SGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFY 1006
                GHY SL +  L          W  FDDE V+        D   +  S    YVLFY
Sbjct: 623  GPHHGHYVSLCHTELF--------GWLLFDDETVESVDESYVLDFVGSHESPTTAYVLFY 674

Query: 1007 ERI 1009
              I
Sbjct: 675  SEI 677

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 553 TPQRNDWTVQTQHLHV--PFSIPTIERSPNEFVSL-------SITGLRNMGNTCYINSML 603
           T Q    ++  Q ++V  P S  TI   P     L        + G  N GNTCY NS+L
Sbjct: 117 TDQATAGSMPAQEINVTPPISSNTISLEPRVSKGLPFGDGSNKVFGYENFGNTCYCNSVL 176

Query: 604 QCLFGCSQFR 613
           QCL+   +FR
Sbjct: 177 QCLYHLPEFR 186

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 10/85 (11%)

Query: 729 LKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIR 788
           L++ G + I + FQG + N +KC  C   + +   F    + + A          +K I 
Sbjct: 475 LQSRGQTYILNQFQGTVTNQIKCLTCDTITSSSEPFLDFPIEVEA--------DEEKYI- 525

Query: 789 LEDCINLYTQDELLTGENAWDCPKC 813
            ++ +  Y Q ELL G N + C +C
Sbjct: 526 -QNVMEHYQQRELLRGSNKFYCNEC 549

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 58/125 (46%), Gaps = 17/125 (13%)

Query: 895  MPNILVIHLSRFFYDLTKKNETM-----INYPLILDVVLKNNE--IARYRLYGIINHFGN 947
            +P+ L +HL RF Y   K+N  +     I+YPL L+V    N     +Y L GI+ H G 
Sbjct: 555  LPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIVVHMGG 613

Query: 948  LVS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFY 1006
                GHY SL      HE    +  W  FDDE V+        +    S +    YVLFY
Sbjct: 614  GPQHGHYVSLC----KHE----KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 665

Query: 1007 ERIHS 1011
            + ++S
Sbjct: 666  KAMYS 670

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           + G  N GNTCY NS+LQCL+  S  R+  L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 169

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 33/77 (42%), Gaps = 10/77 (12%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
           I D+FQG + N +KC  C   +     F    + +          +  +   +++ +  Y
Sbjct: 474 ISDLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEV----------QGDEETDIQEILKSY 523

Query: 797 TQDELLTGENAWDCPKC 813
            Q E+L G N + C +C
Sbjct: 524 HQREMLNGSNKFYCDEC 540

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 108/258 (41%), Gaps = 63/258 (24%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
           I DIF G ++  +KC+ CG  S      Y LSL +          + KK+ + +D     
Sbjct: 471 IYDIFGGLLQQRVKCKSCGSVSITEQPIYDLSLHL----------KGKKLAKGDDS---- 516

Query: 797 TQDELLTGENAWDCPKCGTHSNSSDGS-MNSDETVDKKKKKNFLSVNGDHXXXXXXXXXX 855
           T D+ +TG    D       S S+DG+ +       +K  ++F +               
Sbjct: 517 TVDDSITG----DVKNSAAPSGSTDGAELPKRRYSIEKSIRDFFN--------------- 557

Query: 856 XXXXXXXXXXPFKSNSVKPEKLHIKSK-KMTT--IKTLNFITMPNILVIHLSRFFYDLT- 911
                     P     V  ++ ++  K K TT  IK    +  P  L++HL +F ++ T 
Sbjct: 558 ----------PELIKKVDNKEGYVCEKCKATTNAIKRNMILRAPETLLVHLKKFRFNGTS 607

Query: 912 -KKNETMINYPLILDVVLKNNEIA-----RYRLYGIINHFG-NLVSGHYTSLVNKHLSHE 964
             K +  ++YPL +D+     E A     +Y+L  ++ H G +L SGHY       ++H 
Sbjct: 608 SSKMKQAVSYPLFMDLTEYCVEAAKCLPVKYQLISVVVHEGRSLSSGHY-------IAH- 659

Query: 965 IRKGQQKWYYFDDEVVKK 982
            ++    W  +DDE + K
Sbjct: 660 CKQPDGTWATYDDEYINK 677

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 90/235 (38%), Gaps = 21/235 (8%)

Query: 547 IAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCL 606
           +A EL+ P +N      QH    + I   + +P    S    GL N+GNTCY+NS LQCL
Sbjct: 319 LAVELKPPAKN------QHWASNYYIYN-QMTP----SNGTVGLGNLGNTCYMNSALQCL 367

Query: 607 FGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRKMYL---NGGCSVVPNGFLK 660
               +F+D FL   Y + +   NP      I+  F  L + ++    N   S  P  F  
Sbjct: 368 VHIPEFKDYFLYNAYEKEINVDNPLGHKGHIAWAFGTLIQSLFGKRNNLISSYSPRHFKT 427

Query: 661 ACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLLLHDD--EKLLVDN 718
               L   F                            K   + P L   DD  E   +  
Sbjct: 428 TIGHLNSMFAGYQQQDSQEFLAFLLDGLHEDLNRIVDKPYVEKPELNPTDDVTEFETIKK 487

Query: 719 KEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPA 773
              D W    L+N+ +  I D+F G  +++L C  C   S  +  +  L+L +P 
Sbjct: 488 LADDTWLKHKLRNDSV--ILDLFVGLYKSTLICPTCKKVSTTFDPYNDLTLPLPV 540

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 64/129 (49%), Gaps = 23/129 (17%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPLI-LDV----VLKNNEIAR-YRLY 939
            K +     P+IL+IHL RF      + K   ++++P+  LD+    V K+++    Y L 
Sbjct: 971  KQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYDLI 1030

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+ V   L +       KWYYFDD  V    N    +R I    +G
Sbjct: 1031 AVDNHYGGLGGGHYTAYVKNFLDN-------KWYYFDDSRV----NETVPERSI----AG 1075

Query: 1000 DVYVLFYER 1008
              Y+LFY R
Sbjct: 1076 SAYLLFYRR 1084

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 12/96 (12%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAI----PAMPPPKTFSRSK-------- 784
           ++DI + ++  +     C + S +Y   +  SL +    P   P      SK        
Sbjct: 875 LNDIPREKLIKAQNAIICEWNSKSYDEVFNSSLKVNWDSPGEVPNTELEASKRERNAQEE 934

Query: 785 KIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           K I L DC+ L++  E+L   ++W CP C  H  ++
Sbjct: 935 KKITLHDCLTLFSTPEVLGATDSWYCPSCKEHRQAT 970

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 53/116 (45%), Gaps = 20/116 (17%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDVV---------LKNNEIA 934
           K + F + P +L + L RF YD        IN    +P  +DV          L N E  
Sbjct: 380 KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 935 RYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFD 990
            Y L+G++ H G++ +GHY +++   +S E       WY FDD+ V +      FD
Sbjct: 440 IYNLHGVLVHAGDISTGHYYTMIRPGVSDE-------WYRFDDDKVWRVTKKQAFD 488

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G +N G TCY+NS+LQ  F    FR L
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRL 230

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSLLFRK 644
            GL N+GNTCY+NS LQCL      RD F  G Y   +   NP      I+  FS L + 
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQGNIANAFSALVQN 457

Query: 645 MYLNG---GCSVVPNGF 658
           +Y N      S  P+ F
Sbjct: 458 LYKNQFIPSASYAPSQF 474

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 63/131 (48%), Gaps = 27/131 (20%)

Query: 888  KTLNFITMPNILVIHLSRFFYD--LTKKNETMINYPL--------ILDVVLKNNEIARYR 937
            K +   + P+IL IHL RF      + K + ++++P+        ILD     +++  Y 
Sbjct: 996  KQIQLWSTPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDK--STSQLNIYD 1053

Query: 938  LYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSIS 997
            L  + NH+G L  GHYT+ +   + +       KWYYFDD  V +       +R +    
Sbjct: 1054 LIAVDNHYGGLGGGHYTAYIKNLIDN-------KWYYFDDSRVSETVP----ERSV---- 1098

Query: 998  SGDVYVLFYER 1008
            +G  Y+LFY R
Sbjct: 1099 AGSAYLLFYMR 1109

 Score = 38.9 bits (89), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%)

Query: 782 RSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           + +K I LED +NL+ + E+L   ++W CPKC  H  +S
Sbjct: 957 KEEKNITLEDSLNLFERAEVLGINDSWYCPKCKHHRQAS 995

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 76/171 (44%), Gaps = 45/171 (26%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINY---- 920
            PFKS+S K     +++KK T I  L     P +L+I L RF F     K+  M NY    
Sbjct: 925  PFKSSSGK----DVEAKKQTFIDKL-----PQVLLIQLKRFSFVSNIGKDNGMTNYNSYN 975

Query: 921  ------------------PL--ILDVVLKNNEIAR-YRLYGIINHFGNLV-SGHYTS-LV 957
                              P+  +   +LKNNE +R Y+L  ++ H G+    GHYT+ + 
Sbjct: 976  GRIEKIRKKINYNHELLVPVESVSSAILKNNESSRKYKLRAVVYHHGSSPDGGHYTADIY 1035

Query: 958  NKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYER 1008
            NK L        +KW+  DD  + +  +    + G   + +   Y+L YE+
Sbjct: 1036 NKDL--------KKWFMIDDVNITELEDADVVNGGDNGLDTRTAYILMYEK 1078

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 94/232 (40%), Gaps = 43/232 (18%)

Query: 586 SITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKM 645
            + GL NMG+TC+++S++Q +     F +  L  K+    + K     +S     +    
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKCVSCALDEIACDF 190

Query: 646 YLNG----GCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVAN 701
           Y NG      S V  GF+    +L   +HI                          + A+
Sbjct: 191 YGNGPGTGKSSSVSKGFVN---LLSASWHI-----------------NHHLVGSSQQDAH 230

Query: 702 DYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNY 761
           +Y   LL+   +L  D   + + F      +       IFQG ++N+L+C +CGF+    
Sbjct: 231 EYWQFLLN---QLHTD---HARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQCGFSKTTI 284

Query: 762 STFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
                LSL I   P            +LEDC++ + ++E LT +  ++C  C
Sbjct: 285 DPIMDLSLEIKNNP------------KLEDCLDHFQREETLT-DFHYECQSC 323

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 18/105 (17%)

Query: 886 TIKTLNFITMPNILVIHLSRFFYDLTKKNETM---INYPLILDVVLKNNEIA-------R 935
            +K L     PN+LVI L RF + L  ++  +   + +PL L++     +I         
Sbjct: 329 VVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIA 388

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           Y L  +++H G +  GHYT++       +   GQ  W+ F+D VV
Sbjct: 389 YDLLNVVSHQGTVDQGHYTTVS------KTEDGQ--WFKFNDSVV 425

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 67/171 (39%), Gaps = 42/171 (24%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINY---- 920
            PFKS+S       +++KK T I  L     P IL+I L RF F     K+  M NY    
Sbjct: 661  PFKSSSGN----DVEAKKQTFIDKL-----PQILLIQLKRFSFISNADKDNGMTNYNAYS 711

Query: 921  --------------------PLILDVVLKNNEIARYRLYGIINHFG-NLVSGHYTSLVNK 959
                                  +    L+NN    Y L G+I H G +   GHYT+ V  
Sbjct: 712  GRIEKIRKKISYGHTLEIPDETLASSALRNNSSKTYELSGVIYHHGMSPDGGHYTADV-- 769

Query: 960  HLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIH 1010
                   K  + WY  DD  + K  +      G  ++ S   Y+L Y+ +H
Sbjct: 770  -----FHKQTKTWYRIDDVNITKLEDDDVLKGGEDNMDSRTAYILMYQNVH 815

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 750

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 58/112 (51%), Gaps = 17/112 (15%)

Query: 880 KSKKMT-TIKTLNFITMPNILVIHLSRFFYDLT--KKNETMINYPLILDVVLKNNEI--- 933
           K KK+T  +K+   I  P  LV+HL +F ++ T   K +  ++YP+ LD+    +E    
Sbjct: 575 KCKKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISS 634

Query: 934 --ARYRLYGIINHFG-NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
              RY+L  ++ H G +L SGHY       ++H  ++    W  +DDE + K
Sbjct: 635 LPVRYQLISVVVHEGRSLSSGHY-------IAH-CKQPDGSWATYDDEYINK 678

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 55/115 (47%), Gaps = 19/115 (16%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDV-------VLKNNEIAR- 935
           K + F + P +L + L RF YD        IN    +P  +D+       VL+ N   R 
Sbjct: 380 KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFD 990
           Y L+G++ H G++ +GHY +L+   L       + +WY FDDE V K      FD
Sbjct: 440 YGLHGVLVHTGDISTGHYYALIKPGL-------EDQWYRFDDERVWKVSKKQAFD 487

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  F    FR L
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRL 230

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 22/112 (19%)

Query: 528 NRPPVPLPINSPAPL---LKPSIAKELRTPQRNDWTVQTQ---------------HLHVP 569
           N  P  +P+N  +P+   +  S  + L  P   + T+ T                H+  P
Sbjct: 51  NSVPKSMPVNDSSPVFETINTSGVQSLDEPSFINSTLPTSKVDSSLEKSFASEYTHVEKP 110

Query: 570 FSIPTIERSPNEFVSLSIT---GLRNMGNTCYINSMLQCLFGCSQFRDLFLG 618
              PT E + N  + + I    GL N GNTCY NS+LQCL+  ++FR+  LG
Sbjct: 111 VFSPTNEEN-NLDIDIDIHKVYGLENFGNTCYCNSILQCLYNMNEFRENILG 161

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 55/131 (41%), Gaps = 15/131 (11%)

Query: 888  KTLNFITMPNILVIHLSRFFY-DLTKKNETMIN---YPLILDVVLKNNEIAR--YRLYGI 941
            + L    +P  L IHL RF Y D    N  + N   YP+ L V    +E     Y L G+
Sbjct: 520  RLLGLKELPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGL 579

Query: 942  INHFG-NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGD 1000
            + H G     GHY S+         +     W  FDDE V+             S S+G 
Sbjct: 580  VVHIGIGPQHGHYISVC--------KTSDYGWLLFDDETVECISEDTVLSFVGDSNSAGT 631

Query: 1001 VYVLFYERIHS 1011
             YVLFY+ I+S
Sbjct: 632  AYVLFYKEINS 642

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 11/114 (9%)

Query: 700 ANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSY 759
           A+++ N LL+D    L D    +K  D     N  + ++DIF+G + N ++C  C   + 
Sbjct: 410 AHEFLNFLLNDVSDYL-DKANTEKNPDNTRSGNETNFVNDIFKGTITNQIRCLTCDTVTS 468

Query: 760 NYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
            Y +F    + +             + I ++  +  Y Q E+L G N + C  C
Sbjct: 469 RYESFLDFPIEVIG----------DETIDIQKMMISYHQKEMLQGSNKFYCGTC 512

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 15/122 (12%)

Query: 895  MPNILVIHLSRFFYDLTKKNE----TMINYPLILDVVLK-NNEIA-RYRLYGIINHFGNL 948
            +P+ L +HL RF Y   +         + YPL LDV    ++ IA +Y L G++ H G  
Sbjct: 541  LPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGGS 600

Query: 949  VS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYE 1007
               GHY SL         +  +  W  FDDE V+        +    S +    YVLFY+
Sbjct: 601  PQHGHYVSLC--------KNDKFGWLLFDDETVESVTEKTVLEFTGDSSNQATAYVLFYK 652

Query: 1008 RI 1009
             +
Sbjct: 653  EL 654

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           + G  N GNTCY NS+LQCL+  ++ R
Sbjct: 136 VFGYENFGNTCYCNSVLQCLYNLTELR 162

 Score = 35.4 bits (80), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 32/75 (42%), Gaps = 10/75 (13%)

Query: 739 DIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQ 798
           D+FQG + N +KC  C   +     F    + +          +  + I ++D +  Y  
Sbjct: 462 DLFQGVLTNRIKCLTCDNITSRDEPFLDFPIGV----------KGDENIDIQDVLRCYHT 511

Query: 799 DELLTGENAWDCPKC 813
            E+L G N + C +C
Sbjct: 512 REMLNGSNKFYCSQC 526

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 82/201 (40%), Gaps = 17/201 (8%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYL---NPKRSNTIISKWFSL 640
           S    GL N+GNTCY+NS LQCL    Q RD F+   + + +   NP      +++ F  
Sbjct: 317 STGTIGLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGFQGHMARSFHG 376

Query: 641 LFRKMYLNGGCSVVP-NGFLKACHMLRPDFHIPTXXXXXXXXXXXX--XXXXXXXXSEPT 697
           L + ++   G S+ P   ++   H      H  +                       +  
Sbjct: 377 LIQSLF---GDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQQQDSQEFLAFLLDSLHEDLN 433

Query: 698 KVAN----DYPNLLLHDD--EKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKC 751
           ++      + P+L   DD  +   +     + W    ++N+ +  I DIF G  +++L+C
Sbjct: 434 RIVEKPYVEKPSLKPGDDINDFDTIKKLANETWKSHLMRNDSI--ITDIFVGMYKSTLEC 491

Query: 752 QRCGFTSYNYSTFYVLSLAIP 772
             C   S  +  +  L+L +P
Sbjct: 492 PECSNVSITFDPYNDLTLPLP 512

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 65/133 (48%), Gaps = 23/133 (17%)

Query: 888  KTLNFITMPNILVIHLSRF--FYDLTKKNETMINYPLI-LDV----VLKNNEIAR-YRLY 939
            K +     P++ +IHL RF      + K +  I +P+  LD+    V K++     Y L 
Sbjct: 927  KKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFPIEDLDMSEYLVYKDDPRGSVYDLI 986

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G +  GHYT+ V K+L+       Q WYYFDD  V K       ++ I    +G
Sbjct: 987  AVDNHYGGMGGGHYTAYV-KNLT------DQNWYYFDDSRVSK----TSPEKSI----AG 1031

Query: 1000 DVYVLFYERIHSI 1012
              Y+LFY R  S+
Sbjct: 1032 SAYLLFYLRRGSL 1044

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 22/32 (68%)

Query: 789 LEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           L+DC+NL+++ E+L   ++W CP C  H  ++
Sbjct: 895 LKDCLNLFSKKEVLGMSDSWYCPNCKEHRQAT 926

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (50%), Gaps = 15/93 (16%)

Query: 895 MPNILVIHLSRFFYDLTKKNE----TMINYPLILDV-VLKNNEIAR-YRLYGIINHFGNL 948
           +P  L++HL RF Y   + +       INYPL+L V    N++I++ Y L GI+ H G  
Sbjct: 520 LPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLGGG 579

Query: 949 VS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
              GHY S+         +  +  W  FDDEVV
Sbjct: 580 PQHGHYVSIC--------KNEKYGWLLFDDEVV 604

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 22/84 (26%)

Query: 531 PVPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGL 590
           P P+P+  P  L+K            ND    + H  +   I  +  S N+     + G 
Sbjct: 77  PTPVPLKDPRELVK------------ND----SDHQKL-LEITKLSDSSNK-----VFGY 114

Query: 591 RNMGNTCYINSMLQCLFGCSQFRD 614
            N GNTCY NS+LQCL+   + RD
Sbjct: 115 ENFGNTCYCNSVLQCLYNIPELRD 138

 Score = 32.0 bits (71), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 10/77 (12%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
           I+D+FQG ++ + +C  C   +     F  L  AI      +T         +++ +  Y
Sbjct: 439 INDLFQGVIKYTTRCLTCDNITSREELF--LDFAIEVSNNEET--------NIQEILGDY 488

Query: 797 TQDELLTGENAWDCPKC 813
           +Q E+L G N + C  C
Sbjct: 489 SQREMLNGSNKFFCDCC 505

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 19/107 (17%)

Query: 887 IKTLNFITMPNILVIHLSRFFYDLTKKNETM---INYPLILDV--VLKNNE------IAR 935
           IK      +P +LV+ L RF + ++  N+ +   I +P ILD+   LK+N+         
Sbjct: 341 IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSIL 400

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
           Y L GII+H G++  GHY +        +I  G+  W+ F+D +V K
Sbjct: 401 YELIGIISHTGSVNEGHYVAFC------KIENGE--WFKFNDSMVTK 439

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 6/36 (16%)

Query: 571 SIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCL 606
           ++PT+++         + GL NMG+TCY++S++QC+
Sbjct: 126 NVPTVDQID------GMAGLVNMGSTCYMSSIMQCI 155

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 66/161 (40%), Gaps = 39/161 (24%)

Query: 883  KMTTIKTLNFITMPNILVIHLSRFFYDLTK--KNETMINYPLILDVV---LKNNEIAR-- 935
            K   I+       P+IL +HLSR  ++     +N   + YP  L V+   ++N    R  
Sbjct: 315  KTAIIRRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYPETLIVLQRDVENGTAERIT 374

Query: 936  YRLYGIINHFGNLVSGHYTS---------------LVNKHLSHEIR-----------KGQ 969
            YRL  +I H G   SGHY                  VN+  +   R           K  
Sbjct: 375  YRLRSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSV 434

Query: 970  QKW-YYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
            ++W Y+F  + V +E N G   R      S  VY+LFYER+
Sbjct: 435  RRWPYWFISDAVVRESNAGKMLR-----ESKYVYMLFYERV 470

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 36/139 (25%)

Query: 883  KMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINY---PLILDV--VLKNNEIAR-- 935
            K   I+ L    +P +LV+ L RF + +   +  + NY   P  LD+    + +++    
Sbjct: 331  KQNAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGETP 390

Query: 936  ---YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRG 992
               Y L G+I+H G++  GHYTS+       +I  GQ  W+ F+D +V            
Sbjct: 391  AIVYELIGLISHQGSVNQGHYTSIC------KIPGGQ--WFKFNDSMV------------ 430

Query: 993  ITSISSGDV-----YVLFY 1006
             T+++  DV     Y+LFY
Sbjct: 431  -TAVAEIDVLKEQAYLLFY 448

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 54/109 (49%), Gaps = 21/109 (19%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDV-------VLKN---NEI 933
           K + F + P +L + L RF YD        IN    +P  +D+       VLKN    E 
Sbjct: 386 KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 934 ARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
             Y+L+G++ H G++ +GHY +++   L      G Q WY FDDE V K
Sbjct: 446 HIYKLHGVLVHTGDISTGHYYTMIKPDL------GDQ-WYRFDDERVWK 487

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  F    FR L
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKL 236

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 14/88 (15%)

Query: 727 EGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKI 786
           +G K  G   + ++F G+M++ +KC+   + S     F+ + L +            K +
Sbjct: 307 KGTKVEG--KLSELFVGKMKSYIKCKNVDYESSRVEEFWDIQLNV------------KDL 352

Query: 787 IRLEDCINLYTQDELLTGENAWDCPKCG 814
             L+     Y + EL+ GEN +  P  G
Sbjct: 353 KNLQQSFENYIEVELMDGENQYAAPDFG 380

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 62/132 (46%), Gaps = 29/132 (21%)

Query: 895  MPNILVIHLSRFFYDLTKK-NETMIN---YPLILDVVLK-NNEIAR-YRLYGIINHFGNL 948
            +P+IL +HL RF Y   K  N  + N   YPL L+V    ++ I + Y L G++ H G+ 
Sbjct: 645  LPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSS 704

Query: 949  VS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK-------EFNHGDFDRGITSISSGD 1000
               GHY SL         +  +  W  FDDE V+        EF  GD +   T+     
Sbjct: 705  PQHGHYVSLC--------KNDKFGWLLFDDETVESVSESTVLEFT-GDPNNQATA----- 750

Query: 1001 VYVLFYERIHSI 1012
             YVLFY+ I  I
Sbjct: 751  -YVLFYKEIKDI 761

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 41/86 (47%), Gaps = 14/86 (16%)

Query: 530 PPVPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPFS--IPTIERSPNEFVSLSI 587
           PP+P P  + +    P+      T   ND T+ +  L  P S  IP  + S   F     
Sbjct: 124 PPLPPPSRNTSKKQVPA------TIVNNDDTLNSAILFTPVSDLIPYGDGSNKVF----- 172

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFR 613
            G  N GNTCY NS+LQCL+   +FR
Sbjct: 173 -GYENFGNTCYCNSVLQCLYNLYEFR 197

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 72/170 (42%), Gaps = 42/170 (24%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINY---- 920
            PFKS+S       +++KK T I  L     P +L+IHL RF F + T K+ +M NY    
Sbjct: 866  PFKSSS----GADVEAKKQTFIDKL-----PTVLLIHLKRFSFINNTDKDNSMANYNAYH 916

Query: 921  --------------PLIL--DVVLKNNEIA----RYRLYGIINHFG-NLVSGHYTSLVNK 959
                           L++  + +    ++A     Y L G++ H G +   GHYT+ +  
Sbjct: 917  GRIEKIRKKISYNHELVIPAETITNGKQLAPENRTYELTGVVYHHGLSSDGGHYTADI-- 974

Query: 960  HLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
                   K   KWY  DD  V +         G  S  S   Y+L Y+++
Sbjct: 975  -----YHKEVDKWYRIDDVTVTELEKDDVLKGGENSTDSRTAYILMYQKL 1019

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 49/107 (45%), Gaps = 19/107 (17%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDVV--------LKNNEIAR 935
           K + F + P IL + L RF YD        IN    +P   D            NNE   
Sbjct: 378 KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
           Y L+G++ H G++ +GHY +++   L       + +WY FDDE V K
Sbjct: 438 YNLHGVLVHTGDISTGHYYAMIKPDL-------EDQWYRFDDEKVWK 477

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 78/227 (34%), Gaps = 55/227 (24%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMYL 647
            G RN G TCY+NS+LQ  F    FR L        Y  P  S T  S    L  ++ + 
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YKIPTESETPNSS-VPLALQRAFY 252

Query: 648 NGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKVANDYPNLL 707
               S +P   L+       D                         S      +D   L 
Sbjct: 253 QLQVSQIPLDTLELTRSFGWD-------------------------SAEAFTQHDVQEL- 286

Query: 708 LHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVL 767
                ++L+D  E     +  L       + ++F G+M++ +KC    + S     F+ L
Sbjct: 287 ----NRILMDRLE-----NRMLGTPVEGKLSELFVGKMKSYIKCVNVEYESSRVEDFWDL 337

Query: 768 SLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCG 814
            L +            K +  L+D    Y + EL+ GEN +     G
Sbjct: 338 QLNV------------KNLKCLKDSFENYIEIELMNGENQYAAQDFG 372

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 57/122 (46%), Gaps = 15/122 (12%)

Query: 895  MPNILVIHLSRFFYDLTK----KNETMINYPLILDV--VLKNNEIARYRLYGIINHFGNL 948
            +P+ L++HL RF Y   +    K  + + YPLIL+V    K  +  +Y L GI+ H G+ 
Sbjct: 518  LPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGIVIHVGDG 577

Query: 949  VS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYE 1007
               GHY +L         +  +  W ++DDE V+               +    YVLFY+
Sbjct: 578  PQMGHYVALC--------KTEKYGWLFYDDETVESVSEETVLKFIGDEKTQSTAYVLFYK 629

Query: 1008 RI 1009
            ++
Sbjct: 630  KL 631

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           + G  N GNTCY NS+LQCL+   +FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFR 151

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 10/77 (12%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
           I++IFQG + N ++C  C   +     F  L + +          +      ++  +  Y
Sbjct: 437 INEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEV----------KENGDTDIQRVLKYY 486

Query: 797 TQDELLTGENAWDCPKC 813
           +Q E+L G N ++C +C
Sbjct: 487 SQREMLNGSNKFNCSQC 503

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 25/41 (60%)

Query: 586 SITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN 626
            I GL N+GNTCY+NS LQCL    +  + FL   Y R +N
Sbjct: 337 GIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREIN 377

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 57/129 (44%), Gaps = 23/129 (17%)

Query: 888  KTLNFITMPNILVIHLSRFF--YDLTKKNETMINYPL-ILDV-----VLKNNEIARYRLY 939
            K +     P+IL+IHL RF      + K +  + +P+  LD+       K  E   Y L 
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLI 995

Query: 940  GIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSG 999
             + NH+G L  GHYT+     +         KWYYFDD  V    N    +  I    +G
Sbjct: 996  AVDNHYGGLGGGHYTAYCRNFI-------DGKWYYFDDSRV----NEVSPENSI----AG 1040

Query: 1000 DVYVLFYER 1008
              Y+LFY R
Sbjct: 1041 SAYLLFYRR 1049

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 784 KKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSS 820
           K  I L+ C+ L++Q E+L   ++W CP C  H+ +S
Sbjct: 899 KSSITLDSCLRLFSQPEILGSADSWYCPNCKQHTQAS 935

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 16/110 (14%)

Query: 881 SKKMTTIKTLNFITMPNILVIHLSRFFYD--LTKKNETMINYPLILDVV-----LKNNEI 933
           +K    IK    +  P  LV+HL +F ++   + K +  ++YP+ LD+       K    
Sbjct: 699 NKTTNAIKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLP 758

Query: 934 ARYRLYGIINHFG-NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
           A+Y+L  ++ H G +L SGHY       ++H  R+    W  +DDE++ K
Sbjct: 759 AKYQLLSVVVHEGRSLSSGHY-------IAH-CRQPDGTWATYDDELINK 800

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 74/176 (42%), Gaps = 48/176 (27%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINY---- 920
            PFKS+S       +++KK T I  L     P +L+I L RF F +   K+  M NY    
Sbjct: 751  PFKSSSGN----DVEAKKQTFIDKL-----PQVLLIQLKRFSFINNVNKDNAMTNYNAYN 801

Query: 921  --------------PLIL------DVVLKNNEIA----RYRLYGIINHFG-NLVSGHYTS 955
                           LI+       + LKN+       RY+L G+I H G +   GHYT+
Sbjct: 802  GRIEKIRKKIKYDHELIIPEESMSSITLKNHTSGVDDRRYKLTGVIYHHGVSSDGGHYTA 861

Query: 956  LVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSIS-SGDVYVLFYERIH 1010
             V         K   KWY  DD V   E    D  +G    S S   Y+L Y++++
Sbjct: 862  DV-------YHKEHNKWYRIDD-VNITELEDDDVLKGGEEASDSRTAYILMYQKVY 909

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 92/403 (22%), Positives = 149/403 (36%), Gaps = 108/403 (26%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMYL 647
           TGL N GN C+INS LQ L G  +F         + YLN            S+L    +L
Sbjct: 69  TGLINKGNDCFINSSLQGLAGSQRF---------NHYLN------------SVLRCLKFL 107

Query: 648 NGGCSVVPNGFLKACHMLRPDF----HIPTXXXXXXXXXXXXXXXXXXXXSEPTKVAND- 702
           N       N +    H +  +F      PT                     + ++  ND 
Sbjct: 108 NENPKQEGNRYALPLHQVMAEFIYDLQAPTFLNTVESSDKIIVTMESIFKQKMSRRQNDA 167

Query: 703 --YPNLLLHDDEKLLVDNKEYDKWFD-EGLKNNGLSPIDDIFQGQMENSLKCQRCGFTS- 758
             +  LLL       V + EY +         N L      F+G+  + L C +CG  S 
Sbjct: 168 QEFTQLLLE------VLHNEYQELIRLMNFITNNLDIPTYPFEGKYCHELTCLKCGRNSE 221

Query: 759 YNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENA-----WDCPKC 813
                F +L+L +PA P                 I+L   DEL++G N+     + C  C
Sbjct: 222 VKMFDFDILTLNLPAQPS----------------ISL---DELISGSNSDVIEGFSCTVC 262

Query: 814 ---------GTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXXXXXX 864
                    GTH+ ++   + S + +  + K N                           
Sbjct: 263 KVSAILGGTGTHNPNTRSLIKSLKEIFPELKIN-----------------------TELD 299

Query: 865 XPFKS--NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYD----------LTK 912
            P  S  +S   + +  ++ K T +K   F+ +P+IL+IHL+R  ++          +  
Sbjct: 300 EPLNSFVDSYSHDGVITRNIKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAY 359

Query: 913 KNETMINYPLILD--VVLKNNEIARYRLYGIINHFGNLVSGHY 953
             + ++ + L++D   V++NN   +Y L   I H G+   GHY
Sbjct: 360 DEKLLLEHQLVMDGVSVMRNN--IQYTLSSAIKHSGSHSMGHY 400

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 553 TPQRNDWTVQTQHLHVP-FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQ 611
           T   ++ ++ ++HLH P  +    E +P    S  I G  N GNTCY NS+LQCL+   +
Sbjct: 114 TTNSSNESLPSEHLHNPILNTERTELTPYGDGSNKIFGYENFGNTCYCNSVLQCLYNLPE 173

Query: 612 FRDLFL 617
           FR+  L
Sbjct: 174 FRNDML 179

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 56/133 (42%), Gaps = 27/133 (20%)

Query: 888  KTLNFITMPNILVIHLSRFFYDLTKKNET----MINYPLILDVVLK-NNEIAR-YRLYGI 941
            + +    +P  L +HL RF Y   + +       ++YPL L V    N  I++ Y L GI
Sbjct: 559  RVVGLKQLPKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGI 618

Query: 942  INHFGNLVS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNH------GDFDRGIT 994
            + H G     GHY SL         +  +  W  FDDE V+           GD D   T
Sbjct: 619  VVHMGGGPQHGHYISLC--------KNEKFGWLLFDDETVEAISEQAVLQYTGDKDTMTT 670

Query: 995  SISSGDVYVLFYE 1007
            +      YVLFY+
Sbjct: 671  A------YVLFYQ 677

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 48/109 (44%), Gaps = 14/109 (12%)

Query: 707 LLHDDEKLLVDNKEYDKWFDEGLKNNGLSP--IDDIFQGQMENSLKCQRCGFTSYNYSTF 764
            L    K  +++K YD    +G +N+G     + DIFQG + N +KC  C  T+     F
Sbjct: 455 FLDKQNKNALNSKIYDS--SQGRRNSGTVKNFVSDIFQGTLTNRIKCLTCDNTTARDEPF 512

Query: 765 YVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
               + +          +    I +++ +  + Q E+L G N + C +C
Sbjct: 513 LDFPIEV----------QENVDIDIQEILESFHQKEMLHGPNKFYCDEC 551

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 70/170 (41%), Gaps = 42/170 (24%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINY---- 920
            PFKS+S       +++KK T I  L     P +L+I L RF F + T K+ +M+NY    
Sbjct: 673  PFKSSS----GYDVEAKKQTFIDRL-----PQVLLIQLKRFQFINNTDKDNSMVNYNAYN 723

Query: 921  ------------------PL--ILDVVLKNNEIARYRLYGIINHFG-NLVSGHYTSLVNK 959
                              P+  I       +E  RY L G+I H G +   GHYT+ V  
Sbjct: 724  GRIEKIRKKINYEHELIIPIESISSANAYKDENRRYHLTGVIYHHGVSSDGGHYTADV-- 781

Query: 960  HLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
                   +   KWY  DD  + +         G  S  S   Y+L Y++I
Sbjct: 782  -----YHRESDKWYRIDDVSIIELEKEDVLKGGEESGDSRTAYILMYQKI 826

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 61/142 (42%), Gaps = 42/142 (29%)

Query: 886  TIKTLNFITMPNILVIHLSRFFYDLTKKNETM---INYPLILDV--VLKNNEIAR----- 935
             IK L    +P++LV+ L RF + L   N  +   I +P  L++       E  +     
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNG 404

Query: 936  ------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDF 989
                  Y L GI++H G +  GHY +        +I  GQ  W+ F+D VV         
Sbjct: 405  KVPDIIYELIGIVSHRGTVNEGHYIAFC------KISGGQ--WFKFNDSVV--------- 447

Query: 990  DRGITSISSGDV-----YVLFY 1006
                TSI+ G+V     Y+LFY
Sbjct: 448  ----TSIAQGEVLKEQAYLLFY 465

 Score = 35.4 bits (80), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 6/37 (16%)

Query: 571 SIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLF 607
           ++P +ER         ++GL NMG+TC+++S+LQCL 
Sbjct: 126 TVPIMERRD------GLSGLINMGSTCFMSSILQCLI 156

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLL---FRKM 645
           GL NMGNTCY+NS LQ L+     RD+ L  KY    N +  + +  K  S L   F  +
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVL--KYKEQANVQPGDELHYKLISELKRCFENL 167

Query: 646 YLNGGCSVVPNGFLKACHMLRPDF 669
                 SV+P  FL       P F
Sbjct: 168 QKKSYESVMPVVFLNLLRKCYPQF 191

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 936 YRLYGIINHFG-NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           Y L G+I H G N  SGHY S +         K + KWY F+D+ V
Sbjct: 427 YDLIGVITHQGANSESGHYQSFIRDE------KDENKWYKFNDDKV 466

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNP 627
           GL+N+GNTCY+N+ LQCLF     R++ L  K    ++P
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSP 148

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 60/130 (46%), Gaps = 27/130 (20%)

Query: 895  MPNILVIHLSRFFYDLTKKNETM-----INYPLILDV--VLKNNEIARYRLYGIINHFGN 947
            +P  LV+HL RF Y   +KN  +     +NYP  L++  V  ++   +Y L  I+ H G 
Sbjct: 540  LPKHLVVHLKRFKY-CEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNSIVVHIGE 598

Query: 948  LVS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSI-----SSGDV 1001
                GHY +L  KH S+        W  +DDE V+        D  ++ I      S   
Sbjct: 599  SPQLGHYVTLC-KHKSY-------GWLIYDDETVQ-----AVSDELVSRILNNEQRSATA 645

Query: 1002 YVLFYERIHS 1011
            Y+LFYE + S
Sbjct: 646  YLLFYEEVDS 655

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 583 VSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLG 618
           V   + G +N G TCY NS+LQ LF    FRD  +G
Sbjct: 101 VGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIG 136

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 52/124 (41%), Gaps = 15/124 (12%)

Query: 895  MPNILVIHLSRFFYDLTKKNE----TMINYPLILDV--VLKNNEIARYRLYGIINHFGNL 948
            +P IL +HL RF Y   + +       I YPL LDV      +   RY L G++ H G+ 
Sbjct: 557  VPYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSG 616

Query: 949  VS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYE 1007
               GHY  +         +  +  W  +DDE V+             S      YVLFY+
Sbjct: 617  PQHGHYVCIC--------KNEKFGWLLYDDETVESVSEETVLKFTGHSGDQTTAYVLFYK 668

Query: 1008 RIHS 1011
             IH+
Sbjct: 669  EIHA 672

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           + G  N GNTCY NS+LQCL+   +FR
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR 161

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 85/227 (37%), Gaps = 38/227 (16%)

Query: 741 FQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDE 800
           FQG +  +L C RC     N S   V    + ++P P+  S S K +  ++      Q E
Sbjct: 269 FQGSLATNLICLRCN----NSSKVNVHRFTMHSLPVPQMSSASLKDMMFDN------QTE 318

Query: 801 LLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXXX 860
            + G   + C  C   +            ++ ++++++ +V+ +                
Sbjct: 319 TIEG---YSCISCRLRA-----------ILNNERQRDYHNVSQEERAKLDDLAKLLPRIC 364

Query: 861 XXXXXP----FKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNET 916
                P        S   +  HI S K   +K    ++ P +L++HLSR  +D     + 
Sbjct: 365 INDDLPEPLELYVKSYHKDGCHIPSLKSRILKRTVVVSSPKVLLLHLSRSVFDGVTYTKN 424

Query: 917 MINYPLILDVVLKNNEI----------ARYRLYGIINHFGNLVSGHY 953
             N     D++L   EI           RY+L  +I H G    GHY
Sbjct: 425 SCNVLFPEDLILNEQEIKEDRCIAVHCVRYKLQAMIKHTGTHFQGHY 471

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 62/136 (45%), Gaps = 26/136 (19%)

Query: 888  KTLNFITMPNILVIHLSRFFYD--LTKKNETMINYPLILDV--VLKNNEIARYRLYGIIN 943
            KT+ F  +P  L +HL RF  D  +  K    I YPL L V     N+    Y L G++ 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 944  HFG-NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK------EFNHGDFDRGITSI 996
            H G +   GHY S+      HE    +  W  +DDE ++         + G+ +  IT+ 
Sbjct: 591  HVGASPTHGHYVSIC----KHE----KYGWLMYDDETIESIPEEAVTSHVGEPNNPITA- 641

Query: 997  SSGDVYVLFY-ERIHS 1011
                 YVLFY E+I +
Sbjct: 642  -----YVLFYSEKIQN 652

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMY 646
           + G  N G+TCY NS+LQC++   +FR   L     RY  P +S   + ++ SL  R  Y
Sbjct: 120 VFGYENFGHTCYCNSVLQCIYNLPEFRKSILQFP-QRY--PLKSRVRVEEFHSLHERN-Y 175

Query: 647 LN 648
           +N
Sbjct: 176 IN 177

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 10/77 (12%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
           + D F+G + N +KC  C   S N   F    + I          ++ + I ++D    +
Sbjct: 457 VKDQFEGVLLNRIKCLTCDCVSANEEPFLDFPIEI----------QNDEAINIQDTFRSF 506

Query: 797 TQDELLTGENAWDCPKC 813
            Q E+L G N + C +C
Sbjct: 507 YQREILCGPNKFYCNEC 523

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 57/143 (39%), Gaps = 36/143 (25%)

Query: 895  MPNILVIHLSRF-FYDLTKKNETMINYPLILDVVLKNNEIARY----------------- 936
            +P +L+I L RF F + + +   +INY      + K  +  RY                 
Sbjct: 654  LPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRKWIRYDQELTIPKEALSSVNAK 713

Query: 937  ----------RLYGIINHFG-NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFN 985
                      RL G++ H G +   GHYT+ V       + + Q KWY  DD  V +   
Sbjct: 714  FYLSGKDTTYRLTGVVYHHGLSPSGGHYTADV-------LHQTQDKWYRIDDNNVTEIRQ 766

Query: 986  HGDFDRGITSISSGDVYVLFYER 1008
               F RG  +  S   Y+L Y+R
Sbjct: 767  EDVFKRGDEASDSKTAYILIYQR 789

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 22/29 (75%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           GL+NMGNTCY+N+ LQ LF   + +DL L
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLIL 138

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 52/120 (43%), Gaps = 15/120 (12%)

Query: 895  MPNILVIHLSRFFYDLTKKNE----TMINYPLILDVVLKNNEIA--RYRLYGIINHFGNL 948
            +P IL +HL RF Y   +         I YPL L+V  K +     +Y L G++ H G  
Sbjct: 548  LPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGG 607

Query: 949  VS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYE 1007
               GHY S+         +     W +FDDE V+        +    + +S   YVLFY+
Sbjct: 608  PQHGHYVSVC--------KTDNFGWLFFDDETVETLDEPQVLNFTGDTTTSTTAYVLFYK 659

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           I G  N GNTCY NS+LQCLF  ++FR+  L
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFRNSIL 143

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 57/131 (43%), Gaps = 19/131 (14%)

Query: 888  KTLNFITMPNILVIHLSRFFYDLTKKNETMIN------YPLILDVVLKNNEIA--RYRLY 939
            +T+    +P IL +HL RF Y  ++K+++ I       YPL L V  K++ I    Y L 
Sbjct: 583  RTVGLKQLPKILSLHLKRFKY--SEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELN 640

Query: 940  GIINHFGNLVS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISS 998
            GI+ H G     GHY ++    +          W  +DDE V+       F         
Sbjct: 641  GIVIHMGGGPQHGHYVAICKHDMF--------GWLLYDDETVESIDEETVFKFVGDEKDM 692

Query: 999  GDVYVLFYERI 1009
               YVLF++ +
Sbjct: 693  TTAYVLFFKEV 703

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFR 613
           S  + GL N GNTCY NS+LQCLF  S+ R
Sbjct: 129 STKVFGLENFGNTCYCNSVLQCLFNLSELR 158

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 18/106 (16%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDV--VLKNNEIAR-----Y 936
           K + F + P +L + L RF YD        +N    +P  +D+   L++++  +     Y
Sbjct: 380 KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 937 RLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
            L+G++ H G++ +GHY +L+   L       + +WY FDDE V K
Sbjct: 440 NLHGVLVHAGDISTGHYYTLIKPGL-------EDQWYRFDDERVWK 478

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  F    FR L
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRL 230

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           GL+NMGNTCY+N+ LQ LF     RDL L
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLIL 136

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 72/174 (41%), Gaps = 48/174 (27%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINY---- 920
            PFKS+S       +++KK T I  L     P +L+I   RF F +   K+  M NY    
Sbjct: 754  PFKSSSGN----DVEAKKQTFIDKL-----PQVLLIQFKRFSFINNVNKDNAMTNYNAYN 804

Query: 921  --------------PLIL------DVVLKNNEIA----RYRLYGIINHFG-NLVSGHYTS 955
                           LI+       + LKNN       RY+L G+I H G +   GHYT+
Sbjct: 805  GRIEKIRKKIKYGHELIIPEESMSSITLKNNTSGIDDRRYKLTGVIYHHGVSSDGGHYTA 864

Query: 956  LVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSIS-SGDVYVLFYER 1008
             V  H  H       KWY  DD V   E    D  +G    S S   Y+L Y++
Sbjct: 865  DV-YHSEH------NKWYRIDD-VNITELEDDDVLKGGEEASDSRTAYILMYQK 910

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 69/169 (40%), Gaps = 42/169 (24%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINY---- 920
            PFKS+S       +++KK T I  L     P +L+I L RF F + T K+ +MINY    
Sbjct: 642  PFKSSSGN----DVEAKKQTFIDKL-----PQVLLIQLKRFQFINNTDKDNSMINYNAYN 692

Query: 921  ------------------PL--ILDVVLKNNEIARYRLYGIINHFG-NLVSGHYTSLVNK 959
                              P+  I       +E  +Y L G+I H G +   GHYT+ V  
Sbjct: 693  GRIEKIRKKINYEHELMIPIESISSTNALRDEDRQYSLSGVIYHHGLSSDGGHYTADV-- 750

Query: 960  HLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYER 1008
                   K   KWY  DD  + +         G   + S   Y+L Y++
Sbjct: 751  -----YHKETDKWYRIDDINITEVQKDSVLKGGEDGVDSRTAYILMYQK 794

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 19/105 (18%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILD--------VVLKNNEIAR 935
           K + F + P +L + L RF YD        +N    +P  +D        V+ K      
Sbjct: 436 KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           Y L+G++ H G++ +GHY +++             KWY FDDE V
Sbjct: 496 YNLHGVLVHTGDISTGHYYAMIKP-------TTDDKWYRFDDEKV 533

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  F    FRDL
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDL 286

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLG--GKYHRYLNPK 628
           G +NMGNTCY+N+ LQ LF   Q R+L L    K    LNP+
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLNPQ 150

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN 626
           TGL N+GNTCY+NS+LQ  F  S  RD  L   Y + LN
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVLN--YQKMLN 737

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 19/107 (17%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDVV-LKNNEIAR------- 935
           K + F + P +L + L RF YD        +N    +P  +D+    + E+ +       
Sbjct: 381 KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
           Y+L+G++ H G++ +GHY +++   L       + +WY FDDE V K
Sbjct: 441 YKLHGVLVHTGDISTGHYYAMIKPTL-------EDQWYRFDDEKVWK 480

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLG 618
            G RN G TCY+NS+LQ  F    FR L  G
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYG 234

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 12/78 (15%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
           +++IF G+M++ ++C+   + S     F+ + L +            K    L++    Y
Sbjct: 310 LNEIFVGKMKSYIRCKNVDYESSRVEDFWDIQLNV------------KNFKSLQESFENY 357

Query: 797 TQDELLTGENAWDCPKCG 814
            + EL+ GEN +  P  G
Sbjct: 358 IEVELMNGENQYAAPDFG 375

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 19/115 (16%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILD--------VVLKNNEIAR 935
           K + F + P++L + L RF YD        IN    +P  +D        V+ KN     
Sbjct: 379 KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFD 990
           Y L+G++ H G +  GHY +++   +         +W+ FDD+ V +      FD
Sbjct: 439 YNLHGVLVHSGEISVGHYYAMIKPDVG-------DQWFRFDDDKVWRVTKEQAFD 486

 Score = 35.8 bits (81), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDL 615
           GL+N G TCY+NS+LQ  F    FR +
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKI 229

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 576 ERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           E+   +F  L + G +NMGNTCY+N+ LQ L+  +  RD+ L
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLRDMIL 138

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 62/136 (45%), Gaps = 22/136 (16%)

Query: 888  KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDVVLKNNEIAR-------- 935
            K + F + P +L + L RF YD        +N    +P  +DV    +++          
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 936  -YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDR--G 992
             Y+L+G++ H G++ +GHY +++           + +WY FDDE V K      FD   G
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIKP-------STEDQWYRFDDEKVWKVTKTQVFDENFG 482

Query: 993  ITSISSGDVYVLFYER 1008
            +  I   +V ++  E+
Sbjct: 483  LDRIPDDEVRLMSREQ 498

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G +N G TCY+NS+LQ  F    FR L
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRL 220

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query: 554 PQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFR 613
           P +ND   Q Q L+    +  I+ S   F      G  N GNTCY NS+LQCL+  S+ R
Sbjct: 101 PMQNDIDDQMQELNN--QLGRIDSSTKVF------GFENFGNTCYCNSVLQCLYNFSELR 152

Query: 614 D 614
           D
Sbjct: 153 D 153

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 51/126 (40%), Gaps = 19/126 (15%)

Query: 895  MPNILVIHLSRFFYDLTKKNET------MINYPLILDV--VLKNNEIARYRLYGIINHFG 946
            +P IL +HL RF Y  +++N         I YP  L V      +   +Y L GII H G
Sbjct: 549  LPKILSLHLKRFKY--SEENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLG 606

Query: 947  -NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLF 1005
                 GHY ++         +  +  W  +DDE V+             S      Y+LF
Sbjct: 607  AGPQHGHYVAMC--------KTEKFGWLLYDDETVEAVLEKDVLRHVGDSNDLATAYILF 658

Query: 1006 YERIHS 1011
            Y+ I +
Sbjct: 659  YKTIET 664

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLG--GKYHRYLNPKRSNTIISK 636
           TG+ N+GNTCY+NS+LQ  F  S  R+  LG    Y  + + KR+   I +
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRR 802

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 55/130 (42%), Gaps = 17/130 (13%)

Query: 888  KTLNFITMPNILVIHLSRFFYD----LTKKNETMINYPLILDVVLKNNEIA--RYRLYGI 941
            +T+    +PN L +HL RF Y        K    I YPL L+V          +Y+L GI
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 942  INHFGNL-VSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGD 1000
            + H G+    GHY ++         +  +  W  FDDE      N  +    I    S +
Sbjct: 678  VVHMGSSPQQGHYVAIC--------KTDKYGWLLFDDETA-SWINEEEVLSFIGDEKSQN 728

Query: 1001 -VYVLFYERI 1009
              YVLFYE +
Sbjct: 729  TAYVLFYEEV 738

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           I G  N GNTCY NS+LQCL+    F+
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFK 180

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 9/79 (11%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
           I++ FQG + N +KC  C           V S   P +  P      K+   +   +  Y
Sbjct: 543 INESFQGILTNRIKCLSCD---------NVTSRDEPFLDFPIEVQEHKEFTDISTILKSY 593

Query: 797 TQDELLTGENAWDCPKCGT 815
            Q E+L G N + C +C T
Sbjct: 594 HQKEMLGGHNKFYCSQCCT 612

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 64/144 (44%), Gaps = 30/144 (20%)

Query: 880  KSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNE----TMINYPLILDV--VLKNNEI 933
            ++++M  +K L     P+IL +HL RF Y   +K+       I YPL LDV      +  
Sbjct: 544  EAERMVGLKQL-----PHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVY 598

Query: 934  ARYRLYGIINHFGNLVS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVK--KEFNHGDFD 990
             +Y L G++ H G+    GHY  +         R  +  W  +DDE V+  KE     F 
Sbjct: 599  KKYELSGVVIHMGSGPQHGHYVCIC--------RNEKFGWLLYDDETVESIKEETVLQF- 649

Query: 991  RGITSISSGD---VYVLFYERIHS 1011
                +   GD    YVLFY+   +
Sbjct: 650  ----TGHPGDQTTAYVLFYKETQA 669

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFR 613
           S  + G  N GNTCY NS+LQCL+   +FR
Sbjct: 130 SNKVFGYENFGNTCYCNSVLQCLYNIPEFR 159

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 10/114 (8%)

Query: 700 ANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSY 759
           A+++ N LL+D  + +  N    ++  +   N+  + I D+F+G + N +KC  C   + 
Sbjct: 436 AHEFLNFLLNDFSEYIQRNNPRMRFGPQKTDNSNDNFITDLFKGTLTNRIKCLTCDNITS 495

Query: 760 NYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
               F  L   I      +T         ++  +  Y Q E+L G N + C KC
Sbjct: 496 RDEPF--LDFPIEVQGDEET--------DIQKMLKSYHQREMLNGVNKFYCNKC 539

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 25/111 (22%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDV-------VLK------- 929
           K + F + P +L + L RF YD        +N    +P  +D+       VLK       
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 930 NNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           N     Y L+G++ H G++ +GHY +L+   +       + +WY FDDE V
Sbjct: 442 NGNPYIYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 485

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  F    FR L
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 19/115 (16%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDVV-------LKNNEIAR- 935
           K + F + P +L + L RF YD        +N    +P  +D+        L+ N   + 
Sbjct: 380 KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFD 990
           Y+L+G++ H G++ +GHY +L+      E       WY FDD+ V +      FD
Sbjct: 440 YKLHGVLVHTGDISTGHYYTLIKPSTKDE-------WYRFDDDRVWRATKKQIFD 487

 Score = 35.8 bits (81), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  +    FR L
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRL 230

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 54/128 (42%), Gaps = 27/128 (21%)

Query: 895  MPNILVIHLSRFFY----DLTKKNETMINYPLILD--VVLKNNEIARYRLYGIINHFGNL 948
            +P+ L +HL RF Y    +   K    I+YPL LD      ++   +Y L GI+ H G  
Sbjct: 568  LPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMGGG 627

Query: 949  VS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNH------GDFDRGITSISSGDV 1001
               GHY SL         +     W  FDDE V+           GD D   T+      
Sbjct: 628  PQHGHYVSLC--------KNDNFGWLLFDDETVEAVHESTVSKFIGDRDSLTTA------ 673

Query: 1002 YVLFYERI 1009
            YVLFY+ I
Sbjct: 674  YVLFYKEI 681

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           + G  N GNTCY NS+LQCL+  ++FR L L
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 65/137 (47%), Gaps = 25/137 (18%)

Query: 888  KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDV-------VLKNNEI-AR 935
            K + F + P +L + L RF YD        IN    +P  +D+       V +++   A+
Sbjct: 367  KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAK 426

Query: 936  YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDE----VVKKEFNHGDFDR 991
            Y L+G++ H G++ +GHY +++   L       +  WY FDD+    V KK+    +F  
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGL-------EDAWYRFDDDKVWRVTKKQVFEQNF-- 477

Query: 992  GITSISSGDVYVLFYER 1008
            G   +S  D+  L  E+
Sbjct: 478  GFDKLSEYDLRSLTKEQ 494

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            GL+N G TCY+NS+LQ  +    FR L
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKL 217

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 38/86 (44%), Gaps = 9/86 (10%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNP-----KRSNTIISKWFSLLFR 643
           G +NMGNTCY+N+ LQ L+     RD+ L    +    P     K+    + + F  L  
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMILDYNQNSTTTPVDETHKKIVVEMKRCFENLKS 169

Query: 644 KMYLNGGCSVVPNGFLKACHMLRPDF 669
           K Y     SV+P   L A     P F
Sbjct: 170 KSYK----SVMPMVLLTALRKCYPQF 191

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 52/138 (37%), Gaps = 17/138 (12%)

Query: 532 VPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLR 591
           V + + +P   L     KE R  +  D   Q QHL                 S +  GL+
Sbjct: 21  VIMVLGTPDANLVTKPQKERRFIEDLDEGAQMQHL-----------------SQTPVGLK 63

Query: 592 NMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMYLNGGC 651
           N+GNTCY+NS LQ L+     RD  L  K  R    +  +  +       F+++      
Sbjct: 64  NLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSEEQHHQLVSELRRCFQQLKDKPQE 123

Query: 652 SVVPNGFLKACHMLRPDF 669
           SV P   L       P F
Sbjct: 124 SVTPMLLLAMLRKCYPQF 141

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 34/133 (25%)

Query: 887  IKTLNFITMPNILVIHLSRFFYDLTKKN---ETMINYPLILDV-----VLKNNEIARYRL 938
            IK L    +P +LV+ L RF +    +N      I +P  L++       +NN    Y L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 939  YGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISS 998
             G+I+H G +  GHY +         ++     W+ F+D +V             TSIS 
Sbjct: 383  NGVISHIGTVNEGHYIA--------TLKLDSNNWFKFNDSMV-------------TSISE 421

Query: 999  GDV-----YVLFY 1006
             +V     Y+LFY
Sbjct: 422  EEVLKDQAYLLFY 434

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 57/123 (46%), Gaps = 27/123 (21%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDV-------VLK-NNEIAR 935
           K + F + P +L + L RF YD        IN    +P  +D+       V K   E   
Sbjct: 376 KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDD----EVVKK---EFNHGD 988
           Y L+G++ H G++ +GHY +++   L         KWY FDD    +V KK   E N G 
Sbjct: 436 YNLHGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDDKVWQVTKKQVFEQNFG- 487

Query: 989 FDR 991
           FDR
Sbjct: 488 FDR 490

 Score = 36.2 bits (82), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 586 SITGLRNMGNTCYINSMLQCLFGCSQFRDL 615
              GL+N G TCY+NS+LQ  +    FR L
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKL 226

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 576 ERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           E+   +F  L + G +NMGNTCY+N+ LQ L+  +  R++ L
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLREMIL 138

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 14/114 (12%)

Query: 700 ANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSY 759
           A+++ N LL++    L D  + D   D     +  + I+D+F+G + NS KC  C   + 
Sbjct: 403 AHEFLNYLLNE----LSDTLKRDMELDTDKLESKPTFIEDLFKGSLCNSTKCFTCDTITA 458

Query: 760 NYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
               F    + I          +  + I+++D +N Y   ELLTG N + C KC
Sbjct: 459 RDEPFLDFPIEI----------QEDEEIKIQDILNNYKHRELLTGANKFYCDKC 502

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           S  + G  N GNTCY NS+LQCL+  ++FR   L
Sbjct: 111 STKVFGYENFGNTCYCNSVLQCLYNLTEFRTEIL 144

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 13/80 (16%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSN--TIISKWFSLLFRKM 645
           TG+ N+GNTCY+NS+LQ  F  S  R+  +  +Y + +    SN  +IISK      R++
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLREYIV--QYQKTIADLSSNPDSIISK------RRI 773

Query: 646 YLNGGCSVVPNGFLKACHML 665
              GG  V  N   ++   L
Sbjct: 774 ---GGRQVGKNEIERSVQFL 790

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 10/87 (11%)

Query: 883 KMTTIKTLNFITMPNILVIHLSRFFYDLT--KKNETMINYP---LILDVVLKNNEIA--- 934
           K T +K    +  P +L++HLSR  ++     KN   + +P   +I + +L+NN+     
Sbjct: 375 KSTIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVR 434

Query: 935 --RYRLYGIINHFGNLVSGHYTSLVNK 959
             RY+L  +I H G    GHY    +K
Sbjct: 435 AVRYKLCAMIKHIGTHSQGHYACFRHK 461

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 21/30 (70%)

Query: 584 SLSITGLRNMGNTCYINSMLQCLFGCSQFR 613
           S  + G  N GNTCY NS+LQCL+  S+FR
Sbjct: 122 SNKVFGYENFGNTCYCNSVLQCLYNISEFR 151

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 51/123 (41%), Gaps = 15/123 (12%)

Query: 895  MPNILVIHLSRFFYDLTKKNE----TMINYPLILDV--VLKNNEIARYRLYGIINHFGNL 948
            +P IL +HL RF Y   +++       I YPL LDV     ++   +Y L G++ H G+ 
Sbjct: 546  LPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSG 605

Query: 949  VS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYE 1007
               GHY  +         +  +  W  +DDE V+                    YVLFY+
Sbjct: 606  PQHGHYVCIC--------KNEKFGWLLYDDETVESIREETVLKFTGHPGDQTTAYVLFYK 657

Query: 1008 RIH 1010
              H
Sbjct: 658  ETH 660

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 26/112 (23%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDV-------VLK----NNE 932
           K + F + P +L + L RF YD        +N    +P  +D+       VLK    + +
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 933 IAR----YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
            +R    Y L+G++ H G++ +GHY +L+   +       + +WY FDDE V
Sbjct: 442 KSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 486

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  F    FR L
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 63/156 (40%), Gaps = 38/156 (24%)

Query: 879  IKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINY----------------- 920
            +++KK T I  L     P +L+I L RF F   + K+  M NY                 
Sbjct: 772  VEAKKQTFIDKL-----PRVLLIQLKRFAFVTNSNKDSNMSNYNAYSGRIEKIRKKIIYG 826

Query: 921  -----PL--ILDVVLKNNEIARYRLYGIINHFGNLV-SGHYTSLVNKHLSHEIRKGQQKW 972
                 P+  +    L+++    Y+L G+I H G+    GHYT+ V         +   KW
Sbjct: 827  HDLTIPIESVSSTSLRDDANREYKLTGVIYHHGSSPDGGHYTADV-------FHQQTNKW 879

Query: 973  YYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYER 1008
            Y  DD  + +  N    D     + +   Y+L YE+
Sbjct: 880  YRIDDVNISELKNDHVLDADDNDMGTRTAYILIYEK 915

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 6/54 (11%)

Query: 571 SIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRY 624
           SIPT+ ++        + GL NMG+TCY++S+LQCL     F DL + G ++ Y
Sbjct: 126 SIPTLTQAH------GLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNY 173

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 46/117 (39%), Gaps = 30/117 (25%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTK---KNETMINYPLILDV------------------ 926
           + L+ + +  I+VI L RF + +T    K    + +PL L++                  
Sbjct: 353 RQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNE 412

Query: 927 -VLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
              K+     Y L GI+ H G +  GHY +          +     WY F+D VV K
Sbjct: 413 KTNKSTPDMIYELTGIVTHRGTVNEGHYITYT--------KTADGVWYQFNDSVVMK 461

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 576 ERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           E+   +F    + G +NMGNTCY+N+ LQ L+     RD+ L
Sbjct: 98  EQQVQQFAETPV-GFKNMGNTCYLNATLQALYRVDDLRDMIL 138

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 63/142 (44%), Gaps = 36/142 (25%)

Query: 888  KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDV-------VLKNNEIAR- 935
            K + F + P +L + L RF YD        +N    +P  +D+       VLK    +  
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 936  -------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDE----VVKKEF 984
                   Y L+G++ H G++ +GHY +L+   +       + +WY FDDE    V KK+ 
Sbjct: 442  KDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERVWRVTKKQV 494

Query: 985  NHGDF------DRGITSISSGD 1000
               +F      D  + +++ G+
Sbjct: 495  FQENFGCDRLPDEKVRTMTRGE 516

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  F    FR L
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 20/27 (74%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRD 614
           TGL N+GNTCY+NS+LQ  F  S  RD
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 63/142 (44%), Gaps = 42/142 (29%)

Query: 886  TIKTLNFITMPNILVIHLSRFFYDLTKKNETM---INYPLILDVVL--------KNNEIA 934
             IK L    +P++LV+ L RF + L   N  +   I +P  L++          K++E  
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENG 404

Query: 935  R-----YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDF 989
            +     Y L GI++H G +  GHY +        +I  GQ  W+ F+D +V         
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGGQ--WFKFNDSMV--------- 447

Query: 990  DRGITSISSGDV-----YVLFY 1006
                +SIS  +V     Y+LFY
Sbjct: 448  ----SSISQEEVLKEQAYLLFY 465

 Score = 35.8 bits (81), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 25/35 (71%), Gaps = 6/35 (17%)

Query: 572 IPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCL 606
           +P++ER         ++GL NMG+TC+++S+LQCL
Sbjct: 127 VPSMERRD------GLSGLINMGSTCFMSSILQCL 155

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 62/142 (43%), Gaps = 42/142 (29%)

Query: 886  TIKTLNFITMPNILVIHLSRFFYDLTKKNETM---INYPLILDVV-----------LKNN 931
             IK L    +P++LV+ L RF + L   N  +   I +P  L++            + N 
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNK 404

Query: 932  EIAR--YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDF 989
            ++    Y L GI++H G +  GHY +        +I  GQ  W+ F+D +V         
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGGQ--WFKFNDSMV--------- 447

Query: 990  DRGITSISSGDV-----YVLFY 1006
                +SIS  +V     Y+LFY
Sbjct: 448  ----SSISQEEVLKEQAYLLFY 465

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 6/35 (17%)

Query: 572 IPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCL 606
           +P +ER         ++GL NMG+TC+++S+LQCL
Sbjct: 127 VPIMERRD------GLSGLINMGSTCFMSSILQCL 155

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 586 SITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           S  G +NMGNTCY+N+ LQ L+     RD+ L
Sbjct: 107 SPVGFKNMGNTCYLNATLQALYRVDDVRDMIL 138

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGK 620
           G +NMGNTCY+NS LQ LF     +D+ L  K
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 8/73 (10%)

Query: 936  YRLYGIINHFG-NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGIT 994
            Y L GII H G N  SGHY S +           + KWY F+D+ V  E+     ++   
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDE------NDEDKWYKFNDDKV-SEYEKDKIEQLAG 488

Query: 995  SISSGDVYVLFYE 1007
               S    +L Y+
Sbjct: 489  GGESDSALILIYK 501

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 19/105 (18%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILD--------VVLKNNEIAR 935
           K + F + P +L + L RF YD        IN    +P  +D        +   N +   
Sbjct: 383 KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           Y L+G++ H G++ +GHY +++   +       + +WY FDD+ V
Sbjct: 443 YDLHGVLVHTGDISTGHYYTMIKPSI-------EDQWYRFDDDKV 480

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G +N G TCY+NS+LQ  F    FR L
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKL 233

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 62/144 (43%), Gaps = 44/144 (30%)

Query: 886  TIKTLNFITMPNILVIHLSRFFYDLTKKNETM---INYPLILDVV-------------LK 929
             IK L    +P++LV+ L RF + L   N  +   I +P  L++              + 
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIG 404

Query: 930  NNEIAR--YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHG 987
            N ++    Y L GI++H G +  GHY +        +I  GQ  W+ F+D +V       
Sbjct: 405  NGKVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGGQ--WFKFNDSMV------- 449

Query: 988  DFDRGITSISSGDV-----YVLFY 1006
                  +SIS  +V     Y+LFY
Sbjct: 450  ------SSISQEEVLKEQAYLLFY 467

 Score = 35.0 bits (79), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 6/35 (17%)

Query: 572 IPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCL 606
           +P +ER         ++GL NMG+TC+++S+LQCL
Sbjct: 127 VPAMERRD------GLSGLINMGSTCFMSSILQCL 155

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDVV-LKNNEIAR------- 935
           K + F + P +L + L RF YD        +N    +P  +D+    + ++ R       
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 936 -------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
                  Y L+G++ H G++ +GHY +L+   +       + +WY FDDE V
Sbjct: 442 KDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 486

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDL 615
            G RN G TCY+NS+LQ  F    FR L
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 17/101 (16%)

Query: 892 FITMPNILVIHLSRFFYD-----LTKKNETM-----INYPLILDVVLKNNEIARYRLYGI 941
           F + P +L + L RF YD     L K N+       I+    LD     +  A Y L+G+
Sbjct: 377 FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGV 436

Query: 942 INHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKK 982
           + H G++ +GHY +++              WY FDD+ V K
Sbjct: 437 LVHSGDISTGHYYAMIQP-------DAHGSWYRFDDDRVIK 470

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 20/105 (19%)

Query: 887 IKTLNFITMPNILVIHLSRFFYDL----TKKNETMINYPLILDVV-LKNNEIAR------ 935
           IK +    +P +LV+ L RF + +     K NE  I YP  L++    +   +R      
Sbjct: 335 IKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEK-IAYPTYLNMAPFCHQSESRPVPDMM 393

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           Y L  +I+H G++  GHYTS+       +I  GQ  W+ F+D ++
Sbjct: 394 YELVAVISHEGSVNQGHYTSMC------KIPGGQ--WFRFNDSMI 430

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 574 TIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           T E+   +F  + I G +NMGNTCY+N+ LQ L+     RD  L
Sbjct: 94  TPEQQVQQFNDIPI-GFKNMGNTCYLNATLQALYRIDDLRDAVL 136

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 21/29 (72%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLF 616
           TG+ N+GNTCY+NS+LQ  F  + FR+  
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFREFI 786

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           G +NMGNTCY+NS LQ L+     R+L L
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELIL 137

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 76/200 (38%), Gaps = 49/200 (24%)

Query: 588 TGLRNMGNTCYINSMLQCLF--GCSQFRDLFLGGKYH-RYLNPKRSNTIISKWFSLLFR- 643
            GL N+GN+CY+NS++Q L   G   +   FLG ++    + P  +N +  +W  LL   
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVVYP--ANNLKCQWIKLLNAM 380

Query: 644 ----KMYLNGGCSVVPNGFLKACHMLRPDFHIPTXXXXXXXXXXXXXXXXXXXXSEPTKV 699
               K+Y NG   + P  F K       +F                        S   + 
Sbjct: 381 KHEPKLYANG---IKPTTFKKCIGKNHEEF-----------------------SSNRQQD 414

Query: 700 ANDYPNLLLHD-DEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTS 758
           A ++   LL   D     DN              G S  +D+ +  ME+ L+C +CG   
Sbjct: 415 AMEFLTFLLDSLDRNFFSDNSA------------GASNPNDLMRFMMEDRLQCNKCGKVK 462

Query: 759 YNYSTFYVLSLAIPAMPPPK 778
           Y+Y     + L +     P+
Sbjct: 463 YSYEPAEAIQLPLKENDEPQ 482

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 16/102 (15%)

Query: 887 IKTLNFITMPNILVIHLSRFFYDLTKKNETM---INYPLILDV--VLKNNEIAR---YRL 938
           IK L    +   LV+ L RF +  + +N  +   + +PL LD+       E      YRL
Sbjct: 339 IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 939 YGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
            G+++H G +  GHYT+++      ++  G+  W+ F+D ++
Sbjct: 399 SGVVSHSGTVNEGHYTAVL------QLNSGE--WFKFNDSMI 432

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 19/31 (61%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           I G  N GNTCY NS+LQC F  S FR   L
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSML 156

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 59/274 (21%), Positives = 89/274 (32%), Gaps = 82/274 (29%)

Query: 737  IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
            + DIFQG + N ++C  C   +     F  L  AI          +  + + ++  +  +
Sbjct: 431  VQDIFQGSLTNQIRCYTCDSITSTEEPF--LDFAIEV--------KEDENLNIQRHLESF 480

Query: 797  TQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXX 856
             Q ELL G + + C +C        G   ++  V  K+    LS++              
Sbjct: 481  HQRELLNGSDKFYCDRCC-------GLQEAERLVGLKRLPKTLSLH-------------- 519

Query: 857  XXXXXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNET 916
                              ++      KM  IK  N I  P  L +  S F   L+K    
Sbjct: 520  -----------------LKRFKYSEDKMANIKLFNKIDYPTFLTVS-STFDSKLSK---- 557

Query: 917  MINYPLILDVVLKNNEIARYRLYGIINHFGNLVS-GHYTSLVNKHLSHEIRKGQQKWYYF 975
                              RY L   + H G+    GHY SL         +     W  F
Sbjct: 558  ------------------RYELASAVIHLGDGPQYGHYISLC--------KTETFGWLLF 591

Query: 976  DDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
            DDE V+            T  +S   YVLFY  +
Sbjct: 592  DDETVEAVDEQTVL--SFTGENSDTAYVLFYNEV 623

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           + G  N GNTCY NS+LQCL+  ++FR
Sbjct: 145 VFGYENFGNTCYCNSVLQCLYNLTEFR 171

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 55/129 (42%), Gaps = 27/129 (20%)

Query: 895  MPNILVIHLSRFFYDLTKKNE----TMINYPLILDV--VLKNNEIARYRLYGI-INHFGN 947
            +P+IL +HL RF Y  T+         I YPL L V     ++   RY L GI ++  G 
Sbjct: 558  LPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGIVVHMGGG 617

Query: 948  LVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDV------ 1001
               GHY SL         +  +  W  FDDE V+        D        GD+      
Sbjct: 618  PHHGHYVSLC--------KNEKFGWLLFDDETVES------VDESSVMKFCGDLHDLTTA 663

Query: 1002 YVLFYERIH 1010
            YVLFY+ I+
Sbjct: 664  YVLFYKEIN 672

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCS-------QFRDLFLGGKYHRYLNPKR 629
            GL N+GNTCY+NS+LQ  F  S        F D+ L G+  + L  +R
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLINFNDIELDGREMKNLEKRR 810

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
            YER151C (REAL)
          Length = 910

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 70/174 (40%), Gaps = 48/174 (27%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINY---- 920
            PFKS+S       +++KK T I  L     P +L+I   RF F +   K+  M NY    
Sbjct: 752  PFKSSSGN----DVEAKKQTFIDKL-----PQVLLIQFKRFSFINNVNKDNAMTNYNAYN 802

Query: 921  --------------PLIL------DVVLKNNEIAR----YRLYGIINHFG-NLVSGHYTS 955
                           LI+       + LKN+        Y+L G+I H G     GHYT+
Sbjct: 803  GRIEKIRKKIKYDHELIIPEESMSSITLKNHTSGADDRIYKLTGVIYHHGVGSDGGHYTA 862

Query: 956  LVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSIS-SGDVYVLFYER 1008
             V  H  H       KWY  DD V   E    D  +G    S S   Y+L Y++
Sbjct: 863  DV-YHSEH------NKWYRIDD-VNITELEDDDVLKGGEEASDSRTAYILMYQK 908

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 21/29 (72%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           GL+NMGNTCY+N+ LQ L+  +  R+  L
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAIL 133

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 20/27 (74%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRD 614
           TGL N+GNTCY+NS+LQ  F  S  RD
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 18/27 (66%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           I G  N GNTCY NS+LQCLF    FR
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFR 147

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 9/77 (11%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
           I D FQG + N +KC  C   + N   F    + +             + + ++D +N Y
Sbjct: 422 ILDQFQGTLTNQIKCLTCDTLTSNNEPFLDFPIEV---------KNDDEDLNIQDILNKY 472

Query: 797 TQDELLTGENAWDCPKC 813
            Q E+L G N + C +C
Sbjct: 473 HQREILNGTNKFYCNQC 489

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 56/130 (43%), Gaps = 31/130 (23%)

Query: 895  MPNILVIHLSRFFYDLTKKNETM-----INYPLILDVVLKNNEI--ARYRLYGI-INHFG 946
            +P+ L +HL RF Y L +KN        I YPLIL V    N+    +Y L  I ++  G
Sbjct: 504  LPHTLALHLKRFKY-LEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISIVVHLGG 562

Query: 947  NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNH-------GDFDRGITSISSG 999
                GHY S+         +  +  W  FDDE V +  N        GD +   T+    
Sbjct: 563  GPHHGHYVSIC--------KSDKFGWLLFDDETV-ESINEETVLKFVGDPEDQTTA---- 609

Query: 1000 DVYVLFYERI 1009
              YVLFY  I
Sbjct: 610  --YVLFYREI 617

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 16/63 (25%)

Query: 550 ELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSIT-----GLRNMGNTCYINSMLQ 604
           EL+  Q  +W  Q             + S +E V L+ +     GL NMGN+CY+NS+LQ
Sbjct: 288 ELQVEQNMNWDFQM-----------TDESGHELVKLNPSKEVGCGLINMGNSCYLNSVLQ 336

Query: 605 CLF 607
           CLF
Sbjct: 337 CLF 339

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 9/46 (19%)

Query: 936 YRLYGIINHFGNLV-SGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           Y+LYGI+ H GN   SGHY + + +      R GQ  W  ++DE +
Sbjct: 707 YKLYGIVCHKGNSTQSGHYVAYIRQ------RDGQ--WTLYNDEKI 744

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLG 618
           GLRNMGNTCY N+ LQ L+     R+  L 
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLA 136

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           TGL N+GNTCY+NS+LQ  F  S  R   L
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 36/135 (26%)

Query: 887  IKTLNFITMPNILVIHLSRFFYDLTKKNETM---INYPLILDVV-LKNNEIAR------Y 936
            IK +    +P +LV+ L RF + +   N  +   I YP  L++    ++  AR      Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 937  RLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSI 996
             L  +I+  G++  GHYT +       ++  GQ  W+ F+D +             I SI
Sbjct: 394  ELVAVISQEGSVNQGHYTCMC------KVPGGQ--WFRFNDTM-------------IVSI 432

Query: 997  SSGDV-----YVLFY 1006
            +  DV     Y+LFY
Sbjct: 433  TEEDVLRQQAYLLFY 447

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 883 KMTTIKTLNFITMPNILVIHLSRFFYD--LTKKNETMINYPLILDVV------LKNNEI- 933
           + + +K   F+  P+I VIHLSR  Y+     +N   +++   LD          +NE  
Sbjct: 322 RRSILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFT 381

Query: 934 --ARYRLYGIINHFGNLVSGHYTSLVNK 959
              RYRL  I+ H G+  SGHY  L  K
Sbjct: 382 KRVRYRLKSIVIHTGSHYSGHYQVLRRK 409

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN 626
           TG+ N+GNTCY+NS+LQ  F  +  R   L   Y + LN
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN--YQKTLN 772

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
            GL N+GNTCY+NS+LQ  F     RD  L
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 15/94 (15%)

Query: 895 MPNILVIHLSRFFYDLTKKNE----TMINYPLILDV--VLKNNEIARYRLYGIINHFGNL 948
           +P IL +HL RF Y   +K+       I YPL LDV      +   +Y L G++ H G+ 
Sbjct: 552 LPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSG 611

Query: 949 VS-GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVK 981
              GHY  +         +  +  W  +DDE V+
Sbjct: 612 PQHGHYVCIC--------KNEKFGWLLYDDETVE 637

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           + G  N GNTCY NS+LQCL+   +FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 883 KMTTIKTLNFITMPNILVIHLSRFFYDLTK--KNETMINYPLILDV---VLKNNEI---- 933
           K T +K    +  P +L+IHLSR  ++ T   +N   +N+  IL +   V++N+      
Sbjct: 457 KSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGIN 516

Query: 934 -ARYRLYGIINHFGNLVSGHY 953
              Y L  I+ H G+   GHY
Sbjct: 517 SVNYELKAIVKHAGSHSQGHY 537

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLG 618
           TG+ N+GNTCY+NS+LQ  F  S  R+  L 
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 14/89 (15%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNT--------IISKWFSL 640
           G+ NMGNTCY+N+ LQ L+G    R+  L        + K++           + +    
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILA------FDDKKATAEGMDLYHVQLIREIQA 114

Query: 641 LFRKMYLNGGCSVVPNGFLKACHMLRPDF 669
            FRK+    G ++ P   L+    + P F
Sbjct: 115 TFRKLRDKKGEAITPMLLLEILRRVFPQF 143

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 16/132 (12%)

Query: 875 EKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMIN-----------YPLI 923
           +KLHI   K   IK    + +P+ILV+HLSR  ++         N           Y L 
Sbjct: 319 DKLHISKVKGKIIKKDVAVQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLA 378

Query: 924 LDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIR--KGQQKWYYFDDEVVK 981
            +  +  N   +Y L  ++ H G+   GHY     K    +IR  KG++        +V 
Sbjct: 379 ENRAITENRQVKYNLKSVVKHTGSHSRGHYICYRRK---ADIRFDKGEESSLEGASTIVN 435

Query: 982 KEFNHGDFDRGI 993
            E    + D+ I
Sbjct: 436 NEAKTRNHDQKI 447

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 5/44 (11%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNT 632
           G +NMGNTCY+N+ LQ L+     R + L      Y  P +S+T
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILD-----YKPPAQSST 150

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 19/115 (16%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTKKNETMIN----YPLILDVV------LKNN--EIAR 935
           K + F + P +L + L RF YD        IN    +P  +D+       +K+N      
Sbjct: 379 KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCI 438

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFD 990
           Y L+ ++ H G++ +GHY +++  +++        +W+ FDD+ V K      FD
Sbjct: 439 YNLHCVLVHSGDISAGHYYAMIKPNVT-------DQWFRFDDDKVWKVTKTQAFD 486

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDL 615
           G +N G TCY+NS+LQ  F    FR +
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKM 229

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           + GL N GNTCY NS+LQCL+   + R
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 38.5 bits (88), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 10/77 (12%)

Query: 737 IDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLY 796
           I  +FQG M NS+KC  C   + N   F+    AIP            + + ++D +  +
Sbjct: 464 IHTLFQGTMNNSIKCLTCDNITSNEEPFF--DFAIPV--------SEDEELNVQDILRDF 513

Query: 797 TQDELLTGENAWDCPKC 813
            Q E+L G N + C  C
Sbjct: 514 HQREMLNGANKFYCDSC 530

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
            G+ N+GNTCY+NS+LQ  F     RD  L
Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFIL 727

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 38.9 bits (89), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 15/102 (14%)

Query: 886 TIKTLNFITMPNILVIHLSRFFYDL---TKKNETMINYPLILDV--VLKNNEIAR--YRL 938
            IK L    +P +LV+ L RF + L   + K   ++ +PL L++      +++    + L
Sbjct: 348 AIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFEL 407

Query: 939 YGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
            GII H G +  GHY +       H        W+ F+D +V
Sbjct: 408 IGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMV 441

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 13/60 (21%)

Query: 547 IAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCL 606
           IA  +     +D   +TQ       IP +ER         + GL NMG+TC+++S++QCL
Sbjct: 109 IAASMLNKYWDDVVTKTQ-------IPKLERRD------GLQGLLNMGSTCFMSSIVQCL 155

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 17/86 (19%)

Query: 532 VPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLR 591
           V + + +P   L     KE R  +  D + Q QHL     +P               GL+
Sbjct: 67  VVMVLGTPDANLVSKPQKEHRFIEDLDESAQMQHLS---QLPV--------------GLK 109

Query: 592 NMGNTCYINSMLQCLFGCSQFRDLFL 617
           N+GNTCY+NS LQ L+     R+  L
Sbjct: 110 NLGNTCYMNSTLQALYQIRPLREEIL 135

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 39.3 bits (90), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           G  N GNTCY NS+LQCL+  +  R   L
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNIL 545

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
           UBP16Deubiquitinating enzyme anchored to the outer
           mitochondrial membrane, probably not important for
           general mitochondrial functioning, but may perform a
           more specialized function at mitochondria
          Length = 499

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 51/121 (42%), Gaps = 15/121 (12%)

Query: 877 LHIKSKKMTTIKTLNFITMPNILVIHLSR-FFYDLTKKNE----------TMINYPLILD 925
           L + + K   IK    + +P+IL++HLSR  F  +T              T+  Y L   
Sbjct: 321 LQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAES 380

Query: 926 VVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDE-VVKKEF 984
             +  N   +Y L  ++ H G+  SGHY     K    EIR G++    F    VV  E 
Sbjct: 381 GTITENRQVKYNLKSVVKHTGSHSSGHYMCYRRK---TEIRFGKEDESSFRRAPVVNNEV 437

Query: 985 N 985
           N
Sbjct: 438 N 438

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 38.9 bits (89), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 71/175 (40%), Gaps = 51/175 (29%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILD 925
            PFKS+S       +++KK T I  L     P +L+I L RF +      + ++NY     
Sbjct: 618  PFKSSSGN----DVEAKKQTFIDKL-----PQVLLIQLKRFSFINNTDKDKIVNYNAYSG 668

Query: 926  VVLK-------NNEI-------------------ARYRLYGIINHFG-NLVSGHYTSLVN 958
             V K       N+E+                    +Y+L G++ H G +   GHYT+ V 
Sbjct: 669  RVEKIRKKIHYNHELTIPKETISSVHSNFYDDAGTKYKLVGVVYHHGVSPSGGHYTADV- 727

Query: 959  KHLSHEIRKGQQKWYYFDD----EVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
                    +   KW+  DD    E+ K+E   G    G     S   Y+L Y++I
Sbjct: 728  ------YHQEMDKWFRIDDVNIAELNKEEVLKG----GEDGFDSRTAYILMYQKI 772

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 9/91 (9%)

Query: 528 NRPPVPLPINSPAPLLK------PSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNE 581
           ++P V L   SP P LK      PS  K L         +     ++ ++I  +  + N 
Sbjct: 270 SKPKVSL---SPTPQLKKDKKYVPSTIKSLEPLGVVALRMCLDQDYIKYTIENVPNAGNA 326

Query: 582 FVSLSITGLRNMGNTCYINSMLQCLFGCSQF 612
             S+   G+ N GN C+++S+LQ L  C  F
Sbjct: 327 IDSIVPRGIVNTGNICFMSSVLQVLLYCKPF 357

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGK 620
           GL N+GNTCY+NS+LQ  F  +  R+  L  K
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           TGL N+GNTCY+NS+LQ  F  S  R   +
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFR 613
           TGL N+GNTCY+NS+LQ  F  S  R
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 38.5 bits (88), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           TGL N+GNTCY+NS+LQ  F  +  R   L
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 38.5 bits (88), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN 626
           TG+ N+GNTCY+NS+LQ  F  +  R   L  +Y + L+
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLD 772

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 38.5 bits (88), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 90/227 (39%), Gaps = 37/227 (16%)

Query: 741 FQGQMENSLKCQRCGFTSY-NYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQD 799
           F+G + N L C +CG TS+ N   FY+  L +P           +  ++L D +N    +
Sbjct: 191 FKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLP----------QQGSVKLSDLVN---GE 237

Query: 800 ELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHXXXXXXXXXXXXXX 859
           ++ T EN + C  C T +  ++         ++++K N    + +               
Sbjct: 238 QMETIEN-YSCMYCKTVAMLTN---------EREEKSNVSRTDAELNILKFLKGKLSTLL 287

Query: 860 XXXXXXPFKS---NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLT--KKN 914
                    +   NS      +    K   ++   F   P I +IHLSR  ++     +N
Sbjct: 288 INEELPEHITHYINSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLIHLSRSVFNGMNYSRN 347

Query: 915 ETMINYP---LILDVVLKNN-----EIARYRLYGIINHFGNLVSGHY 953
              + +    L+   +LK++     E  +Y+L  I+ H G+   GHY
Sbjct: 348 PCQVEFEEEILLPRQILKDHQCVGFETVKYKLKSIVKHTGSHYQGHY 394

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 38.1 bits (87), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRS--NTIISKWFSLLFRKMY 646
           G+ N+GNTCY+N+ LQ LF     R+  L     R +       +  + +   + F+K+ 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEGVDTYHAQLVRELKVTFQKLK 162

Query: 647 LNGGCSVVPNGFLKACHMLRPDF 669
              G ++ P   L+    + P F
Sbjct: 163 DRKGENITPLLLLEILRRVFPQF 185

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 8/46 (17%)

Query: 936 YRLYGIINHFG-NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           Y L G+I H G N  SGHY + +            +KWY FDD+ V
Sbjct: 415 YDLIGVITHQGANSESGHYQAFIRDD-------ADEKWYRFDDDKV 453

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 18/104 (17%)

Query: 887 IKTLNFITMPNILVIHLSRFFYDLTKKNETM---INYPLIL---DVVLKNNEIAR----Y 936
           IK      +P +LV+ L RF + +   N  +   + YPL L   D   +N         Y
Sbjct: 347 IKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIY 406

Query: 937 RLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
            L GI++H G++  GHY  ++      +I  G  +W+ F+D ++
Sbjct: 407 ELTGILSHIGSINEGHYVVVL------KINDG--RWFKFNDSMI 442

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 18/20 (90%)

Query: 588 TGLRNMGNTCYINSMLQCLF 607
            GL N+GN+CY+NS+LQCLF
Sbjct: 323 CGLINLGNSCYLNSVLQCLF 342

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           TG+ N+GNTCY+NS+LQ  F  +  R   L
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
           TG+ N+GNTCY+NS+LQ  F  +  R   L
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 48/91 (52%), Gaps = 12/91 (13%)

Query: 875 EKLHIKSK--KMTTIKTLNFITMPNILVIHLSRFFYDLT--KKNETMINYPLILDV---V 927
           EK  IK+   K T +K    +  P++L++HLSR  +D    +KN   +++   L V   V
Sbjct: 425 EKGGIKTSEIKSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQV 484

Query: 928 LKNNEIA-----RYRLYGIINHFGNLVSGHY 953
           ++NN+        Y+L  ++ H G+  +GHY
Sbjct: 485 IENNKCVGIRKDSYKLRSMLRHQGSHSTGHY 515

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 17/19 (89%)

Query: 589 GLRNMGNTCYINSMLQCLF 607
           GL N+GN+CY+NS LQCLF
Sbjct: 332 GLINLGNSCYLNSTLQCLF 350

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 14/91 (15%)

Query: 729 LKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIR 788
            KN+  +P +D+ +  ME+ L+CQ C    Y+  T  V+ L +           S     
Sbjct: 439 FKNSDYNP-NDLMKFMMEDRLQCQECHGVKYSTETSNVIQLPL---------QESNDAQD 488

Query: 789 LEDCINLYTQDELLTGENAWDCPKCGTHSNS 819
           LE+ IN Y   E++     + CP C    N+
Sbjct: 489 LEERINAYFSGEVI----EFKCPNCKKMVNA 515

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRD 614
            GL N+GNTCY+NS+LQ  F  S  R+
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 588 TGLRNMGNTCYINSMLQCLF 607
            GL N+GN+CYINS+LQCL 
Sbjct: 322 CGLINLGNSCYINSVLQCLL 341

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 88/228 (38%), Gaps = 39/228 (17%)

Query: 741 FQGQMENSLKCQRCGFTSY-NYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQD 799
           F+G++ + L C  CG TS  N STF +L      +  P+ +S       LE+ I     D
Sbjct: 209 FEGKLASYLSCLNCGQTSIPNISTFNIL-----PIQTPQEYSA-----ELEEIIYGNQID 258

Query: 800 ELLTGENAWDCPKCGTHSNSSDGSMNSDE--TVDKKKKKNFLS-VNGDHXXXXXXXXXXX 856
           ++      + C  C T++   +   N  +  T D+ +   +L  V               
Sbjct: 259 QI----TDYSCLVCQTNAILKNEKTNGHKGNTTDEHEIVKYLEDVLPVLRINEELDSKTL 314

Query: 857 XXXXXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYD--LTKKN 914
                      KS ++K           T IK  + I  P IL+IHLSR  Y+  +  +N
Sbjct: 315 NYIKYYNKYGMKSGNIKS----------TIIKKNSIIETPKILMIHLSRSIYNGMVAVRN 364

Query: 915 ETMINYPLILDVVLKNN---------EIARYRLYGIINHFGNLVSGHY 953
              + +   + +  +           E+  Y+L  II H G   SGHY
Sbjct: 365 SCRVRFEEKMSIERQTTDEKNENLKIELVDYQLQSIIKHTGTHNSGHY 412

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 883 KMTTIKTLNFITMPNILVIHLSRFFYDLT--KKNETMINYPLILDV---VLKNNEIA--- 934
           K T +K    +  P  LV+HLSR  +D    ++N   + +  IL+    V+++N+     
Sbjct: 420 KSTIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGIN 479

Query: 935 --RYRLYGIINHFGNLVSGHY 953
              Y+L  I+ H G+   GHY
Sbjct: 480 PISYKLKAIVAHSGSHSQGHY 500

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617
            G+ N+GNTCY+NS+LQ  F  +  R+  L
Sbjct: 713 AGINNIGNTCYLNSLLQYYFSIAPLRNYVL 742

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 10/75 (13%)

Query: 936  YRLYGIINHFG-NLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGIT 994
            Y+L G++ H G +   GHYT+ V       + + ++KWY  DD  V  E N  +   G  
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADV-------LHQDEEKWYRIDDTTV-TEINKEEVVTGGE 818

Query: 995  SIS-SGDVYVLFYER 1008
              S S   Y+L Y+R
Sbjct: 819  EGSHSRTAYILIYQR 833

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 589 GLRNMGNTCYINSMLQCLFGCSQFRD 614
           GL N+GNTCY+NS+LQ  F  +  R+
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRN 751

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 2/32 (6%)

Query: 588 TGLRNMGNTCYINSMLQCLFG--CSQFRDLFL 617
            GL N+GN+CY+NS+LQ LF    SQ+ D+ +
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLM 350

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 16/63 (25%)

Query: 550 ELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSIT-----GLRNMGNTCYINSMLQ 604
           EL+  Q  +W  +            ++   NE + L  +     G  N+GN+CY+NS+LQ
Sbjct: 301 ELQVEQNMNWNFKM-----------VDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQ 349

Query: 605 CLF 607
           CLF
Sbjct: 350 CLF 352

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 18/100 (18%)

Query: 575 IERSPNEFVSLSIT-----GLRNMGNTCYINSMLQCLF--GCSQFRDLFLGGKYH-RYLN 626
           ++ S  EF  LS +     GL N+GN+CY+NS++Q L   G   +   FLG K+    + 
Sbjct: 305 VDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVY 364

Query: 627 PKRSNTIISKWFSLLFR-----KMYLNGGCSVVPNGFLKA 661
           P   N +  +W  LL       ++Y NG   + P  F K 
Sbjct: 365 P--DNNLKCQWIKLLNAMKCEPELYPNG---IKPTTFKKC 399

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 36.2 bits (82), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 10/85 (11%)

Query: 729 LKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIR 788
           + +N L+ +D +F+G + N  KC  C   +Y    F  L  AI      +T         
Sbjct: 436 MDDNHLNFVDRLFKGTLTNRTKCLTCDNMTYRNEPF--LDFAIEVQDDGET--------D 485

Query: 789 LEDCINLYTQDELLTGENAWDCPKC 813
           ++  +  Y Q ELL G N + C +C
Sbjct: 486 IQTTLADYHQKELLNGANKFYCDEC 510

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           + G  N GNTCY NS+LQ ++   + R
Sbjct: 142 VFGYENFGNTCYCNSVLQVIYNLPELR 168

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 10/94 (10%)

Query: 870 NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTK--KNETMINYPLIL--- 924
           N+ K +     S K   +K       P IL++HLSR  ++ T   +N   +N+   L   
Sbjct: 419 NNYKKDGCETSSIKSRIVKKTVVTESPEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQ 478

Query: 925 DVVLKNNEIA-----RYRLYGIINHFGNLVSGHY 953
           +  ++NN        +Y+L  ++ H G    GHY
Sbjct: 479 EQTIENNRCVGVKPIKYKLKSMVKHQGTHSQGHY 512

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,
           250 aa]
          Length = 249

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 931 NEIARYRLYGIINHFGNLV-SGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           NE  +Y+L  ++ H GN V SGHY + + K + +      ++W  ++DE +
Sbjct: 182 NEPGKYKLTSVVCHKGNSVQSGHYVAFIKKEIEN-----VERWVLYNDEKI 227

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 19/106 (17%)

Query: 886 TIKTLNFITMPNILVIHLSRFFYDLTK---KNETMINYPLILDV----VLKNNEIAR--- 935
            IK L+   +P++LV+ L RF + L     K    I YP  L++       ++++     
Sbjct: 342 AIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDL 401

Query: 936 -YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
            Y L G++ H G +  GHY +          +   ++W+ F+D +V
Sbjct: 402 IYELIGVVAHKGTVNEGHYVATT--------KVAGRQWFKFNDSMV 439

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 35.4 bits (80), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 16/63 (25%)

Query: 550 ELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSI-----TGLRNMGNTCYINSMLQ 604
           EL+  Q  +W  Q            ++    E  SL        GL N+GN+CY+NS+LQ
Sbjct: 294 ELQVEQNMNWNFQM-----------VDSEGKELKSLKAGDDFGVGLINLGNSCYLNSILQ 342

Query: 605 CLF 607
           C +
Sbjct: 343 CFY 345

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
            YPL072W
          Length = 498

 Score = 35.0 bits (79), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 110/290 (37%), Gaps = 48/290 (16%)

Query: 741  FQGQMENSLKCQRCG-FTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQD 799
            F+G   N L C +C  ++   +S F +L +A+P     K          L D I L++QD
Sbjct: 201  FEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVPGNYSEK----------LTDLI-LHSQD 249

Query: 800  ELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVN------GDHXXXXXXXX 853
            E++ G +   C       N    +   + + +++   NFL          D         
Sbjct: 250  EIIEGYSCLYCKVNMILKNEKYLNQLPEYSQEEQSILNFLRNQILTLYINDDLPADVSFY 309

Query: 854  XXXXXXXXXXXXPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYD--LT 911
                         FKSN +K   +               I  P  L++HLSR  ++    
Sbjct: 310  VDHYSKNGCVTANFKSNIIKKNAV---------------IKEPASLIVHLSRSIFNGATI 354

Query: 912  KKNETMINYP--------LILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSH 963
             ++   + Y         ++++   +  E  +Y L  ++ H G+ V GHY     K    
Sbjct: 355  TRSACRVEYEQSLNLQRQVMINDAFERTEPIKYELKSVVKHTGSHVQGHYQCYRKK---P 411

Query: 964  EIRKGQQKWYYFDDEVVKKEFNHGDFDRG-ITSISSGDVYVLFYERIHSI 1012
            ++ K +      +   + K+++   FD   I SI +G    L Y+RI S+
Sbjct: 412  DLMKERNTDTIVNRSPMIKKYSQDKFDASKIESIITGTSKRL-YKRIKSL 460

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQF 612
           + GL N GNTC++NS+LQCL    + 
Sbjct: 83  VGGLVNDGNTCFMNSVLQCLASSKEL 108

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 21/106 (19%)

Query: 888 KTLNFITMPNILVIHLSRFFYDLTK---KNETMINYPLIL------DVVLKNNEIAR--- 935
           K L    +  +L+    RF + L+    K   +I +PL L      DV  +++  ++   
Sbjct: 345 KQLAVAKLSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDL 404

Query: 936 -YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
            Y L GII H G +  GHYT++       +I +GQ  W  F+D +V
Sbjct: 405 IYELIGIICHTGTVNEGHYTAIC------KIPEGQ--WIKFNDSMV 442

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 18/21 (85%)

Query: 586 SITGLRNMGNTCYINSMLQCL 606
            ++GL NMG+TCY++ ++QCL
Sbjct: 135 GLSGLVNMGSTCYVSCIIQCL 155

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 33/81 (40%), Gaps = 10/81 (12%)

Query: 883 KMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEI--------- 933
           K T +K    +  P +L+IHLSR  ++         N     D+ L+   I         
Sbjct: 440 KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 934 -ARYRLYGIINHFGNLVSGHY 953
             +YRL   + H G   +GHY
Sbjct: 500 NVKYRLRATVRHQGTHSAGHY 520

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 16/63 (25%)

Query: 550 ELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSIT-----GLRNMGNTCYINSMLQ 604
           EL+  Q  +W  Q            ++   NE   L  +     GL N+GN+CY+NS+LQ
Sbjct: 281 ELQVEQNMNWDFQM-----------VDSKGNELKHLPASKEYGCGLNNLGNSCYMNSVLQ 329

Query: 605 CLF 607
            LF
Sbjct: 330 VLF 332

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRS 630
           I GL N GNTC++NS+LQ L    +  D         Y + +RS
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTYEDIERS 143

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 589 GLRNMGNTCYINSMLQCLF 607
           GL N+GN+CY+NS++QCL 
Sbjct: 343 GLINLGNSCYLNSVMQCLL 361

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 16/117 (13%)

Query: 700 ANDYPNLLLHDDEKLLVDNKEYDKWFDEGL--KNNG-LSPIDDIFQGQMENSLKCQRCGF 756
           A+++ N LL++    L  + E      +GL  KN G ++ ++ +FQG + N  KC  C  
Sbjct: 405 AHEFLNFLLNEVSDYLGAHSE---QIAQGLDVKNPGDINFVNRLFQGTLTNRTKCLTCDN 461

Query: 757 TSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKC 813
           T+Y    F  L  AI      +T         ++  +  + Q ELL G N + C  C
Sbjct: 462 TTYRNEPF--LDFAIEVQQDSET--------DIQTTLADFHQKELLNGANKFYCDVC 508

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFR 613
           + G  N GNTCY NS+LQ L+   + R
Sbjct: 142 VFGYENFGNTCYCNSVLQVLYNLPELR 168

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 48/113 (42%), Gaps = 27/113 (23%)

Query: 887 IKTLNFITMPNILVIHLSRFFYDL---TKKNETMINYPLILDVVL----KNNEIAR---- 935
           IK L    +  +LV  L RF + L   T K    I YPL L++       NN+       
Sbjct: 365 IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 936 --------YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
                   Y L  II+H G +  GHY  +V      ++  GQ  W+ F+D +V
Sbjct: 425 SENVPDMIYELTSIISHKGTVNEGHYIVVV------KVNDGQ--WFKFNDSMV 469

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 560 TVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRD-LF-- 616
           T+  Q  ++P  I  I+    EF +    GL N G TCY N+ +Q +      +  LF  
Sbjct: 380 TIADQGSNLPSRI--IKNWGPEFANRKPKGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDI 437

Query: 617 LGGKYHRYLNPKRSNTIISK 636
           L GKY   ++PK  + ++++
Sbjct: 438 LRGKYKETISPKSVSVMLAE 457

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 19/105 (18%)

Query: 887 IKTLNFITMPNILVIHLSRFFYDL---TKKNETMINYPLILDV--------VLKNNEIAR 935
           I+ L    +P +L++ L RF + +   + K    I++PL L++         L       
Sbjct: 349 IRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHPVPNMM 408

Query: 936 YRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980
           Y+L  II+H G +  GHYT++         R     W  F+D +V
Sbjct: 409 YKLSAIISHHGTVHQGHYTTIC--------RINGDIWAKFNDSMV 445

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 587 ITGLRNMGNTCYINSMLQCLFGCSQFRDLF 616
           I GL N GNTC++NS+LQ L    +  D  
Sbjct: 127 IAGLLNDGNTCFMNSVLQSLASSKELMDFL 156

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
            (UBP3) - Ubiquitin-specific protease [contig 231] PARTIAL
          Length = 444

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 66/171 (38%), Gaps = 43/171 (25%)

Query: 866  PFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILD 925
            PFK++S      +++++K T I  L     P + +I L RF +        ++NY     
Sbjct: 290  PFKTSSGN----NVEAQKQTFIDKL-----PEVFLIQLKRFSFINNTDKSKVVNYNAYSG 340

Query: 926  VVLKNNEIAR--------------------------YRLYGIINHFGNLVSG-HYTSLVN 958
             V K  +  R                          Y+L G++ H G   SG HYT  V 
Sbjct: 341  RVEKIRKKIRFGSELTIPSSAISSVHANFYKESGSTYKLIGVVYHHGVSSSGGHYTCDV- 399

Query: 959  KHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009
                   ++ Q+KW+  DD  V++         G     S   Y+L Y+++
Sbjct: 400  ------YQEAQKKWFRIDDINVQEIEMEEVLQPGEEGSDSRTAYILIYQKL 444

>CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa]
           {ON} highly similar to uniprot|P12688 Saccharomyces
           cerevisiae YKL126w Serine/threonine-protein kinase
          Length = 703

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 305 ISTGLARHQQENTIDCFALFSL-----LKDAESRENLLLIDLRLPKRFESNHLVAPNLLN 359
           + +G+A    + +++  A+        L ++ S ENLL  D+       +  L  PN + 
Sbjct: 171 LESGIASDNHDTSLEVEAILQRISRLELTNSNSNENLLPGDIATQSIPSTIKL--PNSVP 228

Query: 360 IDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYD 396
           ++P L F  E   ++ + E     +A PI +KIS +D
Sbjct: 229 LNPLLYFTIEFDNTVATIEPESGTMAQPIFNKISTFD 265

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 11/81 (13%)

Query: 588 TGLRNMGNTCYINSMLQCLF--GCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFR-- 643
            GL N+GN+CY+NS+LQ L   G   +   FLG ++   +    SN +  +W  LL    
Sbjct: 323 CGLINLGNSCYLNSVLQSLLNGGVPNWSLDFLGSEFPLDVVYPASN-LKCQWIKLLNAMK 381

Query: 644 ---KMYLNGGCSVVPNGFLKA 661
              ++Y NG   + P  F K 
Sbjct: 382 CEPEIYPNG---IKPTTFKKC 399

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 7/54 (12%)

Query: 575 IERSPNEFVSLSIT-----GLRNMGNTCYINSMLQCLF--GCSQFRDLFLGGKY 621
           ++ S  EF  LS +     GL N+GN+CY+NS++Q L   G   +   FLG ++
Sbjct: 305 VDSSGKEFEKLSPSKDYGCGLINLGNSCYLNSVMQSLLNGGIPNWSLDFLGSEF 358

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 18/91 (19%)

Query: 919  NYPLI-LDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDD 977
            N+PL  L  ++ NN+   Y L  I+ H+G+   GHY S          R+ + +W+   D
Sbjct: 411  NFPLKELGHIIGNNKCV-YSLKSIVVHYGSHDYGHYISY---------RRFEDQWWRISD 460

Query: 978  EVVKKEFNHGDFDRGITSISSGDVYVLFYER 1008
            E V K       D      +SG ++++FYE+
Sbjct: 461  ESVLK------VDEDEVFSASG-IFIVFYEQ 484

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%)

Query: 588 TGLRNMGNTCYINSMLQCLF 607
            GL N+GN+CY+NS+LQ LF
Sbjct: 322 CGLINLGNSCYMNSVLQLLF 341

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
           (REAL)
          Length = 523

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 61/140 (43%), Gaps = 20/140 (14%)

Query: 875 EKLHIKSKKMTTIKTLNFITMPNILVIHLSR-FFYDLT-KKNETMINYPLILDVV----L 928
           +KL   + K T IK    + +P +LVIHLSR  F  +T  +N   + +   + +     +
Sbjct: 339 DKLRTSNVKSTVIKKDIAVQLPEVLVIHLSRSTFNGMTYTRNPCNVEFEETIKLAEYTSI 398

Query: 929 KNNEIARYR-----LYGIINHFGNLVSGHYTSLVNKH----LSHEIRKGQQKWYYFDDEV 979
           +    A YR     L  ++ H G+   GHY    +K      S +    Q      D++V
Sbjct: 399 EKGPSAEYRQIEYHLKSVVKHTGSHSRGHYVCYRSKGDILLDSEDGSYVQSASIIIDNDV 458

Query: 980 VKKEFNHGDFDRGITSISSG 999
             K  NH      ITS+++G
Sbjct: 459 EAKNHNH-----AITSMNNG 473

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 589 GLRNMGNTCYINSMLQCLF 607
           GL+N+GN+CY+NS+LQ L 
Sbjct: 310 GLQNLGNSCYLNSVLQVLL 328

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%)

Query: 588 TGLRNMGNTCYINSMLQCLF 607
            GL N+GN+CY+N++LQ LF
Sbjct: 309 CGLLNLGNSCYMNAVLQVLF 328

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 71  SFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLH 116
           S +  +I+P  V    RNKSY IY+ L+ L +D  N S    +V H
Sbjct: 107 SCFFDVIVPQIVLDEVRNKSYPIYTRLRTLCRDSENNSTKRFIVFH 152

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 11/95 (11%)

Query: 870 NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMIN---------- 919
           N    +K  I + K   IK    + +P +LVIHLSR  ++    +    N          
Sbjct: 322 NHYTKDKFCISNVKGKVIKRDIAVKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLT 381

Query: 920 -YPLILDVVLKNNEIARYRLYGIINHFGNLVSGHY 953
            Y  I ++ L  N    Y L  ++ H G+   GHY
Sbjct: 382 EYTSIENMKLTENRQIVYNLKSVVKHTGSHSRGHY 416

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%)

Query: 588 TGLRNMGNTCYINSMLQCLF 607
            GL N+GN+CY+NS++Q LF
Sbjct: 318 CGLINLGNSCYLNSVVQVLF 337

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 6/36 (16%)

Query: 571 SIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCL 606
           S P+ +R         ++GL NMG+TCY++ ++QCL
Sbjct: 126 SFPSYDRKD------GLSGLVNMGSTCYMSCIIQCL 155

>NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {ON} 
          Length = 706

 Score = 32.7 bits (73), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%)

Query: 338 LIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYD 396
           LID +L   +    ++ P    ++P L F  E   ++ + E    +++NPI +KIS +D
Sbjct: 211 LIDGKLATNYIPATVMLPASTKLNPLLYFTIEFDNTVATIEPEYGLMSNPIFNKISTFD 269

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 32.0 bits (71), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 10/94 (10%)

Query: 870 NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTK--KNETMINYPLIL--- 924
           N+ K +     + K T +K       P+IL++HLSR  ++     +N   + +   L   
Sbjct: 421 NNYKKDGCDTSTLKSTIVKKTVVTESPDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQ 480

Query: 925 DVVLKNNEIA-----RYRLYGIINHFGNLVSGHY 953
           +  ++NN        +Y+L  ++ H G    GHY
Sbjct: 481 EQEIENNRCVGVKPIKYKLKAMVKHEGTHSQGHY 514

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 32.0 bits (71), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 735 SPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSL 769
           S I DIF G ++  + C+ CG TS     FY LSL
Sbjct: 466 SIIYDIFGGLLKQIVTCKSCGSTSKTEQPFYDLSL 500

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 110,221,437
Number of extensions: 4990487
Number of successful extensions: 16544
Number of sequences better than 10.0: 266
Number of HSP's gapped: 16524
Number of HSP's successfully gapped: 523
Length of query: 1012
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 892
Effective length of database: 39,721,479
Effective search space: 35431559268
Effective search space used: 35431559268
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)