Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L015007.353ON27927913720.0
NCAS0E028507.353ON2812886229e-80
Skud_12.2637.353ON2742816201e-79
Suva_10.2947.353ON2752816165e-79
Smik_12.2587.353ON2742826071e-77
TDEL0C019507.353ON2732815852e-74
YLR199C (PBA1)7.353ON2762835759e-73
Kpol_530.287.353ON2742865741e-72
KNAG0B026007.353ON2792815629e-71
TPHA0F030007.353ON2822895351e-66
TBLA0E020707.353ON2522875303e-66
ZYRO0F11770g7.353ON2722815081e-62
CAGL0A03993g7.353ON2722814881e-59
NDAI0E044507.353ON2212264395e-53
SAKL0F11440g7.353ON2722834158e-49
KLTH0H01188g7.353ON2672873782e-43
Kwal_56.246507.353ON2522703068e-33
KLLA0D12276g7.353ON2582812814e-29
Ecym_47207.353ON2612831896e-16
ACL145W7.353ON2341471604e-12
AEL291C2.518ON551116675.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L01500
         (279 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   533   0.0  
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   244   9e-80
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   243   1e-79
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   241   5e-79
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   238   1e-77
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   229   2e-74
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   226   9e-73
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   225   1e-72
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   221   9e-71
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   210   1e-66
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   208   3e-66
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   200   1e-62
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   192   1e-59
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   173   5e-53
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   164   8e-49
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   150   2e-43
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   122   8e-33
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...   112   4e-29
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    77   6e-16
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    66   4e-12
AEL291C Chr5 complement(94483..96138) [1656 bp, 551 aa] {ON} Syn...    30   5.6  

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/279 (96%), Positives = 268/279 (96%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60
           MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL
Sbjct: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60

Query: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNNFSF 120
           FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWD           SMESATGNNNFSF
Sbjct: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFNPSMESATGNNNFSF 120

Query: 121 KFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNI 180
           KFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNI
Sbjct: 121 KFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNI 180

Query: 181 KTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEELI 240
           KTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEELI
Sbjct: 181 KTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEELI 240

Query: 241 NQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           NQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI
Sbjct: 241 NQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  244 bits (622), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 136/288 (47%), Positives = 191/288 (66%), Gaps = 16/288 (5%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60
           MLFKQWNE +EPRHQLD P++ KN+ESLQ SP+P+V  PS + F +Y+KII+TT++MNPL
Sbjct: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPS-IAFQNYEKIIITTQLMNPL 59

Query: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNN-FS 119
           FP+ L++ ++LG IET L LTE +   +E  H SW+             E        F+
Sbjct: 60  FPEKLIESKNLGKIETQLTLTEDQNAVNEDGH-SWNFNENFPNEFDPDNEDRENQQQAFN 118

Query: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNN 179
           F+FP++ +     ++ISI +NFLK+SPIF N+ISKKL   +       L+LG+SD+I+ +
Sbjct: 119 FEFPVFAVGK--VVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKP-LILGSSDRIA-S 174

Query: 180 IKTVTNKNCSINPPEFITGFIGSLLYEL------LEIGTDNFE--CIIVPSEGPIGFEKL 231
           +K + +  C++ PPEFITGFI SLL EL      L+ G + F+   I+VPSEGP+GFEKL
Sbjct: 175 VKEINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKL 234

Query: 232 SLSTMEELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           +L+ +++LI+  F E    +D K Y +E +RNWKL GS    QSGLYI
Sbjct: 235 NLTVIQDLID-LFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  243 bits (620), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 133/281 (47%), Positives = 184/281 (65%), Gaps = 11/281 (3%)

Query: 3   FKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPLFP 62
           FKQWN+L EPRHQLD P I KN +SL+  P+P+VE+P  +N S Y  +I+TTK+MNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60

Query: 63  KNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGN-NNFSFK 121
           KNLL++  +G ++++L +  S  T    + YSW+             ES T     ++F 
Sbjct: 61  KNLLQLTSIGEVKSSLTVKNSSPTQS-TDAYSWNYDENFPNEVDPISESETSKETQYNFS 119

Query: 122 FPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNIK 181
           FPIY  S  +TLL SI+ENF+ +SPIF N+IS+ + S +      I+++G+SD+IS N+K
Sbjct: 120 FPIY--SFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRIS-NMK 176

Query: 182 TVTNKNCSINPPEFITGFIGSLLYELLEIGTD---NFECIIVPSEGPIGFEKLSLSTMEE 238
            +T   C++ PPEFITGFIGS+L +L+ IG +   NF+C+IVPSEGP GFEK+SLS M  
Sbjct: 177 KMTKSECTLQPPEFITGFIGSVLTQLI-IGENKGMNFKCLIVPSEGPNGFEKISLSDMGS 235

Query: 239 LINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           LI+     LG   D   Y  EC+R W+ + +A   QSGLYI
Sbjct: 236 LIDVCSQWLG--FDHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  241 bits (616), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 180/281 (64%), Gaps = 10/281 (3%)

Query: 3   FKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPLFP 62
           FKQWN+L EPRHQLD P I KN +SL+  P+P+VE+P  ++ S Y ++++TTK+MNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60

Query: 63  KNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNN--FSF 120
           KNLLK+  +G I+T+L++ E         H SW+           +  +AT N    ++F
Sbjct: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAH-SWNYDENFPNEINPNSRTATSNEETLYNF 119

Query: 121 KFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNI 180
            FPIY  S   TLL SI+ENF+ +SPIF N+IS+ + S +      ++++G SD+IS N+
Sbjct: 120 SFPIY--SFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRIS-NM 176

Query: 181 KTVTNKNCSINPPEFITGFIGSLLYELLEIGTDN--FECIIVPSEGPIGFEKLSLSTMEE 238
           K +T   C++ PPEF+TGFIGS+L +L+        F+C++VPSEGP GFEK SLS M  
Sbjct: 177 KIMTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGS 236

Query: 239 LINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           LI+      G  +D   Y +ECHR W+ + +A   QSGLYI
Sbjct: 237 LIDVCSQWFG--LDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  238 bits (607), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 178/282 (63%), Gaps = 13/282 (4%)

Query: 3   FKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPLFP 62
           FKQWNE+ EPRH LD P I KN  SL+  P+P+VE+P  ++ S Y  +++TTK+MNPLFP
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60

Query: 63  KNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGN-NNFSFK 121
           KNLL++  +G IETTL +  S       +H SW+               A  +   + F 
Sbjct: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDH-SWNFDENFPNEVDPVPRGAMSDETKYDFS 119

Query: 122 FPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNIK 181
           FPIY  S   TLL SI+ENFL +SPIF N+IS+ + S +      I+++G SDKI+ N+K
Sbjct: 120 FPIY--SFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIA-NMK 176

Query: 182 TVTNKNCSINPPEFITGFIGSLLYELLEIGTDN----FECIIVPSEGPIGFEKLSLSTME 237
            +T   CS+ PPEFITGFIGS+L +L  +G  N    F+C++VPSEGP G+EKLSLS M 
Sbjct: 177 VMTKDECSLKPPEFITGFIGSVLTQL--VGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMG 234

Query: 238 ELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
            L++     LG   D  +Y++EC+R W+ + +A   QSGLYI
Sbjct: 235 SLVSLCGQWLG--FDHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  229 bits (585), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 180/281 (64%), Gaps = 10/281 (3%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60
           MLFKQWNE+ EPRHQLDSPVI+ NE +LQ S LPQV +P  ++  ++ ++ILT+ +MNPL
Sbjct: 1   MLFKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLPP-IDLQNFSRVILTSAIMNPL 59

Query: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNNFSF 120
           FP+ LLK   LG+++  L L+  KM  D   H SW+           +      +  F  
Sbjct: 60  FPEKLLKSTILGDLKVILDLSSGKMALDHPMH-SWNFDENFPNEVDPAYVVEERSKTFEL 118

Query: 121 KFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINND--KSSILLLGASDKISN 178
             PI  +S   TLLIS+ ENFLK SPIFLN I+K +   +     +  +++LG SD+I+ 
Sbjct: 119 CAPI--VSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQIT- 175

Query: 179 NIKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEE 238
            +K V++K  ++NPPEF+T F+G+++ +L+E  +  F+ +I PSEGP+GFEKL+L TMEE
Sbjct: 176 ELKPVSDKETTLNPPEFVTSFVGAVITQLIE-KSLPFQGLIAPSEGPVGFEKLNLVTMEE 234

Query: 239 LINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           LI      + S  +   Y +EC+R W+L+G+A   QSGLYI
Sbjct: 235 LITLCHQWVDSNKEI--YRNECYRRWRLDGAALGAQSGLYI 273

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  226 bits (575), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 176/283 (62%), Gaps = 11/283 (3%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60
           MLFKQWN+L EP+H LD P I KN +SL+  P+P+VE P  ++   Y   ++TTK+MNPL
Sbjct: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60

Query: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNN-FS 119
           FPKNLL++  +G I+TTL +    +      H SW+             ++ T +   + 
Sbjct: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKH-SWNYDENFPNEVDPDQKNDTADETVYG 119

Query: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNN 179
           F FPIY  S   TLL S++ENF+ +SPIF N+IS+ + S +      I+++G SDKI+ +
Sbjct: 120 FSFPIY--SFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIA-S 176

Query: 180 IKTVTNKNCSINPPEFITGFIGSLLYELLEIGTD---NFECIIVPSEGPIGFEKLSLSTM 236
           +K +T   C++ PPEFITGFIGS+L +L+ +G      F+C++ PSEGP GFEKLSLS M
Sbjct: 177 MKVMTENECTLQPPEFITGFIGSVLTQLI-VGPSKGLKFKCLVAPSEGPNGFEKLSLSDM 235

Query: 237 EELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
             L++     LG   +   Y +EC+R W+ + +A   QSGLYI
Sbjct: 236 GSLVDLCGQWLG--FEPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  225 bits (574), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 128/286 (44%), Positives = 184/286 (64%), Gaps = 19/286 (6%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60
           MLFKQWNE V PRH+LDSP+I +N++SLQ   LP+V +P T + S YK ++LTTK+M+PL
Sbjct: 1   MLFKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHMPET-DLSKYKNVVLTTKIMDPL 59

Query: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNN--F 118
           FP  LL  E + +I TTL + ES+   + +NH SWD             +S   NN    
Sbjct: 60  FPSKLLSAEKIADITTTLKIDESQDVGESENH-SWDYEENFPNEVGFKRDS---NNRRLL 115

Query: 119 SFKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSI---NNDKSSILLLGASDK 175
           SF  PI+     DT++I I+ENF+K+S IF N+I++++ + +    N   + + +G SD+
Sbjct: 116 SFSSPIFAFK--DTIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDR 173

Query: 176 ISNNIKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLST 235
           I N IK +T  +CS+ PPEF+TGFIGS+L +L+    + F  I+ PSEGPIGFEK++L  
Sbjct: 174 ILN-IKKLTQDHCSLEPPEFVTGFIGSILTQLISKEVNVFTGILAPSEGPIGFEKMTLDV 232

Query: 236 MEELINQFFHELGSQMDFKT--YYDECHRNWKLEGSATSTQSGLYI 279
           ++ELI+    EL   +D K+  Y  +C R W+L+G+A   QSGLYI
Sbjct: 233 IKELID-ICQEL---LDIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  221 bits (562), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 119/281 (42%), Positives = 173/281 (61%), Gaps = 4/281 (1%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60
           MLFK WNE VEPRH LD+PV++ N+ESLQ  PLP V +P+  ++   +      K+MNPL
Sbjct: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60

Query: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQN-HYSWDXXXXXXXXXXXSMESATGNNNFS 119
           F  +       G + T+L L ES ++         WD           + ++     +  
Sbjct: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIV 120

Query: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNN 179
            + PI  ++  +TLLIS+DENFLKVSPIF N++++KL + +N  ++ ILL+G+SDKI + 
Sbjct: 121 LRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNT-QTKILLVGSSDKIYST 179

Query: 180 IKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEEL 239
            K V+   C++ PPEFITGF+G ++ EL++    NF+  IV SEGP GFEKLSL +M+EL
Sbjct: 180 -KMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDEL 238

Query: 240 INQFFHELGS-QMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           I+    E  S  ++   + + CH+ WKL+G+A S QSGLYI
Sbjct: 239 IDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  210 bits (535), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/289 (42%), Positives = 181/289 (62%), Gaps = 17/289 (5%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60
           MLFKQWN+L EPRHQL SP +  N ESLQ   +P+V + + + + D++ +I+TTK MN L
Sbjct: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNAL 59

Query: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXX----XXXXXXXXSMESATGNN 116
           FP   L +  +G + ++L+L E++     + HYSWD               ++ES  G+N
Sbjct: 60  FPNKTLNLTKVGELSSSLVLNENEKVPTAE-HYSWDYKENFPNEVDIYSQEAIESEIGSN 118

Query: 117 ---NFSFKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSI---NNDKSSILLL 170
               ++F+ PI  ++   TLLISI+ENF+K+SPIF NL ++K+   I    N    IL L
Sbjct: 119 ESKKYNFQIPI--MAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTL 176

Query: 171 GASDKISNNIKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEK 230
           G SD+++  I+ +T +N ++  PEFITGF+GS + +L+ +   N++ +IVPSEGPIGFEK
Sbjct: 177 GTSDRVAA-IRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEK 235

Query: 231 LSLSTMEELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           LS+ T+ ELI+     L   ++   Y +E HR WK+ GSA   Q+GLYI
Sbjct: 236 LSIETISELIDICKENLN--INDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  208 bits (530), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 171/287 (59%), Gaps = 43/287 (14%)

Query: 1   MLFKQWNELVEPRHQLDSPVIL----KNEESLQESPLPQVEIPSTV-NFSDYKKIILTTK 55
           MLFKQW+E  EPRH +DS   +    +N +SLQE+PLP V++P T+ + + Y++II+ T+
Sbjct: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60

Query: 56  VMNPLFPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGN 115
           V+ PLFPK +L    LGNIE  L ++E                             AT +
Sbjct: 61  VLMPLFPKEILNFTSLGNIEVKLNVSE-----------------------------ATAH 91

Query: 116 NNFSFKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDK 175
                K PIY+ +   TL+I +DEN ++V PIFLN+ISK + +   N +   L+ G SD+
Sbjct: 92  ---LVKTPIYKCNE-RTLIIIVDENVMQVCPIFLNVISKTICTMFGN-QLKFLIFGTSDR 146

Query: 176 ISNNIKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLST 235
           IS  IKT+ + NC++ PPEFITGFIGS++ +L       F   +VPSEGP+GFEKL+L T
Sbjct: 147 ISK-IKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLET 205

Query: 236 MEELI---NQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           ME LI    +    + S ++ + Y  EC+RNW+L G+   TQSGLYI
Sbjct: 206 MEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  200 bits (508), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 115/281 (40%), Positives = 171/281 (60%), Gaps = 11/281 (3%)

Query: 1   MLFKQWNELVEPRHQLDSPVILK-NEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNP 59
           MLFKQWNE+ EPRH LDSP+ +  ++ESLQ+  LP VE+P+ +N++ + KI LTT +M+P
Sbjct: 1   MLFKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELPN-INWNKFHKIFLTTGIMDP 59

Query: 60  LFPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNNF- 118
           LFPK LL +  LG+I TTL +  ++    E   YSW+           ++     N++  
Sbjct: 60  LFPKELLGVMKLGDIRTTLTIDRNQQ--HENGEYSWN--FEENFPNEVNLNGGQDNDDGQ 115

Query: 119 SFKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISN 178
           S  F     +  D LL+ + ENFLKVSPI  N I++ L S  +     + +LG SD+I+ 
Sbjct: 116 SLTFVTTVEAFGDCLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRIT- 174

Query: 179 NIKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEE 238
            +K++++    + PPEF+TGFIGS+L + L +    FE  I PSEG IGFEK+S++TM E
Sbjct: 175 ELKSISHLRSDLQPPEFVTGFIGSILTQ-LTVKNIPFEGFIAPSEGAIGFEKMSMNTMPE 233

Query: 239 LINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           LI+     +    +   Y  EC+R+W+L+  A  + SGLY+
Sbjct: 234 LIDICGQWINGNSE--KYRSECYRHWRLDSGAVGSLSGLYV 272

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  192 bits (488), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 117/281 (41%), Positives = 165/281 (58%), Gaps = 11/281 (3%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTV-NFSDYKKIILTTKVMNP 59
           MLFKQWNEL EPR+ LD+P ++ N ESLQ  PLP V IP  +    + K++ILTTK M+ 
Sbjct: 1   MLFKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTKTMDT 60

Query: 60  LFP-KNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNNF 118
            F     +K++ L +I  +L + ++  T +  + + +              E  T    F
Sbjct: 61  FFLLDKTMKVKKLADITCSLEIPKNLQTHEATHTWDFGENFPNEVEPLQDEEQRT----F 116

Query: 119 SFKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISN 178
           S +FPIY +    TL +SIDENFL VSPIF   IS  ++  +N     I++LG SD+I +
Sbjct: 117 SLRFPIYLLED-QTLYVSIDENFLTVSPIFTAQISDVISKKLNRGHE-IVILGCSDRIED 174

Query: 179 NIKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEE 238
             K  TN NCS+ PPEF+TGF+GSL+ +L +     F   I PSEGP GFEKLS +T++ 
Sbjct: 175 T-KICTNNNCSLVPPEFVTGFLGSLMSDLTKTNDQLFTAAIFPSEGPQGFEKLSSTTVDS 233

Query: 239 LINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           +I+ F  +L S  D   Y +EC++ WK   S+   QSGLY+
Sbjct: 234 IID-FCSQLVS-TDKSRYTEECYKRWKRNASSNGAQSGLYL 272

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  173 bits (439), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 101/226 (44%), Positives = 147/226 (65%), Gaps = 8/226 (3%)

Query: 57  MNPLFPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXS-MESATGN 115
           MNPLFP++LL +  + NI TTL L   ++  +E  H SW+           S  +  +  
Sbjct: 1   MNPLFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKH-SWNYNENFPNEFDPSDKDMKSSE 59

Query: 116 NNFSFKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDK 175
            ++ F FPI+ I  T  L+ISI ENFLK+SPIF N+IS+ L  ++  +K  IL+LG SD+
Sbjct: 60  KSYDFNFPIFAIDRT--LVISIQENFLKISPIFSNVISQTLVQALPLNKE-ILILGTSDR 116

Query: 176 ISNNIKTVTNKNCSINPPEFITGFIGSLLYEL-LEIGTDNFECIIVPSEGPIGFEKLSLS 234
           ++  ++ ++N+  ++ PPEF+TGFIGSL+ EL L     NF+ IIVPSEGP GFEKL+L+
Sbjct: 117 VAV-MRKISNEIDTLEPPEFVTGFIGSLITELNLHNAKYNFDAIIVPSEGPTGFEKLNLT 175

Query: 235 TMEELINQFFHELGS-QMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
            M++LI+ F +E     +D K Y ++C+R+WKL G+A   QSGLYI
Sbjct: 176 IMQDLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  164 bits (415), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 153/283 (54%), Gaps = 15/283 (5%)

Query: 1   MLFKQWNELVEPRHQLDSPVILK-NEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNP 59
           MLFK WNE  EPRHQLD+P     N ESLQ++PLP V +   ++ S + +I+L TKV+ P
Sbjct: 1   MLFKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRP 60

Query: 60  LFPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNNFS 119
           LFP  +  M  +   + T+    + +     + Y  +             E        S
Sbjct: 61  LFPSTICPMTTISEFQVTIPPQPTAIKKAHGSSYGDEDYEQESLPDKKPEEIIV-----S 115

Query: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKS-SILLLGASDKISN 178
           F+   +     D L I I+ENFL VSPI  NL+S+++     +  +   ++LG SD+I+ 
Sbjct: 116 FQVEKFN----DILFICIEENFLHVSPIAWNLLSQQIIRLCKSKNTLQTIVLGTSDRITT 171

Query: 179 NIKTV--TNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTM 236
            +K+V  T     + PPEF+T    SL+  L+ +    F+ +I PSEGP GFEKLSL +M
Sbjct: 172 -LKSVGSTLGLPDLEPPEFVTNCTASLITTLI-LHDLPFKSLIAPSEGPSGFEKLSLVSM 229

Query: 237 EELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           ++L    F  +    +  +Y +ECHR W+L+G+A   Q+GLYI
Sbjct: 230 DQLAESCFELVKPVENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  150 bits (378), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 153/287 (53%), Gaps = 28/287 (9%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNE-ESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNP 59
           MLFKQWNE  EPRH LD+P+    + +SLQ +PLP+V +   ++ + +K+  + T +   
Sbjct: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60

Query: 60  LFPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNNFS 119
           LF   L + E    I + +++ ++K    EQ+ Y  D             +S + +    
Sbjct: 61  LFEDRLARAE---QISSFVVVWQTK--GREQHLYREDYQTQE--------DSRSTDETKR 107

Query: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNN 179
            +FP++++    TL I + E+FL V PI +NL+S+++          +LL G+SD++   
Sbjct: 108 LEFPVHKLDD-GTLFICVREDFLHVPPISINLLSREIAKLCGG--LEVLLFGSSDRVERV 164

Query: 180 IKTVTNKNCS-----INPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLS 234
                  N       + PPE IT F  S++ +LL      F+  + PSEGP G+EKLS+ 
Sbjct: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLS-NKVRFDGYVAPSEGPSGYEKLSME 223

Query: 235 TMEELINQFFHEL--GSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           TM+ LI+  + E+  G++ D   Y   CHRNW+L G+    Q+GLY+
Sbjct: 224 TMDLLIDLCWSEVRFGNRED---YVKSCHRNWRLNGTVMGAQTGLYL 267

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  122 bits (306), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 139/270 (51%), Gaps = 24/270 (8%)

Query: 16  LDSPVI-LKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPLFPKNLLKMEDLGNI 74
           +D+P+  + +  SLQ +PLP+V +   +  + +K++ + T++   LF   L   E +   
Sbjct: 1   MDAPLGEIFDSNSLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLFVGKLAHAEQISTF 60

Query: 75  ETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNNFSFKFPIYRISSTDTLL 134
           E      + +    EQ+ Y  D             +    N +     P+ +I   DT L
Sbjct: 61  EV-----KWQTKGREQHLYREDFQVQE--------DCTKENESCGLSIPVLKIDE-DTFL 106

Query: 135 ISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKIS-----NNIKTVTNKNCS 189
           + + E+FL V PI  NL+S+++     + +  +L++G SD+I       + +   N    
Sbjct: 107 LCVAEDFLHVPPIVGNLLSQEMAKLCRDLR--VLVIGTSDRIEEVKYVGSAQNGRNGVPP 164

Query: 190 INPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEELINQFFHELGS 249
           + PPE IT F  S+  +LL +    F+  + PSEGP G+EKLS+ TM++LI+  + E+ S
Sbjct: 165 LTPPELITSFTASITTQLL-LCKVPFDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEI-S 222

Query: 250 QMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
             +   Y  E HRNW+L G++T TQ+GLY+
Sbjct: 223 TGNRDEYVKETHRNWRLHGTSTGTQTGLYL 252

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score =  112 bits (281), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 132/281 (46%), Gaps = 26/281 (9%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEI-PSTVNFSDYKKIILTTKVMNP 59
           + FKQW     PRHQ+D PV+  +  SL     P V I P +++ S Y   I+    +  
Sbjct: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60

Query: 60  LFPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNNFS 119
           L PK+++ +  +G I  TL            N   W+                     F 
Sbjct: 61  LLPKSIINLVHIGIISGTL-----------SNMNEWESMKPVPGMYDTEEHMINSTEQFV 109

Query: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNN 179
             + ++R+   DTL+  IDEN +K   I  N +++ L + +  D   I +L  SDKI   
Sbjct: 110 IHYNLWRLE--DTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKI--- 163

Query: 180 IKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEEL 239
             T   +   + PPEFITG I + +   L +     + I+VPSEGPIGFEK +  T++ L
Sbjct: 164 --TELKQLSYLVPPEFITGSITNFI---LALPRKELKVIVVPSEGPIGFEKYNFPTVDAL 218

Query: 240 INQFFHELGSQMDFKTYY-DECHRNWKLEGSATSTQSGLYI 279
           +++    L S      YY  EC + WKL+   T+TQ GLYI
Sbjct: 219 VDEMSKLLCSYPSQTEYYVSECLKLWKLD-ECTTTQGGLYI 258

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 77.4 bits (189), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 127/283 (44%), Gaps = 26/283 (9%)

Query: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60
           M+FKQW     PRHQ+ S +   +  SL  SP P + + + +N   Y+K I     +  L
Sbjct: 1   MIFKQWEFDRIPRHQVQS-INSADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWL 58

Query: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDXXXXXXXXXXXSMESATGNNNFSF 120
            P +L+  + +  +  T +L +S   D  +                  ++          
Sbjct: 59  LPADLIHFKQISCL--TAVLKQSSNPDPVE-------IEDVNTSGFYEVDVKPSTKEVRA 109

Query: 121 KFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNI 180
            +PIY +    TL++ I E+ L+  PI  N ++  L   +      + LL  SDKI    
Sbjct: 110 SYPIYELDD-HTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKI---- 164

Query: 181 KTVTNKNCS-INPPEFITGFIGSLLYELLEIGTD---NFECIIVPSEGPIGFEKLSLSTM 236
             +  K+ S + PPEFI G + +++  L    +      E ++V SEGP G+E  +++ +
Sbjct: 165 --IGFKSLSELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVV 222

Query: 237 EELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279
           + L+      LG   ++ T     +R WK   SA+  QSGLY+
Sbjct: 223 DLLVEYMKSTLGYSEEYVT---SAYRRWK-SNSASQFQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 78/147 (53%), Gaps = 11/147 (7%)

Query: 133 LLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNIKTVTNKNCSINP 192
           L++ ++EN LK  PI  N ++++L   +    +   +L  SDK S  +K +      + P
Sbjct: 99  LVVVVEENDLKYPPIVHNRLAQQLAEKLRAVGAETTVLVNSDK-STGVKDLEE----LVP 153

Query: 193 PEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEELINQFFHELGSQMD 252
           PEFITG + +L+  L   G      ++V SEGP GFEK +L+ ++ L+ +    L    +
Sbjct: 154 PEFITGALAALVCALAPSGAGRV--LVVQSEGPHGFEKHNLTVVDALVERVRQILDQPPE 211

Query: 253 FKTYYDECHRNWKLEGSATSTQSGLYI 279
              Y   C R+WKL+ + +  Q GLY+
Sbjct: 212 ---YVAACTRHWKLQ-AGSQFQGGLYL 234

>AEL291C Chr5 complement(94483..96138) [1656 bp, 551 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR008W
           (RSC4)
          Length = 551

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 47/116 (40%), Gaps = 14/116 (12%)

Query: 168 LLLGASDKISNNIKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIV-----PS 222
           L++  S +  N IK    K  +I     I   I   L ++LE   ++ E  I      P+
Sbjct: 144 LIVKNSMQAVNYIKNEVLKAKNITKNYLINDLIKERLLKVLEQLLESTELFIAQAMGNPT 203

Query: 223 EGPIGFEKLSLSTMEELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLY 278
           EG  G  KL            F EL SQ DF  YY+  H+   LE    + Q G Y
Sbjct: 204 EGLDGELKLCHP---------FLELVSQEDFPDYYEVIHKPISLEMIKNNLQLGYY 250

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,237,294
Number of extensions: 1422105
Number of successful extensions: 4268
Number of sequences better than 10.0: 47
Number of HSP's gapped: 4321
Number of HSP's successfully gapped: 49
Length of query: 279
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 171
Effective length of database: 41,097,471
Effective search space: 7027667541
Effective search space used: 7027667541
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)