Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L019708.853ON93293248100.0
YMR287C (DSS1)8.853ON96996920580.0
Suva_13.4778.853ON96996320470.0
KNAG0E011408.853ON92993820420.0
Smik_13.5038.853ON96996920210.0
Skud_13.4608.853ON96997020010.0
TDEL0B002208.853ON93594219250.0
ZYRO0C14938g8.853ON96695019220.0
SAKL0D01078g8.853ON93696018940.0
CAGL0M07051g8.853ON92389618780.0
NCAS0C003008.853ON94094318450.0
KLTH0C03674g8.853ON94890417010.0
Kwal_27.102138.853ON93690716380.0
NDAI0K003208.853ON96290116330.0
TPHA0I003508.853ON94389915330.0
Kpol_237.48.853ON91680115050.0
KLLA0C06314g8.853ON98391914161e-180
AFR448W8.853ON81781713441e-172
TBLA0B029208.853ON10294499891e-117
Smik_13.3622.349ON1660100830.44
KLTH0E04378g7.203ON43757791.0
NCAS0A137307.282ON14228741.1
Kpol_257.12.490ON874129762.3
YBR165W (UBS1)8.596ON27780742.8
ZYRO0D01848g7.503ON65459743.6
NDAI0C040505.307ON1260118735.4
KLTH0F12584g7.127ON44199726.1
Kpol_1023.505.307ON1253175736.1
TPHA0J004906.40ON43589718.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L01970
         (932 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...  1857   0.0  
YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...   797   0.0  
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...   793   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   791   0.0  
Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...   783   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...   775   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   746   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   744   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   734   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   728   0.0  
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   715   0.0  
KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...   659   0.0  
Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...   635   0.0  
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   633   0.0  
TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...   595   0.0  
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   584   0.0  
KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...   550   e-180
AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...   522   e-172
TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...   385   e-117
Smik_13.362 Chr13 complement(562717..567699) [4983 bp, 1660 aa] ...    37   0.44 
KLTH0E04378g Chr5 (396019..397332) [1314 bp, 437 aa] {ON} some s...    35   1.0  
NCAS0A13730 Chr1 (2698652..2699080) [429 bp, 142 aa] {ON} Anc_7....    33   1.1  
Kpol_257.1 s257 complement(1..2622) [2622 bp, 874 aa] {ON} compl...    34   2.3  
YBR165W Chr2 (568852..569685) [834 bp, 277 aa] {ON}  UBS1Ubiquit...    33   2.8  
ZYRO0D01848g Chr4 complement(148657..150621) [1965 bp, 654 aa] {...    33   3.6  
NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {...    33   5.4  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...    32   6.1  
Kpol_1023.50 s1023 (111088..114849) [3762 bp, 1253 aa] {ON} (111...    33   6.1  
TPHA0J00490 Chr10 (109600..110907) [1308 bp, 435 aa] {ON} Anc_6....    32   8.0  

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score = 1857 bits (4810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 899/932 (96%), Positives = 899/932 (96%)

Query: 1   MNVLCATRRLHSSRLSFRALQKQRRSRTKNKNENPSFGTTPXXXXXXXXXXXXXXSRTSG 60
           MNVLCATRRLHSSRLSFRALQKQRRSRTKNKNENPSFGTTP              SRTSG
Sbjct: 1   MNVLCATRRLHSSRLSFRALQKQRRSRTKNKNENPSFGTTPLKKEEIKLINKLFLSRTSG 60

Query: 61  LEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGMERFSKNLINGAKP 120
           LEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGMERFSKNLINGAKP
Sbjct: 61  LEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGMERFSKNLINGAKP 120

Query: 121 NFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNL 180
           NFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNL
Sbjct: 121 NFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNL 180

Query: 181 LFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQHITSLK 240
           LFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQHITSLK
Sbjct: 181 LFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQHITSLK 240

Query: 241 PFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDMSSCNDRKYMKT 300
           PFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDMSSCNDRKYMKT
Sbjct: 241 PFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDMSSCNDRKYMKT 300

Query: 301 LIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNPLKAYQHF 360
           LIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNPLKAYQHF
Sbjct: 301 LIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNPLKAYQHF 360

Query: 361 NDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLI 420
           NDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLI
Sbjct: 361 NDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLI 420

Query: 421 SAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNIXXXXXXXXXXXXXXXXXXXKQLYA 480
           SAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNI                   KQLYA
Sbjct: 421 SAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNILLFNHDLNLSNSSNLGQSNKQLYA 480

Query: 481 LCGPQISADADRVDFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIADPSILFSG 540
           LCGPQISADADRVDFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIADPSILFSG
Sbjct: 481 LCGPQISADADRVDFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIADPSILFSG 540

Query: 541 ASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVK 600
           ASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVK
Sbjct: 541 ASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVK 600

Query: 601 TLPDETLHVLYDTFDIKLSKIRNFPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARAL 660
           TLPDETLHVLYDTFDIKLSKIRNFPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARAL
Sbjct: 601 TLPDETLHVLYDTFDIKLSKIRNFPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARAL 660

Query: 661 RNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLC 720
           RNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLC
Sbjct: 661 RNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLC 720

Query: 721 GWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYT 780
           GWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYT
Sbjct: 721 GWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYT 780

Query: 781 SKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRA 840
           SKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRA
Sbjct: 781 SKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRA 840

Query: 841 DILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKL 900
           DILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKL
Sbjct: 841 DILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKL 900

Query: 901 KKGMPYPVIGDTVTNCRIVKLESLDGILYLEA 932
           KKGMPYPVIGDTVTNCRIVKLESLDGILYLEA
Sbjct: 901 KKGMPYPVIGDTVTNCRIVKLESLDGILYLEA 932

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
           DSS13'-5' exoribonuclease, component of the
           mitochondrial degradosome along with the ATP-dependent
           RNA helicase Suv3p; the degradosome associates with the
           ribosome and mediates turnover of aberrant or
           unprocessed RNAs
          Length = 969

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/969 (43%), Positives = 602/969 (62%), Gaps = 46/969 (4%)

Query: 1   MNVLCATRRLHSSRLSFRALQKQRRSRTKNKNENP-SFGTTPXXXXXXXXXXXXXXS--- 56
           ++VL   R  HS    FR   + +R R+K+K +       T               S   
Sbjct: 7   VHVLLIARSFHSYTPCFRVTTRGKRQRSKSKQQAKVELDHTRELDNDQATETVVDRSVGP 66

Query: 57  -------------RTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTK 103
                        RT GLEPD+E+K+L  I++++N+RY  R + PS+ WY + W+  +  
Sbjct: 67  EKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSWRSLTKP 126

Query: 104 ILGMERFSKN---LINGAK-PNFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMC 159
            + + +   +   LI   K PN       + F   +L+ESPL VGD VLLK    EL+MC
Sbjct: 127 KIPLYKLINSDFQLITKLKAPN------PMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180

Query: 160 VALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIK 219
           V+LP S  DPRYTF TI G + F+T++ + LRIP+ +P GI +LI  E  H   PIG +K
Sbjct: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK 240

Query: 220 SSINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQ 279
           +  N+T ILP V RQ ITS  P  +S +AW++LP+T KKL++LHR LQN +G +QIPFF 
Sbjct: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 280 LVHLVDTIDMSSCNDRK----YMKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWG 335
           LV LV  +D++   D K    Y+ +L++N    +   +++   +STYWAI++QQE+N+WG
Sbjct: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360

Query: 336 DIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKY 395
           +I  N+  +SPISVT+ PLK+   +   ++   +     ++ +  +L+NE+ Y  I   Y
Sbjct: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420

Query: 396 PEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDN 455
           P  + +LKD+A+GN + N  +  LIS   RK+  YKD D+++ +C  L+ EI P     N
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSI-PN 479

Query: 456 IXXXXXXXXXXXXXXXXXXXKQLYALCG------PQISADADRVDFGNLRVYCIDSETAH 509
                               ++LY L         +   D DR DFG+LRV+CIDSETAH
Sbjct: 480 PLLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAH 539

Query: 510 EIDDGISIINKG-NGIYSLSIHIADPSILFSGAS--EIQGPLNDDVFKLAMEKSFTTYLP 566
           EIDDG+S+ N G +G+Y+L IHIADP+ +F  ++  +I+G ++ D+  +A+++SFTTYLP
Sbjct: 540 EIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEG-ISTDILNVALKRSFTTYLP 598

Query: 567 DIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKT---LPDETLHVLYDTFDIKLSKIRN 623
           D V P+LP +    +DLGK GQ T  ++F+V+VK       +++ ++YD+F I+   + N
Sbjct: 599 DTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSN 658

Query: 624 FPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIE 683
           FPK TY  V++IL + +     VK+DLE L  I++ LR  R+KN  AV+FGEGFNKG++ 
Sbjct: 659 FPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVM 718

Query: 684 FFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGS 743
              + + E+  V F DQEET +T+LVSE+MIL NTL G +F +N I G++R Y +L LG 
Sbjct: 719 LNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGE 778

Query: 744 KATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRR 803
            A  +Y S+ +STK G+ P +KD+ ++SSL+NSS YT +P  HEMIGA+QYLTVTSPLRR
Sbjct: 779 VAQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRR 838

Query: 804 FPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAI 863
           FPDL+NH QIHR L+K P  FN  ++ +LIW IQSRADILK+ SR  +TYWTL YL+K  
Sbjct: 839 FPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLT 898

Query: 864 FENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLK-KGMPYPVIGDTVTNCRIVKLE 922
              P + FDVM+TSVP NG   C+FPD+SFARG LKL    M YP+IGD V NC+I K++
Sbjct: 899 KLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKID 958

Query: 923 SLDGILYLE 931
            L+G+L LE
Sbjct: 959 CLEGMLELE 967

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/963 (43%), Positives = 597/963 (61%), Gaps = 38/963 (3%)

Query: 3   VLCATRRLHSSRLSFRALQKQRRSRTKN-KNENPSFGTTPXXXXXXXXXXXXXX------ 55
            L   R  H+ R  FR   +  R R+KN + E   F  T                     
Sbjct: 9   ALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAITRPVENEK 68

Query: 56  ----------SRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRST-KI 104
                      R  GLEPD+E+K+L  I++++ +RY  R + PS+ WY + W+  +  KI
Sbjct: 69  EIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTKPKI 128

Query: 105 LGMERFSKNLINGAKPNFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPE 164
              +  + ++    K   +K+ E   F   +L+++PL VGD+VLLKS   EL+MCV+LP 
Sbjct: 129 PSYKLINLDIHFDTKLESSKQME---FQPAQLMKNPLNVGDLVLLKSRPNELAMCVSLPS 185

Query: 165 SADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINE 224
           S  DPRYTFA+I G++ F+T++ + LRIP  +P GI +L+  E  H   PIG +K+  N+
Sbjct: 186 STMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVKNFSNQ 245

Query: 225 TFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLV 284
           T ILP V RQ ITS  P  +S +AW+ LP+T KKL++LHR LQN +G +QIPFF LV LV
Sbjct: 246 TSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLV 305

Query: 285 DTIDMSSCNDRK----YMKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQRN 340
             +D++   D K    Y+  L+++ K+     ++++  +STYWAI++QQE+N+WG I  N
Sbjct: 306 QKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWGKIHLN 365

Query: 341 SCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMS 400
           +  +SP SVT+ PLK+   +   ++   +  +   I +  +L+NE+ Y  I   YP  + 
Sbjct: 366 TALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLYPSVIQ 425

Query: 401 MLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNIXXXX 460
           +LKD+A+GN + N  +  LIS   RK+  YK  D+++ +C  L+ EI P +  + +    
Sbjct: 426 LLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINPLLLNM 485

Query: 461 XXXXXXXXXXXXXXXKQLYALCGPQ------ISADADRVDFGNLRVYCIDSETAHEIDDG 514
                          K LY L   +       + + DR DFG+L+V+CIDSETAHEIDDG
Sbjct: 486 DLALPASSKLGQSQQK-LYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDDG 544

Query: 515 ISIIN-KGNGIYSLSIHIADPSILFSGASEIQGP-LNDDVFKLAMEKSFTTYLPDIVEPL 572
           +SI N K +G+Y+L IHIADP+ LF  +++I+   +  DV  +A+++SFTTYLPD+V P+
Sbjct: 545 VSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPM 604

Query: 573 LPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDET---LHVLYDTFDIKLSKIRNFPKVTY 629
           LP +  + +DLGK GQ T  ++F+V+VK LP  T   + ++Y++  I+   + NFPK TY
Sbjct: 605 LPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKATY 664

Query: 630 SRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQ 689
           + V++IL  +D   P  K+DLE L  I++ LR  R+K   AV+FGEGFN+G++      +
Sbjct: 665 NDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKE 724

Query: 690 AEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEY 749
            E+  V F DQ ETP+T+LVSE+MIL NTL G FF +N I G++R Y +L L + A  +Y
Sbjct: 725 GELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIAQQQY 784

Query: 750 MSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLN 809
            SL +S K GV P ++D+T++SSL+NSS YT +P  HEMIGA QYLTVTSPLRRFPDL+N
Sbjct: 785 NSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLIN 844

Query: 810 HFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNK 869
           H QIHR L+K P  F+  ++  LIW IQSRADILK  SR  +TYWTL YL+  +  NP K
Sbjct: 845 HLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEK 904

Query: 870 RFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMP-YPVIGDTVTNCRIVKLESLDGIL 928
            +DVMITSVP NG   C+FPD+SFARG LKL      YP+IGDTV  C+I+K++ L+GIL
Sbjct: 905 TYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGIL 964

Query: 929 YLE 931
            LE
Sbjct: 965 ELE 967

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
           Anc_8.853 YMR287C
          Length = 929

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/938 (43%), Positives = 590/938 (62%), Gaps = 20/938 (2%)

Query: 1   MNVLCATRRLHSSRLSFRAL--QKQRRSRTKNKNENPSFGTTPXX---XXXXXXXXXXXX 55
           M+   A R LH+  + +R +    +R  +++ K  + S   TP                 
Sbjct: 1   MSQWLARRSLHTGGVQWRKVLPGNKRWRKSREKVVSSSDARTPTKNLDAVDIERINEMFL 60

Query: 56  SRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGMERFSKNLI 115
           SRT  LEP +EIK+L  I+K++N R+ +R   PSK+W++ +W    +     +  S+N +
Sbjct: 61  SRTKDLEPGMEIKKLKQIKKEFNTRFAERYFNPSKQWFQDNWVVEPSTNTAGKSSSQNSM 120

Query: 116 NGAKPNFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFAT 175
            G       +N+  TF   E + S L++GD+VL      EL+MCV LPESA+DPRYTF T
Sbjct: 121 TG-------KNKHYTFKLSEFISSVLQMGDLVLTTPYPNELAMCVGLPESAEDPRYTFVT 173

Query: 176 IKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQH 235
           + G + F T+S ++LRIPY +P  +  LI++E PH F P+G IK + + T+ILP + RQ 
Sbjct: 174 VSGKMFFGTKSFVHLRIPYRLPEKVRYLISKEGPHAFEPVGTIKGTRDVTYILPYLARQL 233

Query: 236 ITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTID-MSSCND 294
           +TS  P  ++ +AW++LP  IK+LE+L R+L+   G +Q+PF QLV  V  ++      +
Sbjct: 234 VTSELPSQINKLAWQKLPSIIKRLELLSRYLRKYNGTWQVPFVQLVDAVQRLEEKGGPGE 293

Query: 295 RKYMKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNPL 354
            +Y+K+L +     S  ++ A+  L+TYWAI EQQ  N+WG I  N   ++PIS +V P 
Sbjct: 294 FEYIKSLFERPSLGSRRSIHAATYLATYWAIKEQQNFNIWGKIHVNKAFLAPISTSVVPA 353

Query: 355 KAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNS 414
            + + F+D L+   K+K ++KI   T L+N K+Y +++E+YPEF+ +L D+ +GN + N 
Sbjct: 354 ASLRSFHDELINDPKRKHVNKI---TDLINTKDYELVRERYPEFLQLLSDFTAGNFDNNC 410

Query: 415 QVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNIXXXXXXXXXXXXXXXXXX 474
           +V  LIS   R L+ Y++ +V++  C+ LL+EI    F +N                   
Sbjct: 411 EVVTLISQIFRMLDVYRECNVTRDTCFDLLKEISEDNFCENPILSNSDLALAQSSERSAL 470

Query: 475 XKQLYALCGPQISADAD--RVDFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIA 532
            K +Y++  P I  D    R DF ++ VYCIDSETAHEIDDG+SI   G G Y+L +HIA
Sbjct: 471 QKCVYSVVQPDIQLDTKTKRHDFLDMPVYCIDSETAHEIDDGVSIEKNGKGSYTLHVHIA 530

Query: 533 DPSILFSGASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNA 592
           DP+  F  +      L+D V K+A +KSFTTYLPD+VE +LP ++  AADLGK  + T  
Sbjct: 531 DPASFFPESYTESTKLSD-VLKIAFDKSFTTYLPDVVEAMLPESFCRAADLGKQDKKTRT 589

Query: 593 MTFTVNVKTLPDETLHVLYDTFDIKLSKIRNFPKVTYSRVNKILQSSDYSNPSVKQDLED 652
           +TF+V VK      LH+  DTF  +L  + NFPKVTY+ V+ +L  S  SN  ++QDL  
Sbjct: 590 ITFSVRVKMDEHGGLHIQSDTFRARLGLVSNFPKVTYNIVDSVLNDSS-SNSPLRQDLLT 648

Query: 653 LHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNVKFIDQEETPATLLVSEL 712
           L+KIA  LR+NR+K  GAVVFGEGFN G +    +   +VK++ F +  ETP+T+LVSEL
Sbjct: 649 LYKIASGLRHNRVKLNGAVVFGEGFNNGQVRLIRDSANKVKDITFENNNETPSTVLVSEL 708

Query: 713 MILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRVSS 772
           MIL NTL G FF++N IPGI+R YN+L L  KA  +Y S+Q + + G +P++KD+ +++S
Sbjct: 709 MILANTLSGNFFRENKIPGIFRCYNELKLDGKALSDYRSIQDNVQRGKNPTLKDIAKITS 768

Query: 773 LMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNL 832
           LMNSS Y+ +PR H+MIGA+QYLTVTSPLRR+PDL+NH Q+H+ L   P  F+ + +  +
Sbjct: 769 LMNSSFYSGEPRNHQMIGAKQYLTVTSPLRRYPDLINHIQLHKHLANKPLTFSQQAIDQM 828

Query: 833 IWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMS 892
           IW +QSRADILK +S  ++ YWTL YL+K I ++ + RFDVM+TS P +G+VNCLFP+ S
Sbjct: 829 IWQVQSRADILKSISTTVSAYWTLTYLKKRIEKDSSARFDVMVTSFPQDGMVNCLFPNHS 888

Query: 893 FARGKLKLKKGMPYPVIGDTVTNCRIVKLESLDGILYL 930
           +ARGKLKLK     P IGD V +C+I  ++ LD  L L
Sbjct: 889 YARGKLKLKVDRLPPQIGDIVKDCQITSIDCLDSNLQL 926

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/969 (42%), Positives = 593/969 (61%), Gaps = 48/969 (4%)

Query: 2   NVLCATRRLHSSRLSFRALQKQRRSRTKNKNE---------------------NPSFGTT 40
           ++L   R  HS    FR   + +R ++K + +                     N S GT 
Sbjct: 8   HILLIARSFHSCGPCFRVTTRGKRQQSKKRQQAKAQFDYTQLLDNEQVIESGANGSVGT- 66

Query: 41  PXXXXXXXXXXXXXXSRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDR 100
                           RT GLEPD+E+K+L+ I++++ +RY  R I PS+ WY + W+  
Sbjct: 67  ---EKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTWRSL 123

Query: 101 STKILGMERFSKNLINGAKPNFNKRNE--GITFHTQELLESPLKVGDIVLLKSNATELSM 158
           +   +   +    LIN       K  +   + F   +L+E+PL VGD+VLLK    EL+M
Sbjct: 124 TKPKISFHK----LINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAM 179

Query: 159 CVALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVI 218
           CV+LP S  DPRYTF  I G + F+T++ + LRIP+ +P G+ +LI  E  H   PIG +
Sbjct: 180 CVSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTL 239

Query: 219 KSSINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFF 278
           K+  N+T ILP VTRQ ITS  P  +S +AW+ LP+T KKL++LHR LQN +G +QIPFF
Sbjct: 240 KNISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFF 299

Query: 279 QLVHLVDTIDMSSCNDRKY----MKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMW 334
            LV LV  +D++   D KY    +  L++N        +++   +STYWAI++QQE+N+W
Sbjct: 300 TLVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLW 359

Query: 335 GDIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEK 394
           G+I  N+  +SPISVT+ PLK+   +   ++   +     ++    +L+NE+ Y  I   
Sbjct: 360 GEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNL 419

Query: 395 YPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFD 454
           YP  + +LKD+A+GN + N  +  LIS   RK+  YKD D+++ VC  L+ EI P     
Sbjct: 420 YPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVPNSL-S 478

Query: 455 NIXXXXXXXXXXXXXXXXXXXKQLYALCGPQ------ISADADRVDFGNLRVYCIDSETA 508
           N                    ++LY L   +         D+DR DFG+LRV+CIDS+TA
Sbjct: 479 NPLLLNMDLALPSSSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTA 538

Query: 509 HEIDDGISIINKG-NGIYSLSIHIADPSILFSGASEIQG-PLNDDVFKLAMEKSFTTYLP 566
           HEIDDG+S+ N G +G+Y+L IHIADP+ +F  ++ I    ++ D+  +A ++SFTTYLP
Sbjct: 539 HEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLP 598

Query: 567 DIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTL---PDETLHVLYDTFDIKLSKIRN 623
           D+V P+LP      +DLGK+G+ T  ++F+V+VK       ++L ++YD+F I+   + N
Sbjct: 599 DVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSN 658

Query: 624 FPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIE 683
           FPK TY  V+KIL + D  +  VK DLE L  I++ LR  R+K   AV+FGEGFNKGM+ 
Sbjct: 659 FPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVT 718

Query: 684 FFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGS 743
                + E+  V F +QEETP+T+LVSE+MIL NTL G +F +NNI G++R Y +L L  
Sbjct: 719 LNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDL 778

Query: 744 KATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRR 803
            A  +Y S+ + TK G+ P ++D+ ++SSL+NSS YT +P  HEMIGA+QYLTVTSPLRR
Sbjct: 779 IAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRR 838

Query: 804 FPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAI 863
           FPDL+NH QIHR L+K P  F   ++ +LIW IQSRADILK+ SR  +TYWTL YL+K  
Sbjct: 839 FPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLA 898

Query: 864 FENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLK-KGMPYPVIGDTVTNCRIVKLE 922
             +P + +DVMITSVP NG   C+FP +SFARG LKL+ K   YP+IGD V +C+I K++
Sbjct: 899 KSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKID 958

Query: 923 SLDGILYLE 931
            L+G+L LE
Sbjct: 959 CLEGMLELE 967

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/970 (42%), Positives = 598/970 (61%), Gaps = 48/970 (4%)

Query: 2   NVLCATRRLHSSRLSFRALQKQRRSRTKNKNENPS-----------------FGTTPXXX 44
           + L   R  HS +  FR   + +R R+K K +  +                   ++    
Sbjct: 8   HALLIARSFHSYKPCFRVTIRGKRQRSKTKQQGKAQEDYTQLLDNGKVSEVTVNSSIKSA 67

Query: 45  XXXXXXXXXXXSRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKI 104
                       RT GLEP++E+K+L+ I++++ +RY  R I PS+ WY + W+  +   
Sbjct: 68  KDIESINKDFLHRTKGLEPNIELKQLSQIKEEFQQRYRDRYIKPSETWYTNSWRSLAKPK 127

Query: 105 LGMERFSKNLING-----AKPNFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMC 159
           +     S NLIN      A+  F+   E   F   +L+E PL VGD+VLL+    EL+MC
Sbjct: 128 IS----SHNLINSNIQLDAQLKFSNPLE---FQPVQLMERPLNVGDLVLLRVRPNELAMC 180

Query: 160 VALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIK 219
           V+LP S  DPRYTF  I G++ F+T++ I LRIP+ +P G+ +LI  E  +G  PIG IK
Sbjct: 181 VSLPSSTMDPRYTFVAIDGSMCFATKNRILLRIPHRLPVGVNSLIQPEERYGHLPIGTIK 240

Query: 220 SSINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQ 279
           +  N+T ILP   RQ ITS  P  +S +AW +LP T KKL++LHR LQ+  G +QIPFF 
Sbjct: 241 NFSNQTNILPIAARQIITSRYPAQISKLAWRDLPFTTKKLQLLHRSLQDYRGPWQIPFFT 300

Query: 280 LVHLVDTIDMSSCNDRKYMKTLIDN--SKNDSYNNLDASRC--LSTYWAIIEQQETNMWG 335
           LV LV  +D++   D KY  T + N    + + +N+  S    +STYWAI++QQE+N WG
Sbjct: 301 LVGLVQRLDLNEALDDKYGATYLANLLGTHQTADNVPISSATFVSTYWAIMQQQESNFWG 360

Query: 336 DIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKY 395
           +I  N+  +SPISVTV PLK+   + + +V   +  D ++I +  +L+NE+ Y  I   Y
Sbjct: 361 EIHLNTALLSPISVTVIPLKSRHLYYEQVVGKLEADDYNEINRFVKLVNERKYRDISTLY 420

Query: 396 PEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDN 455
           P  + MLKD+A+GN + N  +  L+S   RK+  YKD D+++ +C  L+ EI P     N
Sbjct: 421 PSVIQMLKDFAAGNFHNNGIIVTLVSKIFRKIERYKDCDITRDICQDLINEILPNSM-SN 479

Query: 456 IXXXXXXXXXXXXXXXXXXXKQLYALCGPQ------ISADADRVDFGNLRVYCIDSETAH 509
                               ++LY L   +          ++R DFG+L+V+CIDSETAH
Sbjct: 480 PLLLNMDLALPASSKLVRSQQKLYDLTNIEDLQRKNSDNSSERYDFGDLKVFCIDSETAH 539

Query: 510 EIDDGISIINKG-NGIYSLSIHIADPSILFSGAS--EIQGPLNDDVFKLAMEKSFTTYLP 566
           EIDDG+SI N G +G+Y+L IHIADP+ +F  ++  + +G + D +  +A+E+SFTTYLP
Sbjct: 540 EIDDGVSIENHGTDGLYTLHIHIADPTSMFPESTNYDSEGIITD-ILNVALERSFTTYLP 598

Query: 567 DIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPD---ETLHVLYDTFDIKLSKIRN 623
           D+V P+LP +    +DLGK GQ T  ++F+V+VK +     E+L +++D+F I+   + N
Sbjct: 599 DVVVPMLPKSICNLSDLGKQGQKTKTISFSVDVKVMSKGDGESLEIMFDSFKIRKGIVSN 658

Query: 624 FPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIE 683
           FPKVTY  V++IL + +     VK+DLE L  ++  LR+ R+KN  AV+FGEGFNKG++ 
Sbjct: 659 FPKVTYDDVDRILNTPNDEASPVKKDLESLSMVSNLLRDRRIKNNNAVIFGEGFNKGLVT 718

Query: 684 FFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGS 743
                + E+  + F DQ ET +T+LVSE+MIL NTL G +F  N I G++R Y +L L  
Sbjct: 719 LNANEEGELTEISFSDQVETLSTVLVSEMMILANTLTGKYFADNKICGVFRCYKQLPLDI 778

Query: 744 KATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRR 803
            A  +Y S+ +STK G+ P +KD+ ++SSL+NSS YT +P  HEMIGA+QYLTVTSPLRR
Sbjct: 779 IAQEQYDSMITSTKKGLFPQLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRR 838

Query: 804 FPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAI 863
           FPDL+NH QIHR L+K P  F+  ++  LIW IQSRADILK+  R  +TYWTL YL+K  
Sbjct: 839 FPDLINHLQIHRHLQKKPLCFSQVQIDRLIWPIQSRADILKRAGRNSSTYWTLNYLKKLK 898

Query: 864 FENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMP-YPVIGDTVTNCRIVKLE 922
             +P K +DVMIT+VP NG V+C+FPD+SFARG LKL      YP+IGD V NC+I++++
Sbjct: 899 KLDPEKTYDVMITAVPQNGFVSCVFPDLSFARGTLKLHPSAKHYPMIGDIVKNCKILRID 958

Query: 923 SLDGILYLEA 932
            L+G+L LE 
Sbjct: 959 CLEGMLELET 968

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
           Anc_8.853 YMR287C
          Length = 935

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/942 (41%), Positives = 563/942 (59%), Gaps = 33/942 (3%)

Query: 8   RRLHSSRLSFRALQKQRRSRTKNKNENPSFGTTPXXXXXXXXXXXXXX-------SRTSG 60
           R LH SR   R+++   R R +  NE       P                     SRT  
Sbjct: 8   RSLHVSRTVLRSVRNGGR-RPRLPNEELVIPAVPVEQESAELSPEDIERINLQFLSRTKD 66

Query: 61  LEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGMERFSKNLINGAKP 120
           LEP +E+K+L  I +++ +R+  R   PSK W+E +W +R+       +FS+ ++N A P
Sbjct: 67  LEPGMEVKQLPQIGREFRDRFDARYYEPSKIWFEKNWLNRT-------KFSRKMLN-AVP 118

Query: 121 NFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNL 180
                 E   +    L+  PL VGD+VLLKS+ +ELSMC+ +P S  DPRY F T+ G+L
Sbjct: 119 RKEDTKEVFQYKASALMAKPLDVGDLVLLKSHPSELSMCIDVPSSTKDPRYCFTTVDGSL 178

Query: 181 LFSTRSSINLRIPYSIP---NGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQHIT 237
            F +RS + +RIP+S+P   + +A L+ RE  HGF PIG IK+  NET +LP + RQ +T
Sbjct: 179 KFGSRSLVLMRIPHSLPQELSKMAALLVREAKHGFEPIGTIKNQANETLVLPVIARQLVT 238

Query: 238 SLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDMSSC----N 293
           S     +S  AW++LP+TIKKLE+LHR LQ+  G   +PFF LV ++ ++D++      +
Sbjct: 239 SCVTQRISKSAWDQLPVTIKKLELLHRRLQDSTGPVPVPFFDLVMMIQSLDITKAISNRD 298

Query: 294 DRKYMKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNP 353
              Y++ +I+NS+  S + +D+S  L+TYWAI  QQ+ +++GDIQ +   +SP+SV + P
Sbjct: 299 GEPYIRDVIENSRTGSTSTIDSSCALATYWAIEAQQKNHLFGDIQISGALLSPVSVLILP 358

Query: 354 LKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQN 413
             +   F   L    K    + I + ++L N+  YT +  ++P  + +LK YA+GNL+ +
Sbjct: 359 FASQHLFYSELKEQLKSNGQEAIQEFSKLANKGKYTELTTRFPHIIQVLKGYAAGNLHND 418

Query: 414 SQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNIXXXXXXXXXXXXXXXXX 473
             +  LI+A  RK++ +KD D+++  C KLL    P    +N                  
Sbjct: 419 EGIVSLIAAIFRKIDEFKDNDITRDACEKLLSRTLPQGTVENPIYANFTLGLPDSSARSR 478

Query: 474 XXKQLYALCGPQISADAD-RVDFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIA 532
             +Q+Y L  P  +   + R DF +LRVYCIDSE AHEIDDGISI + GNG Y+L IHIA
Sbjct: 479 TQQQVYDLSKPASAQSTENRHDFKHLRVYCIDSEEAHEIDDGISIEDCGNGKYTLHIHIA 538

Query: 533 DPSILF--SGASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVT 590
           DP+ LF  S +SE  G +ND+V K+A E+ FTTYLPD+V P+LP T++   DLG  G+ T
Sbjct: 539 DPASLFPESESSEQSG-INDEVLKVAAERCFTTYLPDVVSPMLPQTFTTVCDLGHQGKKT 597

Query: 591 NAMTFTVNVKTLPDETLHVLYDTFDIKLSKIRNFPKVTYSRVNKILQSSDYSNPSVKQDL 650
             +TF+V+V  + D  + + +D++ I+L  + NFPKVTY  V++ L      N  +  DL
Sbjct: 598 KTITFSVDV-LVKDGAIKIFFDSYKIRLGLVSNFPKVTYETVDRYLSEPKNVNEEILYDL 656

Query: 651 EDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNVKFIDQEETPATLLVS 710
           + +HKIA  LR  R++  GA+VFG GFN+G++      Q     + F DQ+E+ +TLLVS
Sbjct: 657 KLMHKIAEILREARIQKDGAIVFGSGFNQGLVAVSPVDQ----EISFFDQKESKSTLLVS 712

Query: 711 ELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRV 770
           E MIL N+L G FF +  IPGI+R+Y  L L  +A  EY  ++ S K G+ P+ KD+  +
Sbjct: 713 EFMILANSLAGRFFAEKEIPGIFRTYQPLTLRGQADQEYERMKKSVKKGILPTTKDINML 772

Query: 771 SSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQ 830
           SSL+NSS Y   P  H MIGA QYLTVTSPLRRFPD++NH QIHR L+ LP  F ++ L 
Sbjct: 773 SSLLNSSFYCEYPTAHAMIGASQYLTVTSPLRRFPDIINHLQIHRVLRNLPLCFTEDALS 832

Query: 831 NLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPD 890
            ++WHIQ R   LKK S    +YWTL+Y++  I + P++RFDV ITSVP   V  C+  +
Sbjct: 833 KMLWHIQLRDAALKKASAHQASYWTLKYIKNLIRDTPHQRFDVTITSVPQLNVARCVLAN 892

Query: 891 MSFARGKLKLK-KGMPYPVIGDTVTNCRIVKLESLDGILYLE 931
              ARG LKLK      P +GDTV  C++ K++ LD +L LE
Sbjct: 893 FPSARGVLKLKPSATNIPTVGDTVKGCKVSKIDCLDSLLELE 934

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/950 (40%), Positives = 581/950 (61%), Gaps = 32/950 (3%)

Query: 7   TRRLHSSRLSFRALQKQRR-SRTKNKNENPSFGT---------TPXXXXXXXXXXXXXXS 56
            RRLH S+   R ++K +R SRT NK    +F           TP              S
Sbjct: 23  ARRLHLSQRCLRQVKKPKRASRTSNKEFGDAFSIPNRAMLDPPTPLSQEDIDRINYMFLS 82

Query: 57  RTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGMERFSKNLIN 116
           RT  LEP +E+K+L  I++++  RY  R + P   W++   ++    ILG + FS++LIN
Sbjct: 83  RTKDLEPGVEVKDLNRIKQEFYSRYGARYLNPCNSWFQRSEQN----ILG-KSFSRSLIN 137

Query: 117 GAKPNFNKRNEG-ITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFAT 175
                   +N+  + F  +EL+  PL++GD+VLLK  + +L MC+ +P S  DPRYTF T
Sbjct: 138 ADPEALGIKNKRFLKFDPKELMSRPLQIGDLVLLKHQSPQLCMCIDVPSSTRDPRYTFTT 197

Query: 176 IKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQH 235
           + G ++FSTR+ + +RIP+ +PN    L+ +E+ HGF P+G +K++  ETFILP V RQ 
Sbjct: 198 VDGTIIFSTRNKVLMRIPHHLPN--VPLLMKEMKHGFEPVGCVKNTTTETFILPIVPRQQ 255

Query: 236 ITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDM----SS 291
           ITS     +S  AWEE+P T+KKLE+LHR LQ+  G +Q+PF  LV +V+ +DM    +S
Sbjct: 256 ITSPISHQISKRAWEEMPFTLKKLELLHRHLQDARGPWQVPFMNLVSMVEKLDMQLASAS 315

Query: 292 CNDRKYMKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTV 351
                Y++ LI     +    LD++  LS Y AI  QQ++++WG+I  +   +SP+SVTV
Sbjct: 316 NTGAAYVEDLIRTCTFEPQAKLDSAIFLSVYCAIENQQQSHLWGNIHSSRALLSPVSVTV 375

Query: 352 NPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLN 411
            PL++   ++  ++   K ++ + + +  RL++   Y     +YPE + +L+DYA+GN  
Sbjct: 376 MPLRSQHLYHRSVLQNLKVRNYEAVSKFARLVDTGKYNEAIMEYPEIVKLLQDYAAGNFY 435

Query: 412 QNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNIXXXXXXXXXXXXXXX 471
            ++    ++S   RK+  +++ D+++ +C++LL+E+D +Q   N                
Sbjct: 436 NDATAISVVSKIFRKIQRFQEEDITRDICHQLLKELDSSQTTRNPLHYNLDLGLPSSSLR 495

Query: 472 XXXXKQLYALCGPQISADAD---RVDFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLS 528
               + +Y L  P      D   R DFG+++VYCIDSETAHEIDDG+SI +  +   +L 
Sbjct: 496 SSSEQDIYNLAHPVTFEGQDKNLRHDFGDMKVYCIDSETAHEIDDGVSIESHSDVKRTLH 555

Query: 529 IHIADPSILFSGASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQ 588
           IHIADP+  F    E    +  ++ ++A+ KSFTTYLPD++ P+LP +YS+AADLGK GQ
Sbjct: 556 IHIADPASFFRECQEGTHGIESEILQIALNKSFTTYLPDLMSPMLPGSYSKAADLGKQGQ 615

Query: 589 VTNAMTFTVNVKTLPDETLHVLYDTFDIKLSKIRNFPKVTYSRVNKIL-QSSDYSNPSV- 646
               +TF+V+   + +    +  ++F IKL  + NFP+VTY+ V+ +L Q+S+  N S  
Sbjct: 616 KAKTITFSVDGSWIKNGQFQLQPESFRIKLGLVSNFPQVTYNTVDSMLAQASEVKNGSAN 675

Query: 647 ----KQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNVKFIDQEE 702
               +++L++L+ I++ LR NR+    AVVFG  FNKG +    +    ++ V F DQ E
Sbjct: 676 LTDDQRNLKELYAISQNLRANRINTQQAVVFGSEFNKGQVALSPDENGVLQKVSFKDQLE 735

Query: 703 TPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSP 762
           TP+++LVSE+MIL NTL G FFK NN+PG++R Y  L LG +A  EY  L+S  K G S 
Sbjct: 736 TPSSVLVSEMMILANTLSGQFFKDNNLPGVFRCYQPLALGPQAQNEYELLKSKIKEGKSL 795

Query: 763 SIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPF 822
           + KD+  +S+++NSS Y+S    HEMIGA  YLTVTSPLRRFPD++NH QIHR LK LP 
Sbjct: 796 TFKDICMISTILNSSFYSSDGYRHEMIGAPHYLTVTSPLRRFPDMINHLQIHRLLKGLPL 855

Query: 823 VFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNG 882
            FN + +   +WHIQSR  ILK  SR  NTYWTL+YL++ +  + NK+F VMI SVP  G
Sbjct: 856 CFNKDDVDRFVWHIQSRDSILKDASRCSNTYWTLKYLKQLVENDKNKKFSVMINSVPQVG 915

Query: 883 VVNCLFPDMSFARGKLKLKKG-MPYPVIGDTVTNCRIVKLESLDGILYLE 931
            V C+ PD S AR  LKLK   + +PVIGD + NCRI K+++L+G+L +E
Sbjct: 916 FVRCVLPDYSSARATLKLKPNEISHPVIGDIIENCRITKIDALEGLLEME 965

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
           uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
           RNase component of the mitochondrial degradosome along
           with the ATP-dependent RNA helicase Suv3p the
           degradosome associates with the ribosome and mediates
           turnover of aberrant or unprocessed RNAs
          Length = 936

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/960 (40%), Positives = 578/960 (60%), Gaps = 60/960 (6%)

Query: 4   LCATRRLHSSRLSFRALQKQRRSRTKNKNENPSFGTTPXXXXXXXXXXXXXXSRTSGLEP 63
           + + RR+H++RL  R +    RS  K+  E   F                  S    LEP
Sbjct: 1   MLSLRRIHTTRLLRRKVASGDRS--KDNLEKIFF------------------SHAKDLEP 40

Query: 64  DLEIKELADIEKDYNERYLKRIIWPSKRWYEHDW-KDRSTKI---LGMERFSKNLINGAK 119
           ++EIK+L+ + +D + RY  R   PSK W+  +  + +S K    L  +R S   I    
Sbjct: 41  EVEIKQLSQVRQDSDNRYYHRYFTPSKIWFTQNVSRTQSFKHFFNLDPQRSSDKYI---L 97

Query: 120 PNFNKRNEGITFHT-----QELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFA 174
           P  N+R      HT      +L+ +PLK+GD+VLL+SN T+LSMCV LP    DPRYTFA
Sbjct: 98  PTLNERLYDKGSHTFYLSPSDLMNTPLKIGDLVLLRSNPTQLSMCVDLPTDIMDPRYTFA 157

Query: 175 TIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQ 234
           ++ G L F+ R+ I LRIP      +  L+  E  H + PIGV+K+S   T++LP + RQ
Sbjct: 158 SMDGGLQFAARTMIMLRIPSCHKQELDGLVQLERKHSYEPIGVVKNSPTHTYVLPILARQ 217

Query: 235 HITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDMSSCND 294
            ITS  PF ++  AW ++P+  KKLE+LHRFLQ   G +QI  F L  LV  +D+     
Sbjct: 218 LITSYVPFEITKKAWNQVPIVSKKLELLHRFLQRSTGPWQISIFTLCELVQNLDLQRALS 277

Query: 295 RK------YMKTLIDNSKNDSY--------------NNLDASRCLSTYWAIIEQQETNMW 334
           ++      YM +L      DS               N +DAS  LSTYW++++QQE  +W
Sbjct: 278 KQDGSLQDYMSSLFQKVGLDSNLYCLGEQNLHVNPPNKIDASYFLSTYWSLVKQQELQIW 337

Query: 335 GDIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEK 394
           G IQ +   ++PISVTV PL +   + + +V   KQ +   + +   L+N+KNY  I+ +
Sbjct: 338 GGIQTHRGILTPISVTVLPLNSEHLYYENVVSTLKQDNYRMLDEFAELVNKKNYKPIQNR 397

Query: 395 YPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFD 454
           +P+ + +LK+YA+GN N N  +  L+S   RKL+ YK+ D ++ +C++LL +I P +   
Sbjct: 398 FPQLIQILKNYAAGNFNNNGAMITLVSKIFRKLHTYKERDTTRDMCHELLTQISPDKLI- 456

Query: 455 NIXXXXXXXXXXXXXXXXXXXKQLYALCGPQISADAD--RVDFGNLRVYCIDSETAHEID 512
           N                    + +Y +  P ++ D    R DFG++ VYCIDSETAHEID
Sbjct: 457 NPLLLNKDLGLPMASQRSALEQVVYDISKPPLTEDDSYVRHDFGDMPVYCIDSETAHEID 516

Query: 513 DGISIINKGNGIYSLSIHIADPSILFSGASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPL 572
           DGISI       Y L IHIADP+  F+ +++ +    DDV  +A ++SFTTYLPD+V P+
Sbjct: 517 DGISIETLSEKKYRLHIHIADPASSFAKSTDPEA--RDDVLDIAFQRSFTTYLPDMVLPM 574

Query: 573 LPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSKIRNFPKVTYSRV 632
           LP +Y  AADLGK+G  T  ++F++++      TL +L DTF ++L  +  FP+VTY +V
Sbjct: 575 LPESYCRAADLGKDGNKTKTLSFSIDI-YFHQGTLRLLDDTFKMRLGLVSRFPRVTYEKV 633

Query: 633 NKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEV 692
           + +LQ  +   P    DL+ ++++A++LR  R+KN  A++FGEGFNKG+++   +   E+
Sbjct: 634 DILLQYPE-KQPKEASDLKLMYEVAKSLRAKRVKNQDAIIFGEGFNKGLVKLSPDETGEL 692

Query: 693 KNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYMSL 752
             + F DQ E+ +T+LVSE+MIL NTL G +FKKN IPG++R YN+L L  +A  EY  +
Sbjct: 693 TKISFEDQVESKSTVLVSEMMILANTLTGGYFKKNKIPGVFRCYNELQLKDRALKEYTKM 752

Query: 753 QSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQ 812
           +  TKSG  P+I+D+  +SSL+NSS YT KP+ HEMIGA +YLTVTSPLRRFPD++NH Q
Sbjct: 753 KEMTKSGQFPTIRDINTISSLLNSSFYTGKPKKHEMIGASEYLTVTSPLRRFPDMINHLQ 812

Query: 813 IHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFD 872
           IHR L+ LP  F+ +++  + WHIQSR  +LK  +R   TYWTL++L+  + +  + RF 
Sbjct: 813 IHRHLRGLPLCFSQQEVDGITWHIQSRDVVLKNAARMSATYWTLKFLKNELEKKKDIRFT 872

Query: 873 VMITSVPNNGVVNCLFPDMSFARGKLKLK-KGMPYPVIGDTVTNCRIVKLESLDGILYLE 931
           VM+TSVP+ G V+C FP+++ ARG L L  K  PYP IGD +  C++ KL+ LDG++ LE
Sbjct: 873 VMVTSVPHMGTVSCAFPNLNAARGTLNLDPKHTPYPAIGDLIHKCKLTKLDCLDGVIELE 932

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/896 (42%), Positives = 561/896 (62%), Gaps = 29/896 (3%)

Query: 56  SRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWK------DRSTKILGMER 109
           +RT GLEPD EI++L  I   +N+RY  R + PS+RW++ DWK      D++T++L  E 
Sbjct: 30  ARTKGLEPDFEIRQLPQIISGFNKRYRARYLEPSQRWFKADWKASDHGEDKATRLLRPEV 89

Query: 110 FSKNLINGAKPNFNKRN-------EGITFHTQELLESPLKVGDIVLLKSNATELSMCVAL 162
           F K +IN    +F++ N       + ++F   ELL + L VGDIVLLK   +EL+MCV L
Sbjct: 90  FDKFIINS---DFHRGNMEQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSELTMCVNL 146

Query: 163 PESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSI 222
           P+S  DPRYTFA   G L+++ ++S+ LRIP  +P  +  L+ RE  H +  IG IK+S 
Sbjct: 147 PQSTTDPRYTFAKKDGTLVYAMKNSVILRIPKDLPEEVNQLLKRESNHPYQKIGTIKNSS 206

Query: 223 NETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVH 282
           NET ILP +TRQ I S    T +  AW +LP+ +KKLE++HR+LQ+  G   + F  LV 
Sbjct: 207 NETEILPVLTRQLIVSFTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSKHVNFMSLVR 266

Query: 283 LVDTIDMSSCNDR----KYMKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQ 338
           ++  +++    D      Y++ +ID S +    ++D +  L+TYW + EQQ+ N+WG + 
Sbjct: 267 IIKNLNIKEATDAINGDAYVRKVIDESMSVVNKSIDPTTLLATYWGVREQQQNNLWGSVY 326

Query: 339 RNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEF 398
            N+  +SP +V V PLK    F   ++   +  D  +I    +L+N+K+Y  I ++Y   
Sbjct: 327 TNTALLSPTTVAVLPLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIAKRYDYI 386

Query: 399 MSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNIXX 458
            ++L DYA+GN+ +N+ +  +IS   R ++ Y+D DV++++C KLL EI P     N   
Sbjct: 387 RTLLNDYAAGNIEENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSNSSNFIL 446

Query: 459 XXXXXXXXXXXXXXXXXKQLYALCGPQISADADRVDFGNLRVYCIDSETAHEIDDGISII 518
                            ++LY    P I +D DR DFG++ V+CIDSE AHEIDDGISI 
Sbjct: 447 GNWDLNIPKSSGISSVEQKLYDTAMPTIVSDTDRYDFGDMPVFCIDSEDAHEIDDGISI- 505

Query: 519 NKGNGIYS-LSIHIADPSILFSGASE-IQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNT 576
            + +G+ S + IHIADP+ LF  + +  +  ++DDV +++++++FTTYLPD+V P+LP +
Sbjct: 506 EELDGVRSRIHIHIADPAGLFPESFDYTKSGISDDVLRVSLKRAFTTYLPDLVVPMLPKS 565

Query: 577 YSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSKIRNFPKVTYSRVNKIL 636
           +   ADLGK+ + T  ++F+  +    D  LHV YDTF ++L  + NFPKVTY +V+ IL
Sbjct: 566 FCNRADLGKHDRKTETISFSFELVNKEDGGLHVDYDTFQVRLGIVSNFPKVTYDKVDSIL 625

Query: 637 QSSDYSNPS-VKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNV 695
              D S PS  K+ LE LH +A  L + R+ +  AVVFG+GFNKG++    +   E+   
Sbjct: 626 NGDDNSLPSKQKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNKGLVSLSPDDDGELCIP 685

Query: 696 KFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSS 755
            F DQ +T +TLLVSE MILTN LC  FF++N IPG+YR YN L LG++A  ++  L+ +
Sbjct: 686 TFYDQSQTKSTLLVSEFMILTNKLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFELLKEN 745

Query: 756 TKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHR 815
            K G  PS+KD+T++SS ++SS Y+  P  H+MIG   YLTVTSP+RR PDL+NH Q+HR
Sbjct: 746 IKLGKLPSLKDITKISSQLSSSFYSPFPLPHKMIGNTAYLTVTSPMRRGPDLINHLQLHR 805

Query: 816 FLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMI 875
           FLKKLP  F  E L   +W  Q+RADILK   R  +TYWTL++L+++      K  DV++
Sbjct: 806 FLKKLPLCFKQEYLDQYVWSFQARADILKIFQRHSSTYWTLKHLEQS----GTKTHDVIV 861

Query: 876 TSVPNNGVVNCLFPDMSFARGKLKLKKGM-PYPVIGDTVTNCRIVKLESLDGILYL 930
           TSVP NG VNCLFP+ S+ARG LKL   M   P IGDT+ +C++  +  LDGIL L
Sbjct: 862 TSVPQNGTVNCLFPEYSYARGTLKLDPAMKKIPRIGDTIRHCKVESIHPLDGILTL 917

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
           YMR287C
          Length = 940

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/943 (41%), Positives = 569/943 (60%), Gaps = 23/943 (2%)

Query: 1   MNVLCATRRLHSSRLSFRALQKQRRSRTKNKNENPSFGTTPXXXXXXXXXXXXXXSRTSG 60
           M  +CA R LH+   S R     ++S T    + P   +                 RT+ 
Sbjct: 2   MKRVCAVRNLHTYNPSCRK-SFGKKSPTLEFKQPPDTESKRLSPDDIKFIRESFLKRTNW 60

Query: 61  LEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGMERFSKNLINGAKP 120
           LEP++++K L  I ++Y +R+L R I PSK WYE  W +  TK      F+K  +N   P
Sbjct: 61  LEPNIQLKSLPQIYREYEKRFLSRYIRPSKFWYETLWLNNDTK----PPFNKLFLNNPLP 116

Query: 121 NFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNL 180
           +   + + + F   +L ++PLK+ D+ +L++  +ELSMCV LPES +DPRYTFA+  G L
Sbjct: 117 DSISKKQLLNFDYNDLAKTPLKIRDLAILRATPSELSMCVQLPESVEDPRYTFASRSGKL 176

Query: 181 LFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQHITSLK 240
            F  RS I +RIPY +P GI  LI +E+ H F+PIG +KS+  +TFILP + R  ++   
Sbjct: 177 YFVYRSMIKIRIPYQVPKGIQGLILKELQHEFSPIGTLKSNTKDTFILPYLARNLLSRTG 236

Query: 241 PFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDMSSC------ND 294
              ++  A  + P+ +KKLE+LHR+LQN  G   IPF  L++LV+ +D+S        ND
Sbjct: 237 LSDINKAASYQRPIVMKKLELLHRYLQNDKGPTSIPFTHLINLVNKLDLSQALHLQAGND 296

Query: 295 RKYMKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNPL 354
             Y+  LI  + ND  + ++AS  ++ YW+++E  ET +W  I RNS S+ P +VTV PL
Sbjct: 297 --YIINLIKEA-NDPPSIMNASLTIAVYWSLVELSETFLWDGINRNSASLFPTTVTVLPL 353

Query: 355 KAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNS 414
            +Y+     L+   ++ +  ++ + + L+N+KNY  I++ + + +++L++Y +GNL  N 
Sbjct: 354 LSYRVHYTELIEDLERNNYKQLNKFSNLVNDKNYQEIEQSFSKIINLLQEYTAGNLQNNP 413

Query: 415 QVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNIXXXXXXXXXXXXXXXXXX 474
           ++  LIS   R +  Y+  D+++ +C +LL +    +   N                   
Sbjct: 414 KITTLISKLFRGIKEYQRCDITRDLCNELLMKFPSIKPNSNPLLKNHDLATRADSQHGQR 473

Query: 475 XKQLYALCGPQ----ISADADRVDFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIH 530
            + LY    P       +  DR DFG+LRVYCIDSETAHEIDDGISI  K NG ++L IH
Sbjct: 474 QQILYDYVKPNDLLIQESLRDRFDFGDLRVYCIDSETAHEIDDGISIEKKFNGKFTLHIH 533

Query: 531 IADPSILFSGASEIQG--PLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQ 588
           IADP+I F   +  +G   L DDV K+A E SFTTYLPD V P+LP +Y + ADLG NG+
Sbjct: 534 IADPAIFFPECNNEKGVLGLQDDVLKIAYENSFTTYLPDTVVPMLPKSYCKMADLGINGK 593

Query: 589 VTNAMTFTVNVKTLPDET-LHVLYDTFDIKLSKIRNFPKVTYSRVNKILQSSDYSNPSVK 647
            T +++F+V+V    +++ L + YDTF I+L  + NFPK TY  V+ IL S   S   + 
Sbjct: 594 KTPSISFSVDVILNKEKSNLKICYDTFQIRLGLVSNFPKATYDNVDDILSSEVNSEQKLL 653

Query: 648 QD-LEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNVKFIDQEETPAT 706
           QD L  L  IA  LRN R +  GA+ FGEGFN+G  ++ E+ + E   + F+DQ+ T + 
Sbjct: 654 QDDLRQLSMIAGILRNKRTQENGAITFGEGFNRGTPKYSEDSETESDVISFVDQKNTKSN 713

Query: 707 LLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKD 766
            LV+ELMIL NTLCG +FK+N I G+YR YN L L  KA M+Y  L+   K+G  P+++D
Sbjct: 714 ELVTELMILANTLCGRYFKENKIFGVYRCYNDLNLEPKAKMQYNKLREECKNGKLPTLED 773

Query: 767 MTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFND 826
           + +V SL+NSS Y+  P  H+MIG++QYLTVTSPLRRF DL++H Q+H  LK  P  FN 
Sbjct: 774 IVKVQSLLNSSYYSEHPSRHDMIGSEQYLTVTSPLRRFTDLVSHIQLHNHLKGHPLPFNQ 833

Query: 827 EKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNC 886
           + ++N + HIQSRAD L+K+S   N   TL YL+  +   P+  FDV ITSVP+ G   C
Sbjct: 834 KAIRNFVPHIQSRADKLRKISTESNVCMTLSYLKNLLKTKPDTMFDVKITSVPSEGRARC 893

Query: 887 LFPDMSFARGKLKLKKGMP-YPVIGDTVTNCRIVKLESLDGIL 928
           L P+ SFARG+++L   +  YP +GDTV +C++VK+  +DGIL
Sbjct: 894 LIPEYSFARGEIRLSPSLKVYPKVGDTVNSCKVVKISCVDGIL 936

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/904 (39%), Positives = 530/904 (58%), Gaps = 37/904 (4%)

Query: 57  RTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHD---WKDRS-------TKILG 106
           R   LEP +EIK+L+ I+K  +ER+  +   PSK W   +   W +         T +  
Sbjct: 51  RPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSS 110

Query: 107 MERFSKNLINGAKPN-FNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPES 165
            +R   N  +  KP  F+  +     H   LL+S LK+GD+VLL+S+ ++L MCV +P  
Sbjct: 111 KQRADMN--DSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTE 168

Query: 166 ADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINET 225
             +P Y FATI G++ F  R+ I LRIP         LI  E+P     IG +K S  +T
Sbjct: 169 VTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKT 228

Query: 226 FILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVD 285
           F+L  V RQ  TS  PF ++  AW  + +T KKLE+LHRFLQ   G +Q+  F+L  LV 
Sbjct: 229 FMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVA 288

Query: 286 TIDMSSCNDRK---YMKTL------------IDNSKNDSYNNLDASRCLSTYWAIIEQQE 330
            +D+  C       Y++ +            I++    S  ++DAS  L+TYW++++QQE
Sbjct: 289 LLDIDKCQSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQE 348

Query: 331 TNMWGDIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTI 390
            N+WG I  +   ++PISVTV PL ++  +   ++   K+ +   +    +L+N      
Sbjct: 349 HNLWGQIHSHRAMLTPISVTVLPLTSHHLYYKEVLKELKKDNYAALESFAKLINTGERNS 408

Query: 391 IKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPT 450
            K +YP+   +L+DYA+GN + N  +  ++S   RKL+ Y++ D+++ +C++ LQE+   
Sbjct: 409 AKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQELT-C 467

Query: 451 QFFDNIXXXXXXXXXXXXXXXXXXXKQLYALCGPQISAD-ADRVDFGNLRVYCIDSETAH 509
           +   N                    +++Y L  P  + D + R DFG + VYCIDSETAH
Sbjct: 468 ESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPNQNDDISRRHDFGKMNVYCIDSETAH 527

Query: 510 EIDDGISIINKGNGIYSLSIHIADPSILFSGASEIQGPLNDDVFKLAMEKSFTTYLPDIV 569
           EIDDGISI   G   Y+L IHIADP  LFS + E  G  + +++ +A+++ FT+YLPD V
Sbjct: 528 EIDDGISIEATGENAYTLHIHIADPVSLFSNSQE--GSFSKEIWNIALQRGFTSYLPDCV 585

Query: 570 EPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSKIRNFPKVTY 629
            P+LP +YS+A DLGK+G  +  ++F+V+++   +  + +L +TF +KL  +  FP+VTY
Sbjct: 586 TPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKN-NVEILEETFSVKLGLVSQFPRVTY 644

Query: 630 SRVNKILQ-SSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEG 688
             V++IL    D S  +  Q+L  LHKIA  LR+ R+K   A++FGEGFN+G+++     
Sbjct: 645 KVVDRILGLEQDASQQT--QELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQ 702

Query: 689 QAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATME 748
                 + F DQEET +T+LVSE+MIL NT+ G FF+   IPG++R Y  L L   A   
Sbjct: 703 TNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQG 762

Query: 749 YMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLL 808
           Y SL+    S   PS KD+ ++SSL+NSS Y+++   HEMIGA  YL VTSPLRRF DL+
Sbjct: 763 YNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLV 822

Query: 809 NHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPN 868
           NH+Q+H +L   P  F+++++ +L WHIQSR  +L+K +R   ++WTL +L+     NP+
Sbjct: 823 NHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPS 882

Query: 869 KRFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMPYPV-IGDTVTNCRIVKLESLDGI 927
           +R  VM+TSVP  GVV C+ P++S ARG LKLK      V IGD V NCRI +L+ LD I
Sbjct: 883 RRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSI 942

Query: 928 LYLE 931
           + LE
Sbjct: 943 MELE 946

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
           YMR287C (MSU1) - component of 3'-5'exonuclease complex
           [contig 39] FULL
          Length = 936

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/907 (37%), Positives = 530/907 (58%), Gaps = 41/907 (4%)

Query: 57  RTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGM--------- 107
           R   LEP +EIK+L++I+   N+RY ++ + PSK W     +D  TK  GM         
Sbjct: 37  RAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEW----CRDNGTKWGGMKNYLNMDLM 92

Query: 108 ---ERFSKNLINGAKPN-FNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALP 163
              E+   ++    +P  ++K +E      +ELL+SPLK+GD+VLL+SN T+L  CV +P
Sbjct: 93  SLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVP 152

Query: 164 ESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSIN 223
               +P Y FATI G + ++ RS I LRIP        +LI  E P+    IG +K S  
Sbjct: 153 TDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIREEKPYLDARIGTVKDSPE 212

Query: 224 ETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHL 283
           +TFILP + RQ  TS  PF ++  AW  + +  +KLE+LHRFLQ   G +Q+  F+L  +
Sbjct: 213 KTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQM 272

Query: 284 VDTIDMS---SCNDRKYMKTLID--------NSKNDSYNNL------DASRCLSTYWAII 326
              +D+    S +   Y+K L          NS      NL      DA+  L+T+WA+ 
Sbjct: 273 AVMLDLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWALE 332

Query: 327 EQQETNMWGDIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEK 386
           +QQE N+WG  Q +   ++P+SVTV PL +   + + ++   K+ +   I +   L+N  
Sbjct: 333 QQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDNHRLITKFAGLVNSG 392

Query: 387 NYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQE 446
           N+T    + P+F  +LKDYA+GN + N  +A ++S   R ++ +K  D+++ +C++L+++
Sbjct: 393 NFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKGRDITRDLCHELMEK 452

Query: 447 IDPTQFFDNIXXXXXXXXXXXXXXXXXXXKQLYALCGPQISAD-ADRVDFGNLRVYCIDS 505
           +      + +                   K +Y +  P    D   R DF ++ VYCIDS
Sbjct: 453 LSHRNTLNPLLLSDDLALPSSSANTALEEK-IYEMAQPSTKEDIPARFDFSSMNVYCIDS 511

Query: 506 ETAHEIDDGISIINKGNGIYSLSIHIADPSILFSGASEIQGPLNDDVFKLAMEKSFTTYL 565
           E+AHEIDDGISI   G   ++L IHIADP  LF+     +   ND+V+ +A  + FTTYL
Sbjct: 512 ESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTK--FNDEVWNIAYRRGFTTYL 569

Query: 566 PDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSKIRNFP 625
           PD+V P+LP ++  A  LG N   +  ++F+VN+K + D  L +  ++F ++L     FP
Sbjct: 570 PDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIK-MHDGGLRIDEESFKVRLGYATKFP 628

Query: 626 KVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFF 685
           KVTY  V++ILQ ++      K+ L  L++I+  L++ R+    A++FGEGFN+G+++  
Sbjct: 629 KVTYDSVDRILQQNNDKTQEAKE-LRTLYQISLLLQSKRINEQRAIIFGEGFNRGLVKLN 687

Query: 686 EEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKA 745
           E     +  + F DQ +TP+T+LVSE+MIL NTL G +F+ N IPG++R Y +LLL S A
Sbjct: 688 EGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPGVFRCYKELLLKSGA 747

Query: 746 TMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFP 805
              Y SL++ T+S   P+++D+ ++SSL+NSS YT  P  H MIGA  YLTVTSPLRRFP
Sbjct: 748 RESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYTGTPDRHSMIGAPAYLTVTSPLRRFP 807

Query: 806 DLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFE 865
           DL+NH QI + L + P  F+   +  +IWH+QSR  +++K +R   ++WTL++L+     
Sbjct: 808 DLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDS 867

Query: 866 NPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMPYPV-IGDTVTNCRIVKLESL 924
           +P+++  VM+TS+P  G V C+ PD+S ARG LKLK  +   V IGD + NC I KL+ L
Sbjct: 868 SPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAIGDLMHNCVITKLDCL 927

Query: 925 DGILYLE 931
           D ++ L+
Sbjct: 928 DAVMELK 934

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
           YMR287C
          Length = 962

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/901 (39%), Positives = 532/901 (59%), Gaps = 36/901 (3%)

Query: 57  RTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGMERFSKNLIN 116
           RT+ LEPD+ +K  A I  + ++R+  R + PSK WYE +W+  + K L +    + LIN
Sbjct: 64  RTNDLEPDIRLKTTAQIHYELDKRFNARYLQPSKSWYESNWEKLNEKRLTLS--IRELIN 121

Query: 117 GAKPNFN-KRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFAT 175
                F     + + F+ +++ E PLK+GDIVLLK+N +E SMC+ LP+S  DPRYTF +
Sbjct: 122 KDPAEFKFNYYKNLKFNIEDVTE-PLKIGDIVLLKTNTSEFSMCIDLPQSLKDPRYTFIS 180

Query: 176 IKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQH 235
             G+L+F  RS I L+IP+ +P  I  LI +E  H +NPIG IKSS++ET ++P + RQ 
Sbjct: 181 STGDLIFGMRSMILLKIPFKLPGNIERLIIKEPAHKYNPIGTIKSSLDETVLVPVIARQL 240

Query: 236 ITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDMSSCND- 294
           + +  P  +S  A ++LP+ IKKLE+LHR+LQ+  G  QI F +L+++++ +++    D 
Sbjct: 241 LINFMPAQISKCATKQLPVIIKKLELLHRYLQDFSGPQQIHFHKLINIIEALNLDRATDY 300

Query: 295 ---RKYMKTLIDNSKNDSYNN-----LDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSP 346
               +Y+  L+     + Y +     LDA+  LSTYWAIIEQQ+  +WG+I+RNS S+ P
Sbjct: 301 EKGNEYVNELLKQKYYNDYTDLSLSSLDATVALSTYWAIIEQQDLFLWGEIKRNSSSLFP 360

Query: 347 ISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTI----IKEKYPEFMSML 402
            +VT+ P   + ++   L+   ++ +  +  + +  +NE N       I+ K+PEF+ +L
Sbjct: 361 TTVTILPFSHHVYYTK-LIKSLRKNNFRRTNEFSAFINEHNLNTSSPEIQFKFPEFLHLL 419

Query: 403 KDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQ-FFDNIXXXXX 461
           K+Y +GNL  N ++  ++S   R LN +K+ D++K + Y+LL ++ PT     N      
Sbjct: 420 KEYCAGNLLDNPKIITILSKIFRNLNDFKERDITKDLAYELLTKLIPTSNLLANPLLANH 479

Query: 462 XXXXXXXXXXXXXXKQLYALCGPQISADAD----RVDFGNLRVYCIDSETAHEIDDGISI 517
                          +LY L  P      +    R +F +L VYCIDSETAHEIDDGISI
Sbjct: 480 DLSLPTNSGRGENQSKLYELATPTKIESGETTTKRHNFNDLNVYCIDSETAHEIDDGISI 539

Query: 518 IN--KGNGIYSLSIHIADPSILFSGASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPN 575
               K + +YS  +       +     E +  ++DD+ K+A  +SFTTYLPD V P+LP+
Sbjct: 540 KKYLKIDLLYSFILLTLQFISMKDSNKEKKTGIDDDILKIAYYRSFTTYLPDNVVPMLPS 599

Query: 576 TYSEAADLGKNGQVTNAMTFTVNVKTLP----DETLHVLYDTFDIKLSKIRNFPKVTYSR 631
            Y E +DLGK+ Q    +TF+V++        +ETL +LYDTF I+   + NFPKVTY  
Sbjct: 600 KYCEMSDLGKSNQNIETLTFSVDITIFDGSNNEETLKILYDTFKIQFGLVSNFPKVTYDT 659

Query: 632 VNKILQ-SSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQA 690
           V+KIL  S+   + S+ +DL  L +IA+ LR  R+    A+VFGEGFN+G+ +     Q+
Sbjct: 660 VDKILDNSTKIPDTSITEDLRQLSRIAKLLRKYRINENNAIVFGEGFNRGIPDL----QS 715

Query: 691 EVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYM 750
               + F DQ+ + +  LVSE+MIL NTL G + K + IP IYR Y+ L +G +A  E +
Sbjct: 716 TEDEIIFTDQKNSDSNELVSEMMILANTLTGKYCKDHKIPVIYRCYSPLDIGPEAQQECI 775

Query: 751 SLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNH 810
            L+S     + PS  DM ++SS +NSS Y+  P  H M+G+ +Y TVTSPLRRFPDLLNH
Sbjct: 776 ILRSKNIDRL-PSNIDMAKMSSFLNSSYYSGTPSRHSMLGSDEYATVTSPLRRFPDLLNH 834

Query: 811 FQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKR 870
            Q+H  LK     F    + + +  IQSR+D LK +  A+ T  TL Y++  I + P K 
Sbjct: 835 IQLHNHLKGYQLPFTPNHVAHYLTTIQSRSDTLKNIGNAVYTEMTLNYIKLLINKEPTKA 894

Query: 871 FDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGM-PYPVIGDTVTNCRIVKLESLDGILY 929
           FDV++TSVP  G   C      +ARG +KLK  + P P+IGD +T C++ K+  ++G L 
Sbjct: 895 FDVLVTSVPIEGSARCAIVGYEYARGTIKLKAEINPVPIIGDIITKCKVTKIFPIEGALE 954

Query: 930 L 930
           L
Sbjct: 955 L 955

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
           Anc_8.853 YMR287C
          Length = 943

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/899 (38%), Positives = 523/899 (58%), Gaps = 46/899 (5%)

Query: 57  RTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILGMERFSKNLIN 116
           RT GLE   EIKE+ +I+      +    I PSK W++         +     FS +LIN
Sbjct: 47  RTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFD--------TVTSSGSFSNDLIN 98

Query: 117 GAK--------PNFN-KRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESAD 167
                      P+   K N   +F+  +L +  L +GD+VLL+++  EL MCV +P S +
Sbjct: 99  ETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCVDIPMSIE 158

Query: 168 DPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKSSINETFI 227
           DPR+TFA   G L+FST+ ++ LRI  ++P  I N    ++       G+I    N    
Sbjct: 159 DPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILN---HDLIKNKYEAGLINRKENNAIK 215

Query: 228 LPT---VTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLV 284
           LP+   V RQ  TS  P  +S IA  +L + +KKLEVLHR++ + +    I F +LVHLV
Sbjct: 216 LPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLKLVHLV 275

Query: 285 DTIDMSSC------NDRKYMKTLIDNSKND--SYNNLDASRCLSTYWAIIEQQETNMWGD 336
             +D++        +D  ++  +I N+K+D      +DA   LSTYWA+I+QQ++ +WGD
Sbjct: 276 QNVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQQQSQLWGD 335

Query: 337 IQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYP 396
           IQ +S  + PISV+V P     + N+ +      ++++K    T  +N+ N   I EK+P
Sbjct: 336 IQIHSALLFPISVSVLPFNNVIYLNETIPRVATDENINKF---TEAINKHNLEKINEKFP 392

Query: 397 EFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNI 456
           +F++MLK+Y +G    N ++  +IS   R++  YK+ ++S+  C KL  E++P+    N 
Sbjct: 393 DFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNELNPSNKILNS 452

Query: 457 XXXXXXXXXXXXXXXXXXXKQLYALCGPQISA--DADRVDFGNLRVYCIDSETAHEIDDG 514
                              + +Y+L      A  D  R DF +L+V+CID +TAHEIDDG
Sbjct: 453 LLLSKDLCLPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLKVFCIDEKTAHEIDDG 512

Query: 515 ISIINKGNGIYSLSIHIADPSILFSGASEIQG-PLNDDVFKLAMEKSFTTYLPDIVEPLL 573
           +S++ K   I  L IHIADP+ LF   + I+    +D++  +A  ++FTTYLP+ V P+L
Sbjct: 513 VSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTTYLPEFVLPML 572

Query: 574 PNTYSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSKIRNFPK-VTYSRV 632
           P ++   +DLG  G++TN +TF+V+       +  +L DTF+I+L K+ NFPK  TY  V
Sbjct: 573 PKSFCTKSDLGNTGKMTNTITFSVD---FDKSSCSILEDTFEIQLGKVNNFPKNTTYKEV 629

Query: 633 NKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEV 692
           +KIL SS      +++DL ++  IA  LR  R+ N  AV+FGEGFNKG +   E+ Q   
Sbjct: 630 DKILNSSIKRENDIERDLREMRFIANHLRKCRIDNS-AVIFGEGFNKGAVNLIEKKQDGE 688

Query: 693 KN--VKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYM 750
           K+  V F D E TP+ ++VSE MIL N+L G +FK + IP IY++Y  L +  KA+ ++ 
Sbjct: 689 KSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKGLNMKPKASSQFK 748

Query: 751 SLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNH 810
            + +  K  + PSIK+++++ SL++SS ++SKP +HEMIG  QY TVTSPLRRFPDL+NH
Sbjct: 749 KILNVNKKRL-PSIKEISKIGSLLSSSTFSSKPSIHEMIGTDQYATVTSPLRRFPDLINH 807

Query: 811 FQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKR 870
           FQ+HR+L   P  F+ EKL  ++WH+  R  IL+  SR  N YWTL+YL + I  NP  R
Sbjct: 808 FQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYLNEKIEGNPLLR 867

Query: 871 FDVMITSVPNNGVVNCLFPDMSFARGKLKLK-KGMPYPVIGDTVTNCRIVKLESLDGIL 928
           FDVM+ SV  NG V+C+ P +S+A G LKLK      P IG+ + NC+I  ++ L   L
Sbjct: 868 FDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCKIANIDCLGNSL 926

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
           complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/801 (40%), Positives = 494/801 (61%), Gaps = 29/801 (3%)

Query: 144 GDIVLLKSNATELSMCVALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANL 203
           GDIVLL  + + L MC+ LP+S  DPRY+FA   G+++F+ RSS+ LRIP  +P  +  L
Sbjct: 124 GDIVLLSQDLSNLYMCIELPQSTADPRYSFANSNGDIIFANRSSVLLRIPLQLPTNL--L 181

Query: 204 ITREI--PHGFNPIGVIKSSINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEV 261
           ++ +   P     +G +K+SI+  ++LP + RQ + S    T+S  A   LP+ +KKL++
Sbjct: 182 LSDDFLQPEPTQGVGTVKNSIDNPYVLPVLLRQLVISPSLSTISSNANNLLPIVLKKLQL 241

Query: 262 LHRFLQNPLGWYQIPFFQLVHLVDTIDM--SSCND-RKYMKTLIDNS-KNDSYNNLDASR 317
           LHR LQ    +  IP  QL  LV  +D+  ++ ND   Y+   I NS +N S  ++++S 
Sbjct: 242 LHRNLQ---AFKIIPLVQLSSLVQNLDLTKATSNDGESYISNFIANSNENYSIESINSSN 298

Query: 318 CLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNPLKA-YQHFNDYLVCGTKQKDLDKI 376
            ++T+WAI +QQ+ ++WGDI  +   + P++V++ PL++ Y ++ + L        +++ 
Sbjct: 299 LIATFWAIRQQQQDHLWGDIHYSKALLFPLAVSILPLQSNYMYYKEILPAIELDHSIERF 358

Query: 377 GQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVS 436
            +   + N  N      ++P+ +++LK YASG +  + ++  +IS   R L+ YK  DVS
Sbjct: 359 TK-NGIPNTPN------EFPQLLNLLKQYASGAVLMDDKIVTMISKIFRNLDDYKKYDVS 411

Query: 437 KTVCYKLLQEIDPT-QFFDNIXXXXXXXXXXXXXXXXXXXKQLYALCGP-QISADADRVD 494
           + +C KL  E+ P  Q   N                    +++Y +  P Q S +++R D
Sbjct: 412 RDLCQKLYNELVPKEQKIQNSLLYNTDLALPLASNRTEEQEKVYQMYNPIQTSNNSNRHD 471

Query: 495 FGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIADPSILFSGASEIQGPL-NDDVF 553
           FG+LRV+CID +TAHEIDDG+SI  K N +Y+L +HIADPS  F   ++    + ND++ 
Sbjct: 472 FGDLRVFCIDEKTAHEIDDGVSIEYKQNNVYTLHVHIADPSSYFKICNDHNVNIENDEIL 531

Query: 554 KLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVK-TLPDETLHVLYD 612
           K+A+++SFTTYLPD V P+LP     AADLGK G+ T  +TF+V+VK    D T+ VL +
Sbjct: 532 KIALQRSFTTYLPDQVLPMLPKLLCRAADLGKTGEKTKTITFSVDVKLNKKDMTVKVLDN 591

Query: 613 TFDIKLSKIRNFPK-VTYSRVNKILQSSDYS--NPSVKQDLEDLHKIARALRNNRMKNGG 669
           TF ++L  + NF K +TYS V+ IL  S  S  +  V++DL+ +  IA+ L N+R+ N  
Sbjct: 592 TFQVRLGYVSNFVKDMTYSDVDSILNDSKESGRDKKVEKDLKSMFLIAKGLNNSRIMNN- 650

Query: 670 AVVFGEGFNKGMIEFF-EEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNN 728
           AV+F +  N G IE   +E   EV  + F   + T + +LVSELMIL N+L G FF +N 
Sbjct: 651 AVIFSDEINNGKIELTKDEITGEVTQINFKGGKFTDSNILVSELMILANSLAGKFFAENG 710

Query: 729 IPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEM 788
           IP IYRSY+ LLLG  A  EY ++ S+ K G  P++KD+ ++SSL N+S +T+ P  H M
Sbjct: 711 IPAIYRSYSDLLLGKDAQSEYNAMLSNLKLGKRPTLKDINKISSLFNTSKFTTYPSPHSM 770

Query: 789 IGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSR 848
           I  + Y TVTSPLRRFPD++NH QIHR L K P  F    L+N+ W+IQ++  IL+  SR
Sbjct: 771 IATKYYATVTSPLRRFPDMINHLQIHRILSKQPLCFTQRDLENMNWNIQTKDVILRSSSR 830

Query: 849 AINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLK-KGMPYP 907
            INTYWTL +++  + E+P+K+FDVMITSV  NGV +C+    SFA+GKL        +P
Sbjct: 831 MINTYWTLRHIKDQLSEDPDKKFDVMITSVQQNGVAHCILAQFSFAKGKLVFDPNDESHP 890

Query: 908 VIGDTVTNCRIVKLESLDGIL 928
           +IGDTV+NC+I K++ L  +L
Sbjct: 891 LIGDTVSNCKITKIDCLGNVL 911

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score =  550 bits (1416), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 321/919 (34%), Positives = 523/919 (56%), Gaps = 46/919 (5%)

Query: 56  SRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWY--------EHDWKDRSTKILGM 107
           S+   + P++EIK     + +   R+  R + PS  WY        E+  KD    +L  
Sbjct: 57  SQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRN 116

Query: 108 ERFSKNLING-----AKPNFNKRNEGIT-FHTQEL---------LESPLKVGDIVLLKSN 152
           +  S  L        +K N+  RN     + TQE+         + S L  GDI +LK++
Sbjct: 117 DISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNS 176

Query: 153 ATELSMCVALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGF 212
             EL +CV  P  A D R+TFA   GN++++ ++S++LR P         ++ RE  HG+
Sbjct: 177 PFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLHGY 236

Query: 213 NPIGVIKSSINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGW 272
           +P+G +K+  + TF++PT+ R+ + S   F ++  A ++LP+  KKLE++HR+LQ+    
Sbjct: 237 SPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSP 296

Query: 273 YQIPFFQLVHLVDTIDMSSCNDRK----YMKTLIDN----SKNDSY--------NNLDAS 316
           +QIP  +LV +   +++S+  ++     +MK+ + +    S  +S+        N ++ S
Sbjct: 297 WQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECS 356

Query: 317 RCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNPL-KAYQHFNDYLVCGTKQKDLDK 375
           R L+ YWA++ QQ T MWG++  +     P +VTV PL K + H+++ ++   +Q    +
Sbjct: 357 RLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHN-IIHKLRQHGGVR 415

Query: 376 IGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDV 435
           I ++  L+NE +   + + +P  + +L+DYA+GNL  N  +  LIS+  RKL+ YK++++
Sbjct: 416 INRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNI 475

Query: 436 SKTVCYKLLQEIDPTQFFDNIXXXXXXXXXXXXXXXXXXXKQLYALCGPQISADAD-RVD 494
           S+ VC+ LL+ I+P++  + +                   K       P+I   A+ R +
Sbjct: 476 SRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTE 535

Query: 495 FGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIADPSILFSGASEIQGPLNDDVFK 554
           + +L  YCIDS  AHEIDD +SI + G   Y + IH+ADP+ LF  A+E    +N  V  
Sbjct: 536 YKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLD 595

Query: 555 LAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTF 614
           +A +++FTTYLPD V P+LP TY+ ++DLG+ G+ T A+TF+V+      + L +L D+ 
Sbjct: 596 IAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSL 655

Query: 615 DIKLSKIRNFPKVTYSRVNKILQSSDYSNPSVK-QDLEDLHKIARALRNNRMKNGGAVVF 673
            ++LS +    ++TY  V+++L        S K +DL+ L  IA+ALR  R+ +GGAVVF
Sbjct: 656 KVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVF 715

Query: 674 GEGFNKGMIEFFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIY 733
            E  + G++    +  +E+  V F DQ ET +T+LVSELMIL N+L   +F++N IPGIY
Sbjct: 716 -ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIY 774

Query: 734 RSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQ 793
           R Y  L +   AT     +++ T+     S  D+ ++ S + SS Y+S P  H+M+G   
Sbjct: 775 RGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSH 834

Query: 794 YLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTY 853
           YLT+TSPLRRFPDL+NH Q+HR LK LP ++   +L  ++WHI +R   LK  S     Y
Sbjct: 835 YLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRY 894

Query: 854 WTLEYLQKAIFENPNK-RFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMPYPVIGDT 912
           WTL +L+K I E+P K  + + ITS+ +NG  +C+  D +FA G+LK+      P++GD 
Sbjct: 895 WTLRFLKKEI-EDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLNKNPPLVGDQ 953

Query: 913 VTNCRIVKLESLDGILYLE 931
           +++C I  ++ LDGIL  E
Sbjct: 954 ISDCEISNIQCLDGILQFE 972

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score =  522 bits (1344), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 289/817 (35%), Positives = 459/817 (56%), Gaps = 27/817 (3%)

Query: 135 ELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNLLFSTRSSINLRIPY 194
           +L  + L++GD+ +L +   +L +CV  P  A D RY FA   G + ++T+S + LR+P 
Sbjct: 5   DLAGTTLQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRLRVPG 64

Query: 195 SIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQHITSLKPFTVSHIAWEELPL 254
                +  L+ RE  HG+ P+G +K++I+ T++LP   R+   +L    +S  A  +LP 
Sbjct: 65  LHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLPE 124

Query: 255 TIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDMSSC---NDRKYMKTLID-NSKNDSY 310
            + KLE+LHR LQ+ LG +Q+  F+LV LV  +++ +       K  K L + N    SY
Sbjct: 125 VVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQGSY 184

Query: 311 -------------NNLDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNPLKAY 357
                          +D +  L+TYW +++QQ   MWGDI  +    SP+SVTV PL+  
Sbjct: 185 CSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLRDQ 244

Query: 358 QHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVA 417
             F DYL+   K+ D   + +   L+N+  Y      Y   + +L+DY +GN+N N+ + 
Sbjct: 245 TLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAALI 304

Query: 418 VLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNIXXXXXXXXXXXXXXXXXXXKQ 477
            L++   R+L+ YK+ +V++T+ ++LL ++ P +   N                    ++
Sbjct: 305 YLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCP-ETPHNPLHWNHQLELPLSNPRTALEQK 363

Query: 478 LYALCGPQISAD--ADRVDFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIADPS 535
           +Y L  P +  +    R +F  +  YCIDS  AHEIDDG+SI       Y L +HIA P 
Sbjct: 364 VYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPY 422

Query: 536 ILFSGASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTF 595
            LF  +        D V  +A  ++FTTYLPD+V P++P +Y+ A+DLG+  + T  +T 
Sbjct: 423 SLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITI 482

Query: 596 TVNVKTLPDETLHVLYD-TFDIKLSKIRNFPKVTYSRVNKILQSSDYSNPSVKQDLEDLH 654
           +V+V     + L V+ + T  I L   R   +VTY  V+ +L+S      +   DL  L+
Sbjct: 483 SVDVDL--SKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESK--RQDAEASDLRLLY 538

Query: 655 KIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNVKFIDQEETPATLLVSELMI 714
           K+A +LR  R     A++FG+  N G+I        ++ NV+ +D + T +  LVSELMI
Sbjct: 539 KVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKSNTLVSELMI 597

Query: 715 LTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLM 774
           + N+L G +F +N IPG+YR   +LLL  +A+ +Y SLQ + +   S S  D+ +V++ +
Sbjct: 598 MANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVAAFL 657

Query: 775 NSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIW 834
            +S Y+S P  H M+G ++YLT+TSPLRR PD++NH Q+HR L+ LP  F+ E++  L W
Sbjct: 658 TNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDALNW 717

Query: 835 HIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFA 894
           HI +R   LK  S+  + +WTL YL+  +   P+KR+D+++TS+P NG V+C  P + ++
Sbjct: 718 HILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIFYS 777

Query: 895 RGKLKLKKGMPYPVIGDTVTNCRIVKLESLDGILYLE 931
            GKLK+  G   P +G TV NC I +L+SLDG L  E
Sbjct: 778 SGKLKIPSGANNPAVGSTVANCFITRLDSLDGTLRFE 814

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score =  385 bits (989), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/449 (45%), Positives = 299/449 (66%), Gaps = 21/449 (4%)

Query: 494  DFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIADPSILF---SGASEIQGPLND 550
            DF +L+VYCIDSETAHEIDDGISI    N +++L IHIADPS +F      S+IQ  LN 
Sbjct: 583  DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLN- 641

Query: 551  DVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPD-ETLHV 609
                +A+ KSFTTYLPD+V P+LP ++ + +DLG + Q T  ++F+VNV+   + E++ +
Sbjct: 642  ----MALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKI 697

Query: 610  LYDTFDIKLSKIRNFPK-VTYSRVNKILQSSDYSN------PSVKQDLEDLHKIARALRN 662
            L++TF ++L  +  FP   TY  V++IL +S   N        ++ DL +L +I+  L+ 
Sbjct: 698  LHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKK 757

Query: 663  NRMKNGGAVVFGEGFNKGMIEF-FEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCG 721
            NR++NG AV+FGEGFNKG++     +    V N K  DQ +T +  LV+E+MIL N+L  
Sbjct: 758  NRIQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFK--DQNDTKSVTLVTEMMILANSLAA 815

Query: 722  WFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVS-PSIKDMTRVSSLMNSSVYT 780
              FK+N IPGI+R Y++L L  KA +E+  L+ + K     P+IK++++  SL+NSS YT
Sbjct: 816  RLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYT 875

Query: 781  SKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRA 840
              P  H+MIGA  YLTVTSPLRRFPDL+NH QI  F+KK PF ++   +Q ++  IQSR 
Sbjct: 876  DLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRD 935

Query: 841  DILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKL 900
             I++++S   N Y+ L YL++ I +NP++ FDV+ITSV N G ++C+ P+ S + G LKL
Sbjct: 936  IIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKL 995

Query: 901  KKGMPY-PVIGDTVTNCRIVKLESLDGIL 928
            K  + + P IGD + NC+I K+++LDG L
Sbjct: 996  KPDLDFTPSIGDVIRNCKIDKIDALDGRL 1024

 Score =  234 bits (598), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 154/440 (35%), Positives = 235/440 (53%), Gaps = 62/440 (14%)

Query: 57  RTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEH-DWKDRSTKILGMERFSKNLI 115
           R   L+P + IKEL +I  +Y +R+L+R I PS +W+   +W  R+       +FSK ++
Sbjct: 65  RIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTI----TPKFSKYML 120

Query: 116 NGA--------KPNFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESAD 167
           N          K   N  N   T H+ EL   PL +GD++LL  +++ L MCV +P +  
Sbjct: 121 NSTFSFDAWYQKIISNSFNLTFTKHSLEL--DPLNIGDLILL-PDSSNLLMCVDIPHNTK 177

Query: 168 DPRYTFATIKGNLLFSTRSSINLRIPYSIPNGI--ANLITREIPHGFNPIGVIKSSINET 225
           DPRYTFA+  G L F TRS+I LRIP  +PN +  + L+  E  HG N IG IK++ N  
Sbjct: 178 DPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIK 237

Query: 226 FILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQLVHLVD 285
            +LP + RQ +       ++  A ++L + +KKLE++HR +QN  G YQI FF+L+ L+D
Sbjct: 238 ILLPIIARQLVVRPILNNLNKSANDKLSIILKKLELIHRLIQNGNGPYQISFFKLIKLID 297

Query: 286 TIDMSSCNDRKYMKTLIDNSKNDSYN---------NLDASRCLSTYWAIIEQQETNMWGD 336
            ++++  ++ K     ++ SK  S N          +DAS  L+TYWAI  QQ+  +WG 
Sbjct: 298 ILNLNDFDNSKKFDINLNFSKLLSSNEIESLNSSTEIDASTFLATYWAIRLQQQDFLWGK 357

Query: 337 IQRNSCSMSPISVTVNPLKAYQ-HFNDYL-----VCGTKQKDLDKI-------------- 376
           IQ N   +SPISVTV PL  Y  ++N++L          +  LD                
Sbjct: 358 IQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDINNQSTTNTTN 417

Query: 377 ------------GQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFL 424
                           +L + KN   I + YPEF+++ ++Y +GN + NS++  LIS  L
Sbjct: 418 NNNNTTIITTTTTNNNKLDSSKN---ISQNYPEFINIFQNYCAGNFDDNSKIIALISKIL 474

Query: 425 RKLNYYKDMDVSKTVCYKLL 444
           R+L  +KD D++K  C +LL
Sbjct: 475 RRLTKFKDSDLTKDTCKELL 494

>Smik_13.362 Chr13 complement(562717..567699) [4983 bp, 1660 aa]
           {ON} YMR162C (REAL)
          Length = 1660

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 52/100 (52%), Gaps = 12/100 (12%)

Query: 741 LGSKATMEYMSL-QSSTKSGVSPSIKDMTRVSSLM-----NSSVYTSKPRMHEMIGAQ-- 792
           +G +  ++ + L ++ST+S   PS++D  +  + +     +S++YT +P M  + G +  
Sbjct: 632 IGDQNLLDRLGLSKTSTESVCRPSLEDFPKSRNSIEYKGNSSAIYTGRPSMRSLFGKENS 691

Query: 793 ---QYLTVTSPLRRFPD-LLNHFQIHRFLKKLPFVFNDEK 828
              +  +V SP   F D + + F + RF++K P     +K
Sbjct: 692 FLSKRASVNSPSEAFSDNIKSSFDLIRFIQKYPTALFSQK 731

>KLTH0E04378g Chr5 (396019..397332) [1314 bp, 437 aa] {ON} some
           similarities with uniprot|P40544 Saccharomyces
           cerevisiae YIL023C Hypothetical ORF
          Length = 437

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 532 ADPSILFSGASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQ 588
           A P ++ +   E++      +  L M  +F T + DI+  LLP  +SEA D+ +  Q
Sbjct: 57  AAPCLIVTAIPELRKAKRGSLLSLLMSFAFGTLMGDIILHLLPEIFSEAIDVNEEAQ 113

>NCAS0A13730 Chr1 (2698652..2699080) [429 bp, 142 aa] {ON} Anc_7.282
          Length = 142

 Score = 33.1 bits (74), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 785 MHEMIGAQQYLTVTSPLRRFPDLLNHFQ 812
           M  M+ A  Y+TVTSPLRR P+L+  +Q
Sbjct: 49  MPGMVHAFYYITVTSPLRRDPELIYFYQ 76

>Kpol_257.1 s257 complement(1..2622) [2622 bp, 874 aa] {ON}
           complement(1..2622) [2622 nt, 874 aa]
          Length = 874

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 13/129 (10%)

Query: 810 HFQIHRFLKKLPFVFNDEKLQNLIWH-------IQSRADILKKMSRAINTYWTLEYLQKA 862
           HF     L KLPFV     ++N+I +       I  R DI ++         +L  ++  
Sbjct: 396 HFDESVPLNKLPFVIRKRPIENMIIYGNSLDDFIIGRIDINQETMNDPKLNQSL--IRLP 453

Query: 863 IFENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMPYPVIGDTV---TNCRIV 919
           IF   N   +V    V  +  +N + P ++F + + K+ + +P P I D     T C  +
Sbjct: 454 IFSTENSNIEVGTLCVKISSSMNLILPPVNFKKFE-KILRELPLPKIADIAYSDTICSNL 512

Query: 920 KLESLDGIL 928
           +LE +  IL
Sbjct: 513 RLEDVSEIL 521

>YBR165W Chr2 (568852..569685) [834 bp, 277 aa] {ON}
           UBS1Ubiquitin-conjugating enzyme suppressor that
           functions as a general positive regulator of Cdc34p
           activity; nuclear protein that may represent a link
           between nucleocytoplasmic transport and ubiquitin ligase
           activity
          Length = 277

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 523 GIYSLSIHIADPSILFSGASEIQGPLNDDVFKLA----MEKSFTTYLPDIVEPLLPNTYS 578
           G+  L  HI  P        ++Q   +   F  A    + K F +Y P+++  L P  YS
Sbjct: 98  GLQDLLFHIWQPLFHIQATEDLQYSPSTVKFNRAWNRIIYKDFKSYFPELIGTLQPGDYS 157

Query: 579 EAADLGKNGQVTNAMTFTVN 598
                 KN  ++N+   +VN
Sbjct: 158 IVKSYSKNHNISNSNGGSVN 177

>ZYRO0D01848g Chr4 complement(148657..150621) [1965 bp, 654 aa] {ON}
           similar to uniprot|P32569 Saccharomyces cerevisiae
           YER022W SRB4 subunit of RNA polymerase II
           holoenzyme/mediator complex
          Length = 654

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%)

Query: 827 EKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVN 885
           EKL+ LI+  +    + ++ ++ I+   T+E  +K + E PN++F++ + S+ +  VVN
Sbjct: 404 EKLKALIFEQELMYQLRRECAQLISYGVTIENEKKVVIELPNEKFEIELVSLDDASVVN 462

>NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {ON}
           Anc_5.307 YDR293C
          Length = 1260

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 54/118 (45%), Gaps = 15/118 (12%)

Query: 490 ADRVDFGNLRVYCI----DSETAHEIDDGISIINKGNGIYSLSIHIADPSILFSGASEIQ 545
           A R DF +   Y I    ++++  E    + + N  +G + L  H+ D +      S + 
Sbjct: 700 AVRTDFTDPSEYSILAIAENDSLSEF--ALHVKNNNDGTFELGCHVVDATAHIEENSSLD 757

Query: 546 GPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQ-VTNAMTFTVNVKTL 602
                   + A ++S   ++P  V  LLP   +E+  L K+ +  T ++ +T+N +TL
Sbjct: 758 --------RRARKRSSGVFMPQKVVNLLPKALNESLSLKKDKKSATLSVIYTLNAETL 807

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 129 ITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNLLF-STRSS 187
           I  H+Q  +E   +    +  KS A  + + + +PE AD P++ ++   G+L +   +S+
Sbjct: 298 IQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYS--HGSLKYVPEKSA 355

Query: 188 INLRI---------PYSIPNGIANLITREIPHGFNPIGV 217
           I  +I          ++   G+ ++   E+P    PI V
Sbjct: 356 ILWKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQV 394

>Kpol_1023.50 s1023 (111088..114849) [3762 bp, 1253 aa] {ON}
           (111088..114849) [3762 nt, 1254 aa]
          Length = 1253

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 77/175 (44%), Gaps = 24/175 (13%)

Query: 510 EIDDGISIINKGNGIYSLSIH---IADPSILFSG-----ASEIQGPLNDDVFKLAMEKSF 561
           E D  +  I   N +  L+ H   + D +I F        + I+  L+ D  + A ++S 
Sbjct: 699 EEDYDVVAITPDNNLSELAFHLRTVDDSTIEFGCHVVDVTAHIEEGLSLD--RRARKRSS 756

Query: 562 TTYLPDIVEPLLPNTYSEAADLGKNG-QVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSK 620
             ++P     LLP T +E+  L +N    T ++ ++++VK+L  ++  +           
Sbjct: 757 AVFMPQTTVNLLPKTLNESLKLDQNKTSATLSVVYSLDVKSLEVKSCWIGETV------- 809

Query: 621 IRNFPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGE 675
                 ++ S V  I   +D  +P+    L  + KIAR+   NR++N  A +  E
Sbjct: 810 ------ISPSSVISIDDITDDKSPNHSGSLSTMKKIARSFYQNRIQNDKAELIPE 858

>TPHA0J00490 Chr10 (109600..110907) [1308 bp, 435 aa] {ON} Anc_6.40
           YMR005W
          Length = 435

 Score = 32.0 bits (71), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 38/89 (42%), Gaps = 15/89 (16%)

Query: 766 DMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFN 825
           D+    +L+NSSV TSK + H  I       V  P    P  L+  Q+ +F+KK+     
Sbjct: 201 DIREEEALLNSSVNTSKNQTHATI-------VNMP--EHPPFLHPSQVSKFMKKI----- 246

Query: 826 DEKLQNLIWHIQSRADILKKMSRAINTYW 854
             + Q          DIL  +S A  TY 
Sbjct: 247 -AREQTFNQDFTKNNDILAMISTACETYM 274

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,204,272
Number of extensions: 4531063
Number of successful extensions: 13718
Number of sequences better than 10.0: 52
Number of HSP's gapped: 13943
Number of HSP's successfully gapped: 53
Length of query: 932
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 813
Effective length of database: 39,836,145
Effective search space: 32386785885
Effective search space used: 32386785885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)