Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L019508.849ON58858828180.0
NCAS0C003208.849ON60858614440.0
TDEL0B001808.849ON58256714160.0
NDAI0K003608.849ON62061614190.0
Suva_13.4748.849ON60257513750.0
ZYRO0C14850g8.849ON59457213650.0
YMR284W (YKU70)8.849ON60258213630.0
Skud_13.4578.849ON60259113201e-176
Smik_13.5008.849ON60258012971e-172
KLTH0C03586g8.849ON57857312901e-172
SAKL0D01188g8.849ON58158212891e-171
KNAG0M02650singletonON57458112761e-169
TPHA0I003108.849ON60858412521e-165
Kwal_27.101998.849ON57256812061e-159
TBLA0B028908.849ON64863411971e-157
KLLA0C06226g8.849ON59258511321e-148
Kpol_1068.18.849ON51448610931e-143
CAGL0I02662g8.849ON60659310891e-141
AFR443CsingletonON5765929121e-115
Ecym_46208.849ON5975636992e-83
ABL117C8.849ON6025125673e-64
TDEL0B069302.600ON23988980.001
Suva_13.2072.600ON24963870.033
Skud_13.1942.600ON24963840.087
YMR038C (CCS1)2.600ON24963840.092
CAGL0F06017g2.600ON23963830.12
Smik_13.2082.600ON24963800.26
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L01950
         (588 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....  1090   0.0  
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   560   0.0  
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   550   0.0  
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     551   0.0  
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   534   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   530   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   529   0.0  
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   513   e-176
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   504   e-172
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   501   e-172
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   501   e-171
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   496   e-169
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   486   e-165
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   469   e-159
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   465   e-157
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   440   e-148
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   425   e-143
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   424   e-141
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   355   e-115
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   273   2e-83
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   223   3e-64
TDEL0B06930 Chr2 complement(1225098..1225817) [720 bp, 239 aa] {...    42   0.001
Suva_13.207 Chr13 complement(337909..338658) [750 bp, 249 aa] {O...    38   0.033
Skud_13.194 Chr13 complement(334081..334830) [750 bp, 249 aa] {O...    37   0.087
YMR038C Chr13 complement(347511..348260) [750 bp, 249 aa] {ON}  ...    37   0.092
CAGL0F06017g Chr6 complement(601431..602150) [720 bp, 239 aa] {O...    37   0.12 
Smik_13.208 Chr13 complement(341587..342336) [750 bp, 249 aa] {O...    35   0.26 

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/588 (91%), Positives = 539/588 (91%)

Query: 1   MSGVDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELNKXXXXXXXXXXXXXXX 60
           MSGVDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELNK               
Sbjct: 1   MSGVDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELNKIQLIEILESLEELMS 60

Query: 61  XXXVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXX 120
              VVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKK                 
Sbjct: 61  QLIVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLID 120

Query: 121 FFQYNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILR 180
           FFQYNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILR
Sbjct: 121 FFQYNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILR 180

Query: 181 KIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSSTEYDGPNTTPIQASYIK 240
           KIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSSTEYDGPNTTPIQASYIK
Sbjct: 181 KIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSSTEYDGPNTTPIQASYIK 240

Query: 241 SKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFS 300
           SKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFS
Sbjct: 241 SKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFS 300

Query: 301 RRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKS 360
           RRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKS
Sbjct: 301 RRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKS 360

Query: 361 CVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLE 420
           CVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLE
Sbjct: 361 CVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLE 420

Query: 421 PSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGY 480
           PSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGY
Sbjct: 421 PSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGY 480

Query: 481 NPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXXXXXXX 540
           NPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKV          
Sbjct: 481 NPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVSHIREKIISS 540

Query: 541 XXXXDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRKPAPTLNL 588
               DAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRKPAPTLNL
Sbjct: 541 SRSEDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRKPAPTLNL 588

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/586 (48%), Positives = 383/586 (65%), Gaps = 29/586 (4%)

Query: 10  EDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXXXXVVRPN 68
           E+  + S+KK++ HE +IF +ELS  MFE VPELN K                  ++RP+
Sbjct: 7   ENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPS 66

Query: 69  AAIGCYFHYCGKEGNDY--GIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQYN- 125
             IGCYFHYC ++  D   GIYEFFPL D+NA++MKK                 +F ++ 
Sbjct: 67  TGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDP 126

Query: 126 -----NAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILR 180
                + K+  +E LF F L+QF+   A   KY  ++IFLFTDNDSP +  DK+A   +R
Sbjct: 127 TLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIR 186

Query: 181 KIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLG--------ARKDSS-----TEYD 227
           +IVDD++++++NFV FFIGR   PF ++ YS ILKLG        A+ D +     +EYD
Sbjct: 187 RIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYD 246

Query: 228 GPNTTPIQASYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKL 287
           GPNTTPI ASYIKSK+LRK+EIKR  F+CPLIL E+ NFIV +RGY  V+ EK ATRYKL
Sbjct: 247 GPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKL 306

Query: 288 VYEYENLRQEAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDV- 346
           VYE+EN+R+EA SRRKFL+  T EEIK  EL K+F  GD DIE++++   EV K +DD  
Sbjct: 307 VYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDK---EVAKINDDYS 363

Query: 347 --RSFLKVVGFRSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAII 404
              SFLKV+GFRS K+ ++Y NNIDK +FVVPDE QY  +IK + SLF+ L+ + K  I+
Sbjct: 364 KHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIV 423

Query: 405 WGKLKANSNPSLFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLI 464
           WGK+K+NSN  L++L P+   D NEGFYL+R+PFLDEIRK P ++ Y     + DY NL+
Sbjct: 424 WGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLV 483

Query: 465 KVTEYIMAYFNLKGGYNPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTE-RKQRLLRE 523
           ++TE I+ YFNLK GY P D KNP +Q+++K LHDYLLQ+E    ++  ++ +  R L+E
Sbjct: 484 RITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKE 543

Query: 524 DDTLRKVXXXXXXXXXXXXXXDAGAQKLSKYIKVWNNFYAKIEKES 569
           DDTL K+              D   Q+LSKY+ +WN FY K+EKES
Sbjct: 544 DDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKES 589

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/567 (47%), Positives = 369/567 (65%), Gaps = 3/567 (0%)

Query: 16  SYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXXXXVVRPNAAIGCY 74
            Y++++ HE +IF +ELS+GMF+ +PELN K                  + RP+  IGCY
Sbjct: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74

Query: 75  FHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQYNNAKKTSMEK 134
           F  C +     GIY F PL D+NA+ MKK                 F  Y+ +K T +E 
Sbjct: 75  FFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLES 134

Query: 135 LFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLDESHVNFV 194
           L      +F  +V  Q+ +  ++IF FTDNDSP +  D +AKS LR +V+DLD+  +NF 
Sbjct: 135 LLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFT 194

Query: 195 PFFIGRPDAPFNSALYSEILKLGARKDSSTEYDGPNTTPIQASYIKSKVLRKREIKRVAF 254
            FFIG+P  PF+   YS+IL+LGA   +S E+DGPNTTPI A+YIKS+VLRK+EIKR+ F
Sbjct: 195 TFFIGKPGLPFDEGFYSDILRLGATTKASDEFDGPNTTPISAAYIKSRVLRKQEIKRIMF 254

Query: 255 RCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSETAEEIK 314
           +CPLIL EK  FIVG++GY  +SHEK   RYKLVYE E++RQEAFSRRK+L+++T EEIK
Sbjct: 255 QCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEEIK 314

Query: 315 GKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNIDKVMFV 374
              LTK++  GDLDIE+ E    E+        SFLKV+GF+S ++C+ Y NNI+K  FV
Sbjct: 315 DG-LTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATFV 373

Query: 375 VPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPNEGFYLH 434
           VPDE +Y  SI+ L+SLFK LR K K AI+WGKLK+NSNP++F   PS E  PNEGFYL+
Sbjct: 374 VPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYLY 433

Query: 435 RVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNPCIQKYF 494
           RVPFLDE+R++P M+         DYENL + T+ ++ +FNLK G+ P + KNP +QK+F
Sbjct: 434 RVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKHF 493

Query: 495 KILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXXXXXXXXXXXDAGAQKLSKY 554
           KILHDYLLQIE++   +    ++ +LL EDD+LR++              D   QKLSKY
Sbjct: 494 KILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSKY 553

Query: 555 IKVWNNFYAKI-EKESVSLEPSKTKKR 580
           + +WN+ Y KI ++E+   +  KTKK+
Sbjct: 554 LAIWNSLYDKIFDQETAIADAPKTKKK 580

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/616 (44%), Positives = 388/616 (62%), Gaps = 39/616 (6%)

Query: 9   NEDDQ---------NASYKKFESHEAMIFSVELSDGMFETVPELNKXXXXXXXXXXXXXX 59
           NEDD+         +ASYKK++ HE +IF +ELS  MF+ VPELN               
Sbjct: 8   NEDDEYEPTTTTAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLEL 67

Query: 60  XXXXVV-RPNAAIGCYFHYCGKEGNDY---------GIYEFFPLSDINAKNMKKXXXXXX 109
               V+ RP+  +GCY HYC K  N+          GIYE FPL D+NA +MKK      
Sbjct: 68  MSHLVIIRPSTGVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFE 127

Query: 110 XXXXXXXXXXXFFQYNN----AKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDND 165
                      +FQ++N     K+  +EKLF F L++F++    +  Y  ++IFLFTDND
Sbjct: 128 DLQHERITLMKYFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDND 187

Query: 166 SPIDKEDKEAKSILRKIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARK----- 220
           SPI+ E+ EAK  +R++VDD++++++NF  FFIG PD PF+ + YS++LKLGA+      
Sbjct: 188 SPIESEEHEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSD 247

Query: 221 --------DSSTEYDGPNTTPIQASYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRG 272
                   D  +E+DGPNT PI A YIKS++LRK+EIKR+ F+ PLILNE   FI+G+RG
Sbjct: 248 QDYIDAVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRG 307

Query: 273 YIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVD 332
           Y+  SHEK  TRYKLVYE EN+R+EAFS RK+L+  T EE++  E  KIF  GD++IE++
Sbjct: 308 YMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELN 367

Query: 333 ERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLF 392
           ++  ++VE+      +FLK++GFRS   C+ Y NNI    FVVPDE QY  SI+ + SLF
Sbjct: 368 DKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLF 427

Query: 393 KTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYE 452
           +TL+ K K AIIWGK+K NS P L++L P+   D NEGFYL+R+PFL+EIRK P ++ Y+
Sbjct: 428 RTLKKKDKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYK 487

Query: 453 CGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNPCIQKYFKILHDYLLQIEDKTSDES 512
              +  DY NLIK+T  I+ YF+L+ GY P + +NP +Q+++++LHDYLLQ+E   ++  
Sbjct: 488 DRSSNPDYTNLIKITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGD 547

Query: 513 STERKQRLLREDDTLRKVXXXXXXXXXXXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSL 572
              + Q+LL EDDTLRK+              D   Q+L KY+ +WN +Y K+++E+   
Sbjct: 548 EQHQIQKLLEEDDTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEENSLS 607

Query: 573 EPSKTKKRKPAPTLNL 588
            P K K +   PTLNL
Sbjct: 608 NPPKKKSK---PTLNL 620

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/575 (45%), Positives = 381/575 (66%), Gaps = 11/575 (1%)

Query: 9   NEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXXXXVVRP 67
           N+  ++ASY+KF+ HE ++F +ELS  MF+  PELN K                  + RP
Sbjct: 15  NDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRP 74

Query: 68  NAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQYNNA 127
             +IGCYF+YCG++    GIYE FPL DINAK MK                  +F + ++
Sbjct: 75  GTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHS 134

Query: 128 KK---TSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVD 184
           +K     + KLFTF L+ F  ++ GQ++ + ++IFLFTDND P + +D + ++ LR++  
Sbjct: 135 EKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTI 194

Query: 185 DLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARK----DSSTEYDGPNTTPIQASYIK 240
           DL ++ VNF  FFIG  +  F++  YS+IL+LG+ K    D  +E+DGPNT PI A YIK
Sbjct: 195 DLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIK 254

Query: 241 SKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFS 300
           SK+LRK+E+KR+AF+CPLI +E  NFI+G++GY   SHEK   RYKLVYE+E++RQEA+S
Sbjct: 255 SKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYS 314

Query: 301 RRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKS 360
           +RKFL+  T  ++ G  + K++  GDLDI + E++   + +A      FL+++GFRS  S
Sbjct: 315 KRKFLNPTTGADVTGSTV-KVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTS 373

Query: 361 CVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLE 420
            + Y NNI+K  F+VPDE +Y  SI+ L SL KTLR K K AI+WGKLK+NS+PSLFVL 
Sbjct: 374 SIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLS 433

Query: 421 PSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTS-DYENLIKVTEYIMAYFNLKGG 479
           PS  ++ NEGFYL+R+PFLDEIRK P++++Y+ GE    +Y+N+ ++++ IM YFNL+ G
Sbjct: 434 PSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDG 493

Query: 480 YNPMDLKNPCIQKYFKILHDYLLQIE-DKTSDESSTERKQRLLREDDTLRKVXXXXXXXX 538
           YNP D KNP +Q++FK+LHDYLLQIE +   +E+S  R  R++ EDD+LRK+        
Sbjct: 494 YNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKIL 553

Query: 539 XXXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSLE 573
                 D   Q+L+KY+K+WN FY K   +++S++
Sbjct: 554 ESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISVK 588

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/572 (45%), Positives = 366/572 (63%), Gaps = 3/572 (0%)

Query: 13  QNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXXXXVVRPNAAI 71
           Q+ SY+K+E HE +IF +ELS GMF+ + ELN K                  +VRP   I
Sbjct: 20  QSKSYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQLVIVRPGTGI 79

Query: 72  GCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQYNNAKKTS 131
           GCYF+ C K+     IYEFFPL DINAK+MKK                 F  Y+ +++T 
Sbjct: 80  GCYFYNCNKDDAKNHIYEFFPLRDINAKSMKKLSDLLDDLANDRITLQKFLPYDESERTP 139

Query: 132 MEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLDESHV 191
           ++ L+ F  ++F  EV GQ+ +  +++FLFTDNDSP + ED E KS LR +VDD+D+  +
Sbjct: 140 LDFLYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNETKSRLRHLVDDMDDHFI 199

Query: 192 NFVPFFIGRPDAPFNSALYSEILKLGAR-KDSSTEYDGPNTTPIQASYIKSKVLRKREIK 250
           NF  FFIG+ +APF+ + YS++LKLGA  +D +TE+DGPNTTPI ASYIKS+VLRK+E+K
Sbjct: 200 NFTTFFIGKEEAPFDDSFYSDVLKLGATAEDPNTEFDGPNTTPISASYIKSRVLRKQEVK 259

Query: 251 RVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSETA 310
           R+ F+C LIL E+  F+VG++GY  +  E+   RY+LVYE + +R+EA S+RKFL S T 
Sbjct: 260 RIMFQCCLILEERMQFMVGIKGYTIIIQERPGQRYRLVYEKDEVRKEANSKRKFLDSNTG 319

Query: 311 EEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNIDK 370
           E I+ + LTK+F  GDLDI + +    EV K+  +  SFLK++GFR    C+ Y NNID+
Sbjct: 320 EVIE-EGLTKVFPYGDLDITITDEELNEVRKSYTEEESFLKIIGFRDYNKCIHYFNNIDR 378

Query: 371 VMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPNEG 430
            +FVVPDE ++  SI+ L SLFK LR KGK A++WGKLK NS+P++FVL PS  +DPNEG
Sbjct: 379 ALFVVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWGKLKTNSHPAVFVLSPSRNEDPNEG 438

Query: 431 FYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNPCI 490
           FYL+R+PF +E+R+ P  +      +T +Y  L   T+ I+ +F    GY P + +NP +
Sbjct: 439 FYLYRIPFAEELRRFPQSLIRHNSYDTPEYNQLKDTTKSIIDHFQFAKGYRPSEFRNPDL 498

Query: 491 QKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXXXXXXXXXXXDAGAQK 550
           QK+FKILHDYLLQ+E +  D+S    KQRLL EDD+L K+              D    +
Sbjct: 499 QKHFKILHDYLLQVEQEEEDDSPESSKQRLLSEDDSLLKLAQIRDKIMDSAQSSDPKKFQ 558

Query: 551 LSKYIKVWNNFYAKIEKESVSLEPSKTKKRKP 582
           L +Y ++WN  Y  + K +   +  + K ++P
Sbjct: 559 LDEYFQLWNRLYEDVSKATTLEDAPRPKPKQP 590

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/582 (46%), Positives = 379/582 (65%), Gaps = 13/582 (2%)

Query: 3   GVDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXX 61
           G   E+N+      Y+KF+ HE ++F +ELS+ MF+   +L  K                
Sbjct: 9   GNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQ 68

Query: 62  XXVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXF 121
             + RP  AIGCYF+YC +E    GIYE FPL DINA  MKK                 +
Sbjct: 69  LVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDY 128

Query: 122 F---QYNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSI 178
           F   Q  + K+  +  LFTF L+ F  E+ GQ++ + +R+FLFTD D P + +D + ++ 
Sbjct: 129 FMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERAR 188

Query: 179 LRKIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSST----EYDGPNTTPI 234
           LR++  DL ++ VNF  FFIG  D PF++  YS+IL+LG+  + +T    E+DGP+T PI
Sbjct: 189 LRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKPI 248

Query: 235 QASYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENL 294
            A YIKS++LRK+E+KR+ F+CPLIL+EK NFIVG++GY   +HEK   RYKLVYE+E++
Sbjct: 249 DAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDI 308

Query: 295 RQEAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVG 354
           RQEA+S+RKFL+  T E++ GK + K++  GDLDI + + +   V +A     +FLK++G
Sbjct: 309 RQEAYSKRKFLNPITGEDVTGKTV-KVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIG 367

Query: 355 FRSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNP 414
           FRS    + Y NNIDK  F+VPDE +Y  SI+ L SL K LR K K AI+WGKLK+NS+P
Sbjct: 368 FRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHP 427

Query: 415 SLFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECG-ENTSDYENLIKVTEYIMAY 473
           SL+ L PS  KD NEGFYL+RVPFLDEIRK P++++Y+ G E+  DY+N+ KVT+ IM Y
Sbjct: 428 SLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKVTQSIMGY 487

Query: 474 FNLKGGYNPMDLKNPCIQKYFKILHDYLLQIEDKTSDESST--ERKQRLLREDDTLRKVX 531
           FNL+ GYNP D KNP +QK++K+LHDYLLQIE  T DE+ T   +K R++REDD+LRK+ 
Sbjct: 488 FNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIE-TTFDENETPNTKKDRMMREDDSLRKLY 546

Query: 532 XXXXXXXXXXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSLE 573
                        D   Q+L+KY+K+WN FY K   +++S++
Sbjct: 547 YIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIK 588

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  513 bits (1320), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 266/591 (45%), Positives = 375/591 (63%), Gaps = 12/591 (2%)

Query: 3   GVDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXX 61
           G   E+N+   +A Y+KF+ HE ++F VELS+ MF+   EL+ K                
Sbjct: 9   GGIGELNDVMDDAGYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILESLNELMSQ 68

Query: 62  XXVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXF 121
             + RP  AIGCYF+YC ++    GI+EF PL DINA  MK+                 +
Sbjct: 69  LVITRPGTAIGCYFYYCSRDDAKQGIFEFSPLRDINATFMKRLNDLLEDLSSGRMTLYEY 128

Query: 122 FQYNNAKK---TSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSI 178
           F +   +K     +  LFTF L+ F  ++ GQR+ + +++FLFTDND P + +D + ++ 
Sbjct: 129 FNFQPTEKQRQMPLGVLFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEAQDTDDRAR 188

Query: 179 LRKIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDS----STEYDGPNTTPI 234
           LR +  DL ++ VNF  FFIG  +  F++  YS+IL+LG+  +     ++E+DGPNT PI
Sbjct: 189 LRSLTIDLFDNKVNFSTFFIGYANKSFDNEFYSDILQLGSHTNKGVGLNSEFDGPNTKPI 248

Query: 235 QASYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENL 294
            A YIKSK+LRK+EIKR+ F+CPL+  E ++F VG++GY   SHEK   RYKLVYE+E++
Sbjct: 249 NAKYIKSKILRKKEIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKLVYEHEDV 308

Query: 295 RQEAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVG 354
           R+EAFS+RKFL+  T E++    + K++  GDLDI   E +   V +A     +FL+++G
Sbjct: 309 RREAFSKRKFLNPMTGEDVTSSTV-KVYPYGDLDINFSENQNQIVMEAYTQKDAFLRIIG 367

Query: 355 FRSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNP 414
           FRS    + Y NNI+K  F+VPDE +Y  S++ LTSLFKTLR K K AI+WGKLK NS+ 
Sbjct: 368 FRSSSKAIHYFNNIEKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGKLKTNSHA 427

Query: 415 SLFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTS-DYENLIKVTEYIMAY 473
           SLFVL PS  K+ NEGFYL+RVPFLDEIRK P++++Y+ GE    DYEN+ K+T+ IM Y
Sbjct: 428 SLFVLSPSSIKEYNEGFYLYRVPFLDEIRKFPSLLSYDNGEKYKLDYENMKKITQNIMGY 487

Query: 474 FNLKGGYNPMDLKNPCIQKYFKILHDYLLQIEDKT-SDESSTERKQRLLREDDTLRKVXX 532
           FNLK GYNP D +NP +QK+FK+LHDYLLQIE     +E+   +  R++ EDD+LRK+  
Sbjct: 488 FNLKDGYNPSDFRNPSLQKHFKVLHDYLLQIETTPEGNETPDAKLNRIIHEDDSLRKLYH 547

Query: 533 XXXXXXXXXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSL-EPSKTKKRKP 582
                       D   Q+L+KY+K+WN FY K   +S+S+ E  K   +KP
Sbjct: 548 IRNKILDSEKSEDPAIQRLNKYVKIWNVFYNKFNDDSISVKEEKKPLDKKP 598

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  504 bits (1297), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 257/580 (44%), Positives = 369/580 (63%), Gaps = 11/580 (1%)

Query: 3   GVDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXX 61
           G   + N +     Y+KF+ HE ++F VELS+ MF+   EL+ K                
Sbjct: 9   GSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQ 68

Query: 62  XXVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXF 121
             + RP  AIGCYF+YC ++    GIYE FPL DIN + MKK                 +
Sbjct: 69  LVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEY 128

Query: 122 FQYN---NAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSI 178
           F +    N K+  +  LFTF L+ F  + +GQ++   +R+FLFTDND P + ++ + ++ 
Sbjct: 129 FNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRAR 188

Query: 179 LRKIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSS----TEYDGPNTTPI 234
           LR++  DL ++ +NF  FFIG  +  F++  YS+IL+LG+ K+ +    +E+DGPNT PI
Sbjct: 189 LRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPI 248

Query: 235 QASYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENL 294
            A YIKS++LRKRE+KR+ F+C LI +EK +FI+G++GY   SHEK   RYKLVYE+E++
Sbjct: 249 DAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDI 308

Query: 295 RQEAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVG 354
           RQEA+S+RKFL+  + E++    + K++  GDLDI + E +   V +A     +FLK+ G
Sbjct: 309 RQEAYSKRKFLNFMSGEDVTDNTV-KVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITG 367

Query: 355 FRSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNP 414
           FRS    + Y NNI+K  F+VPDE +Y  SI+ LTSL K LR K K AI+WGKLK+NS+P
Sbjct: 368 FRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHP 427

Query: 415 SLFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTS-DYENLIKVTEYIMAY 473
           SLFVL PS  K+ NEGFYL+RVPFLDEIRK P++++Y+ G +   DY+N+ KVT+ I+ Y
Sbjct: 428 SLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGY 487

Query: 474 FNLKGGYNPMDLKNPCIQKYFKILHDYLLQIEDK-TSDESSTERKQRLLREDDTLRKVXX 532
           FNL+ GYNP D KNP +QK++K+LHDYLLQ E     +E+S  +  R++ EDD+LRK+  
Sbjct: 488 FNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYH 547

Query: 533 XXXXXXXXXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSL 572
                       D   Q+L+KY+K+WN FY K   + +S+
Sbjct: 548 IRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISV 587

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  501 bits (1290), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 255/573 (44%), Positives = 355/573 (61%), Gaps = 12/573 (2%)

Query: 12  DQNASYKKFESHEAMIFSVELSDGMFETVPELNKXXXXXXXXXXXXXXXXXXVVRPNAAI 71
           D  + YKKFE HE +IF VELS+ MF+   +LNK                  ++ P   I
Sbjct: 11  DSESKYKKFEVHEGIIFCVELSEAMFKEPFDLNKVQLLEILETLLELMTQVIIILPGTGI 70

Query: 72  GCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQYNNAKKTS 131
           GC+F  C  EG   GIYEF PL D+NA++MKK                  F +N+ + TS
Sbjct: 71  GCFFFQCSHEGAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPFNDKQNTS 130

Query: 132 MEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLDESHV 191
           +E +F     QFS  V GQ+ Y  ++IFLFTDND P + +D+EAK+ LRK++DDLD+S +
Sbjct: 131 LEAVFVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRKVIDDLDDSFI 190

Query: 192 NFVPFFIGRPDAPFNSALYSEILKLGARKDSST---EYDGPNTTPIQASYIKSKVLRKRE 248
           N +PFF+G    PF+ + YS+ILKLGA+K +S    +Y+GPNTTPI A  IKS+VLRK+E
Sbjct: 191 NIIPFFVGSEQRPFDQSFYSDILKLGAKKKASDGPFKYEGPNTTPISAKLIKSRVLRKKE 250

Query: 249 IKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSE 308
           IKRV F+C LILNE  +F V ++GY  +SHE+  ++YK VY+++ LR+EA S RK+L + 
Sbjct: 251 IKRVRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGLRKEALSHRKYLDAN 310

Query: 309 TAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNI 368
           T E++  + + K+F   ++DIE+ E    ++ +      SFLK+VGFR    CV Y NNI
Sbjct: 311 TGEDVT-ERVVKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVGFRDTNRCVFYFNNI 369

Query: 369 DKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPN 428
               FVVPD+  +  SIK + SLF+ LR K K+A++WGKLK+NSNPSL+ L PS   D N
Sbjct: 370 SNSSFVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNPSLYTLTPSNFNDHN 429

Query: 429 EGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNP 488
           EGFYL RVPF+DEIRK P    +     T  +E + K+TE +++YF+L+  Y P D +NP
Sbjct: 430 EGFYLTRVPFIDEIRKFPPTAYHGNLSKTKTFEQMCKITETLISYFSLRHSYRPSDFENP 489

Query: 489 CIQKYFKILHDYLLQIE-DKTSDESSTERKQRLLREDDTLRKVXXXXXXXXXXXXXXDAG 547
            +QK+F++LHDYLLQ+E D TS       K+ LL++DDTL K+              D  
Sbjct: 490 TLQKHFELLHDYLLQVEVDPTSGS-----KEHLLKKDDTLLKLHQVRAKILESAESDDPV 544

Query: 548 AQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKR 580
             +LS Y+K WN+ Y +  + +  LEP  T K+
Sbjct: 545 QARLSNYVKAWNSMYNR--ELNGDLEPETTSKK 575

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  501 bits (1289), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 256/582 (43%), Positives = 359/582 (61%), Gaps = 11/582 (1%)

Query: 4   VDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXXX 62
           VD     DDQ   YKK+E H  ++F +EL+  M+  V ELN K                 
Sbjct: 7   VDGSNYGDDQTV-YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQL 65

Query: 63  XVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFF 122
            V  PN  +GCYF  C K+ +++GIYEF PL D+NAKNMKK                  F
Sbjct: 66  IVTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKF 125

Query: 123 QYNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKI 182
            +  +   S+E +  F   QF  E+  ++ Y   ++FLFTDN  P   E+ E++S LRKI
Sbjct: 126 PFVPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKI 185

Query: 183 VDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKD---SSTEYDGPNTTPIQASYI 239
           V+DL++ ++NF PFFI   + PF+ + YS+ILKL A+ D    S  +DGPNTTPI ASYI
Sbjct: 186 VNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYI 245

Query: 240 KSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAF 299
           KS+V RK+E +RV F+CPLIL+++ NF + ++GY  +SHEK  TRYKLVYE E LR+EAF
Sbjct: 246 KSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAF 305

Query: 300 SRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIK 359
           S R++L + T  ++  K + KIF  GD +IE+ +    +++K D +  SFLK++GFRS  
Sbjct: 306 SHRRYLDASTGVDVSDK-VAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTD 364

Query: 360 SCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVL 419
            C+ Y NN+DK  FVVPDE  Y  SI+ + SL++ LRTKGK+A++WGKLK NSNP ++++
Sbjct: 365 QCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLM 424

Query: 420 EPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGG 479
            PS E DPNEGFYL R+PF+DEIR+ P++  Y    ++ DY ++ + TE I+AYFNL+ G
Sbjct: 425 TPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNG 484

Query: 480 YNPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXXXXXX 539
           Y P + KNP +Q YF +LHD LL+      +ESS + +Q  L+ DDTL K+         
Sbjct: 485 YKPSEFKNPGLQHYFSLLHDQLLE----AKEESSADEEQESLK-DDTLLKLSQIRDKIIE 539

Query: 540 XXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRK 581
                + G Q+LSKY K WN  Y K   + +S E  + K ++
Sbjct: 540 SSKSDEPGRQRLSKYFKGWNTLYNKEYNQHLSFECGEKKTKR 581

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  496 bits (1276), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 256/581 (44%), Positives = 367/581 (63%), Gaps = 12/581 (2%)

Query: 4   VDSEVNED-DQNASYKKFESHEAMIFSVELSDGMFETVPEL-NKXXXXXXXXXXXXXXXX 61
            D EVN+  D    YKK+++HE ++F +EL+  +FE V  L  +                
Sbjct: 2   TDLEVNKTVDGEYGYKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQ 61

Query: 62  XXVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXF 121
             +VRP +++GC FHY    G   G+YEF PL D+NAK+MK                  +
Sbjct: 62  LVIVRPGSSVGCIFHYTDINGAVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQY 121

Query: 122 FQYNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRK 181
           F+++ +K  S+E+LF     ++S E    +K+T +R FLFTDND+P +  D EA   + K
Sbjct: 122 FKFDGSKHVSLERLFQLIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRISK 181

Query: 182 IVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSSTEYDGPNTTPIQASYIKS 241
           IVDDLDE+ V+F  FFIG  +APF++  YS +LKLGA+   S +YDGP+  PI  S IK+
Sbjct: 182 IVDDLDETAVSFTTFFIGSEEAPFDNRFYSNVLKLGAQLKHS-DYDGPSVRPITGSDIKA 240

Query: 242 KVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSR 301
           ++LR +EIKR  F+CPL LN+  NFI+G+RGY  V+HEK  TRYKL YE E++RQEAFS+
Sbjct: 241 RILRGKEIKRTMFQCPLYLNKDSNFIIGIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFSK 300

Query: 302 RKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSC 361
           RK+L+S+T EE+  K+++K+   GD++IE+      ++  + ++   F+KV+GFRS   C
Sbjct: 301 RKYLNSKTGEEVDPKDISKVIPYGDVNIELSAEALQQMRASYEEEGPFMKVLGFRSTDLC 360

Query: 362 VKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEP 421
           VKY NNIDK  F+VPDE+QY  SIK L SLF+TLR+K K+AIIWGK K+NSN +L+++ P
Sbjct: 361 VKYFNNIDKPSFIVPDELQYEGSIKTLASLFRTLRSKNKSAIIWGKPKSNSNSALYIMVP 420

Query: 422 SGEKDPNEGFYLHRVPFLDEIRKLPT-MITYECGENTSDYENLIKVTEYIMAYFNLKGGY 480
           S  +D N+GFY+HR+PFLDE+RK+P  M+  +  +  +D   L+ VTE I+ YFNL+ GY
Sbjct: 421 SHREDRNDGFYMHRIPFLDELRKVPIKMVDNDWTQLDND---LLTVTETILKYFNLRQGY 477

Query: 481 NPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXXXXXXX 540
            P + KNP IQ Y+K+LHDY+LQ+E+    E     ++ LLR+DDTL+K+          
Sbjct: 478 IPSEFKNPGIQNYYKVLHDYILQVEE-IKHEGWDFSQEELLRQDDTLKKI----SHIRGK 532

Query: 541 XXXXDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRK 581
               +   + LS Y+ +WN FY  +E  +V       KK K
Sbjct: 533 IEASNDSDKVLSGYMNMWNLFYKSLETNNVKWSEPVAKKAK 573

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  486 bits (1252), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 254/584 (43%), Positives = 369/584 (63%), Gaps = 18/584 (3%)

Query: 11  DDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXXXXVVRPNA 69
           D+  ASY+K+ESHE  +F +ELS+ MF  + +LN K                  + RP+ 
Sbjct: 29  DNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPST 88

Query: 70  AIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQYN--NA 127
            +GC+F  C  + +   IYEF PL DIN  +MKK                  F+++  N 
Sbjct: 89  GVGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEIND 148

Query: 128 KKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLD 187
           K  S+E LF    ++FS  + GQ+ YT +++FLFTDND P +  DKE    LR++ DD+ 
Sbjct: 149 KGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDIS 208

Query: 188 ESHVNFVPFFIGRPDAP--FNSALYSEILKLGARKDSSTEYDGPNTTPIQASYIKSKVLR 245
           ++++ FV FFI + D+   F+ + YS+ILKL  R  +S E+DGP+T PI  +YIK+KVLR
Sbjct: 209 DNYIQFVTFFINKIDSSDNFDDSFYSDILKL--RNSNSIEFDGPSTKPISVAYIKNKVLR 266

Query: 246 KREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFL 305
           K+EIKR+ F+CPLILN   +F V ++GY  +SHEK  +RYKLVYE+EN+R+EAFS+RK L
Sbjct: 267 KKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLL 326

Query: 306 SSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDD---VRSFLKVVGFRSIKSCV 362
           + +T   +   +  KIF LG+  I   E  F   EK +D+      FLK++GFRS ++ +
Sbjct: 327 NGKTGTVVTKDDTEKIFQLGNFSINSFENEF---EKGNDNPLPQEPFLKLIGFRSPENSL 383

Query: 363 KYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPS 422
              NNI K +F+VPDE + V SI+ L+S+++T+RTK + AI+WGKLK+NSNP++++L PS
Sbjct: 384 HLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPS 443

Query: 423 G-EKDPNEGFYLHRVPFLDEIRKLPTMITYECGE---NTSDYENLIKVTEYIMAYFNLKG 478
              KD NEGFYL++VPFLDEIRK+P+  T+   +      DYENL +VT  I+ YFNL  
Sbjct: 444 DPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTN 503

Query: 479 GYNPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTER-KQRLLREDDTLRKVXXXXXXX 537
           GY+P++ KNP +QKY+K+LHDYLLQ+E     E S E+ KQ++L EDDT+RK        
Sbjct: 504 GYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKI 563

Query: 538 XXXXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRK 581
                  ++  Q+LS    +WN+ Y+K+E   ++++  K KK+K
Sbjct: 564 IKSASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQK 607

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  469 bits (1206), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 235/568 (41%), Positives = 340/568 (59%), Gaps = 8/568 (1%)

Query: 17  YKKFESHEAMIFSVELSDGMFETVPELNKXXXXXXXXXXXXXXXXXXVVRPNAAIGCYFH 76
           Y+KFE HE +IF +ELS GMFE   ++NK                  +  P   IGCYF 
Sbjct: 10  YQKFEVHEGIIFCIELSKGMFEKSSDMNKVQLVEILETLLELMSQVIISLPGTGIGCYFF 69

Query: 77  YCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQYNNAKKTSMEKLF 136
           +CG E    GIYE  PL D+NA++MKK                  F  +    T +E +F
Sbjct: 70  HCGHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPLDEQLSTPLETVF 129

Query: 137 TFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLDESHVNFVPF 196
                QF  +V GQ+ Y  ++IFLFTDNDSP +  D + +  LRK+VDDLD+ H+NF  F
Sbjct: 130 ILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCHINFTTF 189

Query: 197 FIGRPDAPFNSALYSEILKLGARKDSS---TEYDGPNTTPIQASYIKSKVLRKREIKRVA 253
           FIG    PF+ + YS+ILKLGA+K +S   + ++GP+T PI A+ IK++ LRK+EIKR+ 
Sbjct: 190 FIGTEQKPFDQSFYSDILKLGAKKTASQGGSTFNGPSTAPINANLIKARALRKKEIKRIR 249

Query: 254 FRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSETAEEI 313
           F+C L LNE  +F V ++GY  VSHE+  T+YK VY++  LR+E  S RK+L++ T E++
Sbjct: 250 FQCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKYLNANTGEDV 309

Query: 314 KGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNIDKVMF 373
               + ++F   ++DIE  E    ++ K      SFLK++GFR    C+ + +NI    F
Sbjct: 310 T-DSIARVFRFAEIDIEFSEEELAKISKDYSPNDSFLKLIGFRDTSKCLFFYDNIGNSSF 368

Query: 374 VVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPNEGFYL 433
           VVPDE     SIK ++SLF++L  K K+A++WGKLK+NSNP++++L PS  KD NEGFYL
Sbjct: 369 VVPDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPSTSKDLNEGFYL 428

Query: 434 HRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNPCIQKY 493
            RVPF+DE+RK P +  Y+      ++E + K+TE +++YF+L+  Y P D KNP +QK+
Sbjct: 429 TRVPFVDEVRKFPPIPRYDEELGGKNFEQMCKITETLISYFSLRRPYKPSDFKNPTLQKH 488

Query: 494 FKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXXXXXXXXXXXDAGAQKLSK 553
           FK+L+DYLLQ+E   S ES        L+ DDTL K+              D   ++L  
Sbjct: 489 FKLLYDYLLQVEVDCSSESV----DGALKHDDTLLKLYQVRRKIQESLSSKDPEEERLGT 544

Query: 554 YIKVWNNFYAKIEKESVSLEPSKTKKRK 581
           Y+K WN+ Y KI  + ++ +    K++K
Sbjct: 545 YVKAWNSLYNKISNQELTPDKGMKKQKK 572

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  465 bits (1197), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/634 (41%), Positives = 364/634 (57%), Gaps = 54/634 (8%)

Query: 9   NEDDQNASYKKFESHEAMIFSVELSDGMFETVPEL-NKXXXXXXXXXXXXXXXXXXVVRP 67
           N+  +NASYKKF  HE +IF VELS  MFE +PEL  K                  + RP
Sbjct: 15  NDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRP 74

Query: 68  NAAIGCY-FHYCGK--EGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQY 124
           N AIG Y FH+     E N +GIYEFF LSDIN K MKK                  F++
Sbjct: 75  NTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKF 134

Query: 125 NNAKKTSMEKLFTFYLNQFSM--EVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKI 182
           +N++ T +E +F     QF     +   + +  +++FLFT+ND PI+ E+ E +  LR++
Sbjct: 135 DNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRM 194

Query: 183 VDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSS-----TEYDG--------- 228
           V+DL+ES + F  FFI +PD+ F+   YS+ILKL    D+S       YD          
Sbjct: 195 VNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYL 254

Query: 229 ---------------------------PNTTPIQASYIKSKVLRKREIKRVAFRCPLILN 261
                                      PNT PI+AS IK ++LRK+EI+RV F+CPLIL+
Sbjct: 255 LINDLKDTSKSKTTDRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILD 314

Query: 262 EKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSETAEEIKGKELTKI 321
           E  NFI+G+ GY   S EK  TRYKLVYE+EN+R+EAFSRRKFL   T EE+K ++  K+
Sbjct: 315 EASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKV 374

Query: 322 FTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNIDKVMFVVPDEMQY 381
           +  GD++IE+ +     ++    + R F+K++GFRS    +KY NNIDK  FVVPDE  Y
Sbjct: 375 YKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSY 434

Query: 382 VNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPNEGFYLHRVPFLDE 441
             SIK + SLF+TL  K K AI+WG   +  +P++ +L PS E + NEG YL +VPFLDE
Sbjct: 435 EGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDE 494

Query: 442 IRKLPTMITYECG--ENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNPCIQKYFKILHD 499
           IR+ P + +Y  G  +N S+YE + K+TEYI+   +L+ GY P   +NP +QKY+KILHD
Sbjct: 495 IRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHD 554

Query: 500 YLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXXXXXXXXXXXDAGAQKLSKYIKVWN 559
           YLLQIED +  ++  E  +R + EDDTL ++              +   Q+LSK+I+ WN
Sbjct: 555 YLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWN 614

Query: 560 NFYAKI-EKESVSLEPS----KTKKRKPAPTLNL 588
             + KI E   + +EP+    K +K+K    LNL
Sbjct: 615 RVFKKINEDAQMDIEPTPVTLKKRKQKEKLALNL 648

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  440 bits (1132), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 227/585 (38%), Positives = 350/585 (59%), Gaps = 18/585 (3%)

Query: 6   SEVNEDDQNASYKK---FESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXX 61
           ++  +DD+ + +KK   +E+H+ ++F ++L+  M+ + P+L  K                
Sbjct: 14  TQTRDDDKESDHKKWRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQ 73

Query: 62  XXVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXF 121
             VV P+ A+GCY + C     +  +YE  PL D+N KNMK+                  
Sbjct: 74  LVVVMPSTAVGCYIYNCSHPNAEDNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLKDE 133

Query: 122 FQYNNAKK-TSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILR 180
               +      +  +       F   + GQ++ T ++IF FTD+D P +  + +++S LR
Sbjct: 134 IPIADPNNPIELSPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLR 193

Query: 181 KIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSSTEY---DGPNTTPIQAS 237
           K+VDDL + ++NFV FFIG  D PF+ ++Y++ILK G++ + +  +    GP+T PI AS
Sbjct: 194 KVVDDLYDYYINFVTFFIGSEDKPFDDSMYADILKWGSKINEAQSWLSSHGPSTNPINAS 253

Query: 238 YIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQE 297
           YIKSKV R +EIKR+ FRCPL+L+E+ + +V + GY  VSHE   ++YKLVY   ++R+E
Sbjct: 254 YIKSKVKRTKEIKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRRE 313

Query: 298 AFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRS 357
           A+S R++L +ET E +   +L+K++T GD  IE+ E    +++    +  SFLK++GFRS
Sbjct: 314 AYSHREYLDAETGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRS 373

Query: 358 IKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLF 417
            + C+ Y +NID   FVVP+E  Y  SIK L SL++T+  K K+A++WGKL+ NS PS+F
Sbjct: 374 TEQCLHYYDNIDVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMF 433

Query: 418 VLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLK 477
           VL PS +KD N+GFYL++VPF++E+RKLP  + +     + DY+ + KVTE ++ +FNLK
Sbjct: 434 VLTPSSKKDYNQGFYLYKVPFMEEVRKLPDFLNHSALIESDDYKVMSKVTETLINFFNLK 493

Query: 478 GGYNPMDLKNPCIQKYFKILHDYLLQIE-DKTSDESSTERKQRLLREDDTLRKVXXXXXX 536
            GY P D  NP +QK+FKIL +YLLQIE DK+  E            D+TL+KV      
Sbjct: 494 NGYRPSDFHNPALQKHFKILREYLLQIEVDKSKPEDEG---------DETLQKVKQIYAR 544

Query: 537 XXXXXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRK 581
                   D   Q+L KY+K+WN+FY ++    V  +P+K KK K
Sbjct: 545 IASSAKSDDVKQQRLVKYLKLWNSFYNRLSNLEVDTKPTKNKKAK 589

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  425 bits (1093), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 224/486 (46%), Positives = 317/486 (65%), Gaps = 10/486 (2%)

Query: 5   DSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXXXX 63
           +SEV  D +  SY+K++ HE ++F VELS+ MF+ +PELN K                  
Sbjct: 30  ESEV-PDGKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLV 88

Query: 64  VVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQ 123
           + RP   +GCY + C K+ ++  I+ F PL D+N K MKK                 +F 
Sbjct: 89  ITRPGTGVGCYIYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFP 148

Query: 124 YNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIV 183
           Y+  ++T +E L     ++    V+  + +  +++FLFTDNDSP +  DK  K+ LR++ 
Sbjct: 149 YDKTQRTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLF 208

Query: 184 DDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSSTEY----DGPNTTPIQASYI 239
           DD +E+ + FVPFFI R + PF+S+ YS+I KLG  ++ S++Y    DGP+T PI ASYI
Sbjct: 209 DDNNENFITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYI 268

Query: 240 KSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAF 299
           KS+VLRK+EIKRV F+C LILN++ NF V ++GY  VS EKV +RYK+VYE+E++R+EAF
Sbjct: 269 KSRVLRKQEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAF 328

Query: 300 SRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIK 359
           S+RK L+  TAEE+K + LTK+F  GDL+IE+ E    +V++A  +   FLK++GFRS++
Sbjct: 329 SKRKILNCITAEEVK-EGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLE 387

Query: 360 SCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVL 419
             + Y NNI K  FVVPDE +   SI++L SLF+T+R K K A++WGKLK NS+P L+VL
Sbjct: 388 ISLHYYNNITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVL 447

Query: 420 EPSGEKDPNEGFYLHRVPFLDEIRKLPTMITY---ECGENTSDYENLIKVTEYIMAYFNL 476
             S   DPNEGF+L+R+PFLDEIRK P + T    E   NT +YEN+ + TE I+ YFNL
Sbjct: 448 SASNASDPNEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNL 507

Query: 477 KGGYNP 482
           K GY P
Sbjct: 508 KHGYIP 513

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  424 bits (1089), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 226/593 (38%), Positives = 351/593 (59%), Gaps = 17/593 (2%)

Query: 5   DSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KXXXXXXXXXXXXXXXXXX 63
           D EVN   + AS+K+FE HE ++F +ELS+ MFE   EL+ K                  
Sbjct: 22  DGEVN---KQASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELLI 78

Query: 64  VVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQ 123
           V RP+ AIGCYF+ C +E +   I+EF PL D+N + MKK                 +  
Sbjct: 79  VTRPSTAIGCYFYNCEREDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYLN 138

Query: 124 YN--NAKKTS----MEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKS 177
           YN    KK +    +EKLF+  L  F+  + GQ+++  +++FLFTDND P  +  + +  
Sbjct: 139 YNIDQNKKLNIPILLEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVESQQRSID 198

Query: 178 ILRKIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDS--STEYDGPNTTPIQ 235
           +L+ I+ D+D++ +NF  FFI + D PFN A YS++L+     +S  S  Y GP+T PI 
Sbjct: 199 VLKGILKDIDDNMINFTNFFISKKDKPFNPAFYSKVLRNDRDYNSLGSQAYFGPSTKPIG 258

Query: 236 ASYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLR 295
            + IK ++ +++EI+RV F+CPL+L+E  NF++ ++GY   +HEK + RYKLVYE + +R
Sbjct: 259 VNDIKERIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVYENQEIR 318

Query: 296 QEAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGF 355
           +EAFS+RKF++ +T E++  K+  KI   G+ +IE++++          +  + L V+GF
Sbjct: 319 KEAFSKRKFINPKTGEDV-SKQTVKIIPYGEKEIEMEDKNIANALNVYGNTSASLTVIGF 377

Query: 356 RSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPS 415
            +  + + + NNIDK +F+ PDE     S     SLF+TL+   K  ++WG  K+NS+PS
Sbjct: 378 LNEDNSLVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTKSNSSPS 437

Query: 416 LFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFN 475
           L++L PS + D N+GFYL +VPF+DEIRK PT+      E   +Y+N+ ++T+ I+++FN
Sbjct: 438 LYLLWPSKDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWEEYKNVKELTQGIISHFN 497

Query: 476 LKGGYNPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXX 535
           LK GY+  + +NP + +++K+LHDYLLQ+E    D    + + R LREDDTL K+     
Sbjct: 498 LKSGYHAEEFRNPALNRHYKLLHDYLLQVEIPQDD---NDIRDRYLREDDTLLKITKIRE 554

Query: 536 XXXXXXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRKPAPTLNL 588
                    D   ++LSKY++VWN +Y K  KE  +   S   K +  P LNL
Sbjct: 555 RIMKDTTIDDVEKRRLSKYLEVWNIYYRKF-KEDTNQTSSSLLKSEKKPKLNL 606

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/592 (35%), Positives = 326/592 (55%), Gaps = 37/592 (6%)

Query: 2   SGVDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPEL-NKXXXXXXXXXXXXXXX 60
           S +DS  +++D +  + ++  HE ++F VELS  M++  PEL  K               
Sbjct: 11  SILDSTADKED-DKRHLRYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELME 69

Query: 61  XXXVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXX 120
               V P+  +GCYF  C       GIYE FPL D+N  +MKK                 
Sbjct: 70  QLVAVMPDTGVGCYFFQCRHREAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEE 129

Query: 121 FFQYNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILR 180
              Y+    TS++ +FT   +QF  EV  QR Y  ++IFLFTDNDSP +KE   +++ LR
Sbjct: 130 ELPYDGRHPTSLDVVFTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLR 189

Query: 181 KIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGAR----KDSSTEYDGPNTTPIQA 236
           K+VDDL++ ++NF  FFIG    PF+ + YS+ILKLGA+      S   YDGP+T PI  
Sbjct: 190 KVVDDLNDYYINFSTFFIGTEQRPFDESFYSDILKLGAQVAAEGSSKPLYDGPSTKPISV 249

Query: 237 SYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQ 296
           SYI+S+VLRK+E++R+ + CPL LNE++  +V ++GY   ++E+   RY++VY++E++++
Sbjct: 250 SYIRSRVLRKKEVRRLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQR 309

Query: 297 EAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERR-----FFEVEKADDDVRSFLK 351
           EAFS R++L  +T EE   ++L K++ +GD  +++ +        F    +D    SFL+
Sbjct: 310 EAFSHRRYLDPDTGEEAT-EDLCKVYQIGDDCLDLPDDLENLITNFAAPTSD----SFLR 364

Query: 352 VVGFRSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKAN 411
           ++G R+  + + Y NNI  V F+VPD+  Y  S  +L SL +TLR   +A +++GKL+A 
Sbjct: 365 MLGSRTAVAVLPYYNNIHHVTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRAT 424

Query: 412 SNPSLFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIM 471
           S P+L+ L P+    P+  F L R+PF +E+RK P +   +    + DY  L K+T  I+
Sbjct: 425 SLPALYALAPAAAPLPDAVFILARLPFQEEVRKFPALSPPQASLASPDYAVLQKITSRII 484

Query: 472 AYFNLKGGYNPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVX 531
               L   Y P D KNP I  +F++L D+L +                  R DDT+    
Sbjct: 485 DLLVLSSPYAPADFKNPVIATHFRLLSDHLFETAQDP-------------RTDDTI---- 527

Query: 532 XXXXXXXXXXXXXDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSK-TKKRKP 582
                        D    +L+KY++ WN FYA+  ++  S  P+K +K+R+P
Sbjct: 528 --ARLLRLRHRVLDDPESRLAKYLRHWNAFYAR-HQQVASPSPTKYSKRRRP 576

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  273 bits (699), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 166/563 (29%), Positives = 279/563 (49%), Gaps = 12/563 (2%)

Query: 13  QNASYKKFESHEAMIFSVELSDGMFETVPELNKXXXXXXXXXXXXXXXXXXVVRPNAAIG 72
           Q++   K E  +++I  +ELS  ++++     K                  ++ PN+ + 
Sbjct: 11  QHSKNIKHERRQSIIVCIELSSRVYQSSEISPKAQLAEMLEALLELMKQLAMLLPNSEVC 70

Query: 73  CYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQYNNAKKTSM 132
           CY + C +     GIYE  PL  +N + + K                    +     + +
Sbjct: 71  CYVYQCRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPL 130

Query: 133 EKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLDESHVN 192
             +     +Q   +   + K+  +RI L T ND P +  D E +   +  ++ L +   +
Sbjct: 131 SSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFS 190

Query: 193 FVPFFIGRPDAPFNSALYSEILKLGARKDSSTE----YDGPNTTPIQASYIKSKVLRKRE 248
            V FFI     PFN   Y+++LK   R +   +    YDGPNT PI+   +K K+L+K+E
Sbjct: 191 IVTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTKPIEIKELKGKLLQKKE 250

Query: 249 IKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSE 308
             +  F+C  I+N++ +FI+ L+G+  ++ EK   R+K +Y+     Q+AFS RKF ++ 
Sbjct: 251 GNKFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNAN 310

Query: 309 TAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNI 368
             E    + LTK+F +G L+IE  E +  ++  +  +  +FL+++GFRS+     Y NNI
Sbjct: 311 DGEAADSR-LTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNI 369

Query: 369 DKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPN 428
               +V+PD+  Y  S K L+ L+ ++  KGKAAI+WGKL   ++P LF++     K+ N
Sbjct: 370 STSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTN 429

Query: 429 EGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNP 488
           +GFYL R+PF++EIR+ P  +      N  +Y  + K+T  I+A+FNLK  Y   +  +P
Sbjct: 430 QGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSP 489

Query: 489 CIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXXXXXXXXXXXDAGA 548
            ++ ++  L D LLQ     SD+     K   L  D TL KV              +   
Sbjct: 490 VLKSFYTTLSDKLLQ--KSLSDQWGMGFK---LSNDITLGKVQHLRELINKSSQNMEQPI 544

Query: 549 QKLSKYIKVWNNFYAKIEKESVS 571
             L+KY+K WN +Y K    S++
Sbjct: 545 --LAKYMKYWNTYYNKEGNNSIT 565

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  223 bits (567), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 139/512 (27%), Positives = 254/512 (49%), Gaps = 28/512 (5%)

Query: 64  VVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKXXXXXXXXXXXXXXXXXFFQ 123
           +V+PN+A+GC     G+   D GI E FPL  ++A N  +                  F 
Sbjct: 69  IVQPNSAVGCLTFRNGRRAED-GIVEAFPLRPLDA-NYVRNISDCVADLEETGMVGQHFP 126

Query: 124 YNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIV 183
           +      S++ +       F+ +          RIFL TD D+P++  D      ++  +
Sbjct: 127 FTATVPASLDVMLAASDRYFTEDTQNAD----NRIFLVTDVDTPVEFTDPIRLEKVQARL 182

Query: 184 DDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSSTEYDGP----NTTPIQASYI 239
             L    ++   FF+    A FN + Y+EILK       + E+  P    +T+P+    +
Sbjct: 183 LSLYRRRIDITTFFLHTEHAAFNDSSYAEILK-------TREWGIPGAPQSTSPLSICKL 235

Query: 240 KSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAF 299
           + K+L ++++ R  F CPL++N+  + +V + GY+  +HE+  TRYK + +++   +   
Sbjct: 236 REKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVH 295

Query: 300 SRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIK 359
             RK+ + +  + I+  + + ++ +G   IEV +    ++ +      SFL+++GFR+I 
Sbjct: 296 QCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAIN 355

Query: 360 SCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVL 419
           +   Y +NI +  +++P E+ +  S K+L SL +++  KGKAAI+WG+LKA  +P+LF L
Sbjct: 356 TAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFAL 415

Query: 420 EPS-GEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKG 478
            PS GE        L R+PF++E+R  PT+   +   +T +YE +  V++ ++ +F+L+ 
Sbjct: 416 IPSDGE---TCALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRT 472

Query: 479 GYNPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVXXXXXXXX 538
            Y P D++NP ++ ++  L+      E     +      Q L   D TL KV        
Sbjct: 473 SYRPSDIRNPLLRNFYSTLYH-----EQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIE 527

Query: 539 XXXXXXDAGAQKLSKYIKVWNNFYAKIEKESV 570
                 +     +S+YI  WN +Y  I  ++V
Sbjct: 528 NSIIHDEPPI--ISEYINCWNIYYNHIIDKAV 557

>TDEL0B06930 Chr2 complement(1225098..1225817) [720 bp, 239 aa] {ON}
           Anc_2.600 YMR038C
          Length = 239

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 358 IKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLF 417
           IKSC++ I+ I+ + F +  ++  VN     +S+   LR  G+ AII G  K NS+ ++ 
Sbjct: 24  IKSCLQEIHGIEGMQFDLGQQIMSVNGNVAPSSIISALRRCGRDAIIRGTGKPNSS-AVS 82

Query: 418 VLEPSGEKDPNEGFYLHRVPFLDEIRKL 445
           +LE    KDP     L R+  + E R L
Sbjct: 83  ILESHEGKDPLTVRGLVRMVQVAEKRTL 110

>Suva_13.207 Chr13 complement(337909..338658) [750 bp, 249 aa] {ON}
           YMR038C (REAL)
          Length = 249

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 358 IKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLF 417
           IK+C+K +  ID + F +  ++  V S    +++  TLR+ GK AII G  K NS+ ++ 
Sbjct: 24  IKTCLKDVPGIDSLNFDMDQQIMSVESSVAPSTIINTLRSCGKDAIIRGAGKPNSS-AVA 82

Query: 418 VLE 420
           +LE
Sbjct: 83  ILE 85

>Skud_13.194 Chr13 complement(334081..334830) [750 bp, 249 aa] {ON}
           YMR038C (REAL)
          Length = 249

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 358 IKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLF 417
           IKSC+K +  I+ + F +  ++  V+S    +++  TL++ GK AII G  K NS+ ++ 
Sbjct: 24  IKSCLKDVPGINSLNFDIDQQIMSVDSSVAPSTIINTLQSCGKDAIIRGAGKPNSS-AVA 82

Query: 418 VLE 420
           +LE
Sbjct: 83  ILE 85

>YMR038C Chr13 complement(347511..348260) [750 bp, 249 aa] {ON}
           CCS1Copper chaperone for superoxide dismutase Sod1p,
           involved in oxidative stress protection;
           Met-X-Cys-X2-Cys motif within the N-terminal portion is
           involved in insertion of copper into Sod1p under
           conditions of copper deprivation
          Length = 249

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 358 IKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLF 417
           IK+C+K +  I+ + F +  ++  V S    +++  TLR  GK AII G  K NS+ ++ 
Sbjct: 24  IKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIRGAGKPNSS-AVA 82

Query: 418 VLE 420
           +LE
Sbjct: 83  ILE 85

>CAGL0F06017g Chr6 complement(601431..602150) [720 bp, 239 aa] {ON}
           highly similar to uniprot|P40202 Saccharomyces
           cerevisiae YMR038c LYS7
          Length = 239

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 358 IKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLF 417
           IK C+  I  I  + F +  +M  VNS    + +   LR  G+ AII G  K NS+ ++ 
Sbjct: 25  IKKCLNGITGIKDLQFDISQQMMSVNSCVAPSVIINALRDCGRDAIIRGAGKPNSS-AVA 83

Query: 418 VLE 420
           +LE
Sbjct: 84  ILE 86

>Smik_13.208 Chr13 complement(341587..342336) [750 bp, 249 aa] {ON}
           YMR038C (REAL)
          Length = 249

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 358 IKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLF 417
           IK+C+K +  I+ + F +  ++  V S    +++  TL++ GK AII G  K NS+ ++ 
Sbjct: 24  IKACLKDVPGINSLNFDIGQQIMSVESSVAPSTIINTLQSCGKDAIIRGTGKPNSS-AVA 82

Query: 418 VLE 420
           +LE
Sbjct: 83  ILE 85

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,125,969
Number of extensions: 2672519
Number of successful extensions: 8371
Number of sequences better than 10.0: 45
Number of HSP's gapped: 8516
Number of HSP's successfully gapped: 46
Length of query: 588
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 473
Effective length of database: 40,294,809
Effective search space: 19059444657
Effective search space used: 19059444657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)