Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L014807.351ON26426412541e-176
KNAG0B026207.351ON2652467651e-102
NCAS0E028707.351ON2612617395e-98
ZYRO0F11726g7.351ON2512427221e-95
Suva_10.2967.351ON2602457134e-94
YLR201C (COQ9)7.351ON2602457003e-92
CAGL0A03949g7.351ON2682457005e-92
TDEL0C019707.351ON2602496935e-91
TPHA0F029807.351ON2642476927e-91
Kpol_530.307.351ON2602536911e-90
Skud_12.2657.351ON2602456873e-90
NDAI0E044707.351ON2642626865e-90
TBLA0E004507.351ON2792426782e-88
KLLA0D12320g7.351ON2502476412e-83
KLTH0H01232g7.351ON2572476283e-81
Kwal_56.246447.351ON2582526265e-81
Smik_12.2607.351ON2602456162e-79
SAKL0F11396g7.351ON2542466082e-78
ACL147W7.351ON2462456012e-77
Ecym_47227.351ON2532425874e-75
Smik_7.998.125ON468102666.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L01480
         (264 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   487   e-176
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   299   e-102
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   289   5e-98
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   282   1e-95
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   279   4e-94
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   274   3e-92
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   274   5e-92
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   271   5e-91
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   271   7e-91
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   270   1e-90
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   269   3e-90
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   268   5e-90
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   265   2e-88
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   251   2e-83
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   246   3e-81
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   245   5e-81
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   241   2e-79
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   238   2e-78
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   236   2e-77
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   230   4e-75
Smik_7.99 Chr7 (175710..177116) [1407 bp, 468 aa] {ON} YGL172W (...    30   6.0  

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  487 bits (1254), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 245/264 (92%), Positives = 245/264 (92%)

Query: 1   MVMSSFTPLNKSLLRTTQFKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKE 60
           MVMSSFTPLNKSLLRTTQFKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKE
Sbjct: 1   MVMSSFTPLNKSLLRTTQFKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKE 60

Query: 61  YVPTSGFNEKSILKSINDLGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXX 120
           YVPTSGFNEKSILKSINDLGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRI   
Sbjct: 61  YVPTSGFNEKSILKSINDLGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELT 120

Query: 121 XXXXXXXXXXXXXXXXKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIF 180
                           KRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIF
Sbjct: 121 KDTNDNTTTTLKELLLKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIF 180

Query: 181 FSNEKDHHDMAWYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYN 240
           FSNEKDHHDMAWYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYN
Sbjct: 181 FSNEKDHHDMAWYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYN 240

Query: 241 NVEEYAWFTLMNSINLVKSQFSRM 264
           NVEEYAWFTLMNSINLVKSQFSRM
Sbjct: 241 NVEEYAWFTLMNSINLVKSQFSRM 264

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 179/246 (72%), Gaps = 6/246 (2%)

Query: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83
           RLYHP   EY N T ++PLTY+MDS QS+IL+H L+  VP  GF E+++LKSI  +GY S
Sbjct: 19  RLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYDS 78

Query: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKR------IXXXXXXXXXXXXXXXXXXXK 137
           SMMSV+GASNSPS  HSSPAV+EL+K+NLV KR      +                   K
Sbjct: 79  SMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPSLEHLLVK 138

Query: 138 RLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRL 197
           RL+MD+P+S QL  LF QLA P +FM +V++PELF+L+DDMI+FSNEKDH D AWYSKRL
Sbjct: 139 RLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKRL 198

Query: 198 AVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLV 257
            VS+AY TSK+FM QD S N Q T++FA DK+ R+M LGEYYNNVEEYAW+++M ++N  
Sbjct: 199 GVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRA 258

Query: 258 KSQFSR 263
           K+ FSR
Sbjct: 259 KAGFSR 264

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  289 bits (739), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 186/261 (71%), Gaps = 8/261 (3%)

Query: 9   LNKSLLRTTQFKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFN 68
           LN+S+L+   F    R YHP+  EYV P T+SPLTY+ +S+Q KILS++L ++VP  GF 
Sbjct: 2   LNRSILKKGLFSY--RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFK 59

Query: 69  EKSILKSINDLGYSSSMMSVIGASNSPS-FAHSSPAVLELIKYNLVSKRIXXXX-----X 122
           EK+I  S+N+LG+SSS++SVIGASNSP+ F   SPAV+ELIK+ LVSKR           
Sbjct: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDT 119

Query: 123 XXXXXXXXXXXXXXKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFS 182
                         KRLEMD  I  Q+  LFA+LATP  F+FDV+LPEL +L+DDMI+FS
Sbjct: 120 TPKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179

Query: 183 NEKDHHDMAWYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNV 242
           NEKDHHDMAWY+KRL VS AYV+SK++M QD S +F+ T+ FA DK+ R+M LGEYYNN 
Sbjct: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239

Query: 243 EEYAWFTLMNSINLVKSQFSR 263
           EEYAW+  M S NLV+++ +R
Sbjct: 240 EEYAWYMFMVSTNLVRARLAR 260

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  282 bits (722), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 173/242 (71%), Gaps = 1/242 (0%)

Query: 22  LRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGY 81
           LRR YHP+  E++N + + PL Y +DS Q  +LSH+LK  VP  GFNE++I+ S+N L Y
Sbjct: 10  LRR-YHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNY 68

Query: 82  SSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXXXXXXXXXXXXXXXXXKRLEM 141
            S+M+SVIGASNSPS  HSSPAV+EL+K++LV KR+                   KRLE+
Sbjct: 69  PSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSLEDLFIKRLEL 128

Query: 142 DIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAVSM 201
           ++PI+  L  L + ++ PG F  D +LPEL +L+DD+I++SNEKDHHD AWYSKRL +S 
Sbjct: 129 NVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLGISC 188

Query: 202 AYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVKSQF 261
           AYV+S++FM QD S+N++ T  FA DK+ R M LGEYYNN EE+ W+TL+NSINL KSQ 
Sbjct: 189 AYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAKSQM 248

Query: 262 SR 263
           +R
Sbjct: 249 AR 250

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  279 bits (713), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 136/245 (55%), Positives = 170/245 (69%), Gaps = 5/245 (2%)

Query: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83
           RLYH    E+VNP  I PL Y   S Q K+LS +L+EYVP  GF E+SI++S+N LGY S
Sbjct: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYPS 74

Query: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXX-----XXXXXXXXXXXXXXXKR 138
           SM+S IGASNSPSF HSS AV+EL+K+ LV KR                         KR
Sbjct: 75  SMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134

Query: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198
           LEMD P+  QL  L +QLA P  F+F+ ++PEL +L+DDMI+FSNEKDHHD AWY+KRLA
Sbjct: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258
           VS  Y+ S++FM QD S++F  T  FA DK+ RVM LGEYYNN EE+AW+TLM+++NLVK
Sbjct: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 259 SQFSR 263
           SQ +R
Sbjct: 255 SQLAR 259

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  274 bits (700), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 134/245 (54%), Positives = 171/245 (69%), Gaps = 5/245 (2%)

Query: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83
           RLYH    E+V P  I PLTY  +S Q K+LS +L+++VP  GF+E+SI++S+N+LGY S
Sbjct: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74

Query: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXX-----XXXXXXXXXXXXXXXKR 138
           SM+S IGA NSPSF HSS AV+ELIK+ LV KR                         KR
Sbjct: 75  SMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLLKR 134

Query: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198
           LEMD PI   L  L +QLA P  F+F+ ++PEL +L+DDMI+FSNEKDHHD AWY+KRLA
Sbjct: 135 LEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258
           VS  Y+ SK+FM QD S+N++ T  FA DK+ RVM LGEYYNN EE+AW+TLM+++NL+K
Sbjct: 195 VSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLIK 254

Query: 259 SQFSR 263
           SQ  R
Sbjct: 255 SQLVR 259

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  274 bits (700), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 170/245 (69%), Gaps = 4/245 (1%)

Query: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83
           R YHP SNEYVNP    PLTY+ +S + K+LSH+++  VP  GF EK+I+ S+N +   S
Sbjct: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83

Query: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXXXXXXXXXXXX----XXXXXKRL 139
            M++ IGASNS +F HSSPAV+ELIK+ LV KR                        KRL
Sbjct: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEASKLPSLESLLLKRL 143

Query: 140 EMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAV 199
           +MD+PI+S L  + AQL  P  FM +VSLPEL +LADDMI++SNEKDHHD AWY+KR A+
Sbjct: 144 KMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAAL 203

Query: 200 SMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVKS 259
           +  Y+ SK FM QD S+NF  TM+FA DK+ +VM LG+YYNNVEE+ WFTLM+++NL KS
Sbjct: 204 ATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKS 263

Query: 260 QFSRM 264
           Q +R+
Sbjct: 264 QMARV 268

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  271 bits (693), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 177/249 (71%), Gaps = 5/249 (2%)

Query: 20  KCLRRLYHPASNEYVNP-TTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSIND 78
           +   R Y PA  EY+NP  +  PL Y  DS Q K+LSH+L + VP  GFNE++I+ S+N+
Sbjct: 11  RIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNE 70

Query: 79  LGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXXXXXXXXXX----XXXXX 134
           LGY S+M+SVIG+SN PSF HSSPA++EL+K++LV KR+                     
Sbjct: 71  LGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQLPSLEHL 130

Query: 135 XXKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYS 194
             KRLEM++P++  L  L +QL+ PG F+ D S+PEL +L+DDMI+FS EKDH+D AWYS
Sbjct: 131 VIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYS 190

Query: 195 KRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSI 254
           KRLAVS AYV+S++FM QD S +++ T +FA +K+ RV  LGEYYNN EE+AW+TL+++I
Sbjct: 191 KRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTI 250

Query: 255 NLVKSQFSR 263
           NLVKSQ +R
Sbjct: 251 NLVKSQLAR 259

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  271 bits (692), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 173/247 (70%), Gaps = 7/247 (2%)

Query: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYS- 82
           R +HPA++EYV P  +SP TY+ DS Q KILSH++   V   GF+E++I++++ +L    
Sbjct: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76

Query: 83  -SSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXX-----XXXXXXXXXXXXXXX 136
            S+M+S IG+SNSPSF HSSP+V+EL+K+NLV KR                         
Sbjct: 77  QSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELPSLESLLL 136

Query: 137 KRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKR 196
           KRLEMDIPI   +    +QL  PG F+ D +LPEL +LADDMI+FSNEKDHHD AWYSKR
Sbjct: 137 KRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196

Query: 197 LAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINL 256
           L VS AY++SK+FM QD S N++ T+ FA DK+++VM LG+YYNN EEYAW+ L+NS+N+
Sbjct: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256

Query: 257 VKSQFSR 263
           VKS+ SR
Sbjct: 257 VKSRMSR 263

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  270 bits (691), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 172/253 (67%), Gaps = 5/253 (1%)

Query: 15  RTTQFKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILK 74
           + T F  L R YHP   EYV   T+ PL Y  DS Q KILSHSL   VP  GFNE++I+ 
Sbjct: 8   KRTAF-GLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVN 66

Query: 75  SINDLGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXXX----XXXXXXXX 130
           SIN LGY SS++SVIG+SN+PSF HSS A++EL+K+NLV+KR                  
Sbjct: 67  SINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPS 126

Query: 131 XXXXXXKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDM 190
                 KRL+MD+PI   L  L AQL+ PG F+ D SLPEL +LADDMI+FS+EKDH D 
Sbjct: 127 LEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDF 186

Query: 191 AWYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTL 250
           AWY+KR+ VS AY++SK+FM QD S  +  T +FA DK+ R+M LG+YYNN EEYAW+ L
Sbjct: 187 AWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVL 246

Query: 251 MNSINLVKSQFSR 263
           MNSIN+ KS+ +R
Sbjct: 247 MNSINMAKSKAAR 259

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  269 bits (687), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 170/245 (69%), Gaps = 5/245 (2%)

Query: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83
           RLYH    E+V P  I PLTY   S Q K+LS +L EYVP  GF+E+SI++S+N LGY S
Sbjct: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74

Query: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXX-----XXXXXXXXXXXXXXXKR 138
           SM+S IGASNSPSF HSS AV+EL+K+ LV KR                         KR
Sbjct: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 134

Query: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198
           LEMD  I  QL  L +QLA P + +F+ ++PEL +L+DDMI+FSNE+DHHD AWY+KRLA
Sbjct: 135 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 194

Query: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258
           VS  Y+ SK+FM QD S++F+ T  FA +K+ +VM LGEYYNN EE+AW+TLM+++NLVK
Sbjct: 195 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 259 SQFSR 263
           SQ +R
Sbjct: 255 SQLAR 259

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  268 bits (686), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 133/262 (50%), Positives = 183/262 (69%), Gaps = 8/262 (3%)

Query: 9   LNKSLLRTTQFKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFN 68
           LN+ L +  +   + R +H  + EY    T+SPLTY+ DS+Q KILS++L ++VP  GF 
Sbjct: 3   LNRILSKNVKL-SINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFT 61

Query: 69  EKSILKSINDLGYSSSMMSVIGASNSPS-FAHSSPAVLELIKYNLVSKR------IXXXX 121
           +++I  S+N+L  SSS+ SV+G+SNSPS F   SPAV+EL+K+ LVSKR      I    
Sbjct: 62  DEAITSSLNELDLSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYI 121

Query: 122 XXXXXXXXXXXXXXXKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFF 181
                          +RL+MD P+++QL  LF QL  P   +F+V+LPELF L+DD+I+F
Sbjct: 122 ETAKDKLPSLETLLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYF 181

Query: 182 SNEKDHHDMAWYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNN 241
           SNEKDHHDMAWY+KRL VS AYV+SK++M+++   NF  T+DFA DK+ R+MNLGEYYNN
Sbjct: 182 SNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNN 241

Query: 242 VEEYAWFTLMNSINLVKSQFSR 263
            EEYAW+TLM S+NLVK++ +R
Sbjct: 242 TEEYAWYTLMVSMNLVKARLAR 263

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  265 bits (678), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 128/242 (52%), Positives = 171/242 (70%), Gaps = 2/242 (0%)

Query: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83
           R Y+  SN+      + PL Y  DS Q +IL  +++  VPT GF E++I+ SIN LGY+S
Sbjct: 37  RTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYNS 96

Query: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXXXX--XXXXXXXXXXXXXKRLEM 141
           SM+SV+G+SN+ +  HSSPAVLEL+K+NLVSKR+                     KRL+M
Sbjct: 97  SMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETKDLPSLEYLLLKRLQM 156

Query: 142 DIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAVSM 201
           D  I S+L  +  +L+ PG F+ + S+PELF+L+DDMI+FSNEKDHHDMAWYSKRLAVS 
Sbjct: 157 DKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRLAVST 216

Query: 202 AYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVKSQF 261
            Y+ S++FM QDTS +   T++FA DK+++VMNLGEYYNN EE+ WFTLM S+N+VKSQ 
Sbjct: 217 TYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIVKSQL 276

Query: 262 SR 263
           +R
Sbjct: 277 AR 278

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  251 bits (641), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 174/247 (70%), Gaps = 3/247 (1%)

Query: 20  KCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDL 79
           +   RLYHP + E+  P  I PLTY  DS+Q K+LS++L ++VP  GFNE++I++S+N+L
Sbjct: 3   RVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEL 62

Query: 80  GYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKR---IXXXXXXXXXXXXXXXXXXX 136
           G  SS +SV+G+SNSPSF + SP+VLEL+K++LVSKR   I                   
Sbjct: 63  GMGSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLDSDKPLPDLKTLFL 122

Query: 137 KRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKR 196
           +RL+++  ++  L  L + ++ PG+F+   +L EL +L DDMIF+SNE+DH+D AWYSKR
Sbjct: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182

Query: 197 LAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINL 256
           +A+S AYV+S++FM QD S+NFQ TM+FA  K+++V  LG  YNN EEY WFTL++SINL
Sbjct: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242

Query: 257 VKSQFSR 263
            KSQ +R
Sbjct: 243 AKSQITR 249

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  246 bits (628), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 170/247 (68%), Gaps = 6/247 (2%)

Query: 23  RRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYS 82
           RRLYHP++ E+    + +PLTY   S Q K+L H+L ++VP+ GFNE++++ S+NDL   
Sbjct: 10  RRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLG 69

Query: 83  SSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKR------IXXXXXXXXXXXXXXXXXXX 136
            S++SVIGASNSPSF ++SPAVLELIK++LV+KR      +                   
Sbjct: 70  PSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFH 129

Query: 137 KRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKR 196
           +RLE++ PI+  L  L + L+ PG+F+   +LPEL +L+DDM++FS E D +D AWYSKR
Sbjct: 130 RRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKR 189

Query: 197 LAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINL 256
           +A+S A+V+S++FM QD S N+  T +FA++K+  V  LG+YYNN EEY W+TL+ S+NL
Sbjct: 190 IALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNL 249

Query: 257 VKSQFSR 263
            KSQ +R
Sbjct: 250 AKSQLTR 256

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  245 bits (626), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 166/252 (65%), Gaps = 7/252 (2%)

Query: 19  FKCL-RRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSIN 77
           F+ L RR Y P   EY   T ++PL Y   SIQ K+L H+LK +VP+ GFNE++++ S+N
Sbjct: 6   FRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLN 65

Query: 78  DLGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKR------IXXXXXXXXXXXXXX 131
           DLG  S ++S IGA NSP   +SSPAVLEL+K++LV+KR      +              
Sbjct: 66  DLGLGSQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPAL 125

Query: 132 XXXXXKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMA 191
                KRLE++IPI+  +  L A LA PG+F+   +LPEL +L+DDMI+FS E D +D A
Sbjct: 126 ETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFA 185

Query: 192 WYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLM 251
           WYSKR A+S A+V+S++FM QD S N+  T +FA+DK+  V  LG+YY N EEY W+TL+
Sbjct: 186 WYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLL 245

Query: 252 NSINLVKSQFSR 263
            S+NL KSQ +R
Sbjct: 246 MSVNLAKSQITR 257

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  241 bits (616), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 172/245 (70%), Gaps = 5/245 (2%)

Query: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83
           RLYHP   E+V    I PLTY  +S Q K+LS +L++YVP  GF+E+SI++S+N+LGY S
Sbjct: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYPS 74

Query: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXXX-----XXXXXXXXXXXXXXKR 138
           SM+S I ASNSPSF HSS AV+ELIK+ LV KR                         +R
Sbjct: 75  SMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSLEHLLLRR 134

Query: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198
           LEMD PI   L  L +QLA P  F+F+ ++PEL +L+DDMI+FSNEKDHHD AWY+KRLA
Sbjct: 135 LEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258
           VS  Y+ SK+FM QD S+N++ T DFA  K++RVM LGEYYNN EE+AW+TLM+++NLVK
Sbjct: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 259 SQFSR 263
           SQ  R
Sbjct: 255 SQLVR 259

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  238 bits (608), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 175/246 (71%), Gaps = 2/246 (0%)

Query: 20  KCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDL 79
           K  RR YHP + E+ +   + PL YS DS Q KIL+++L E VP  GFNE+++  S +DL
Sbjct: 8   KIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDL 67

Query: 80  GYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKR--IXXXXXXXXXXXXXXXXXXXK 137
           GYSSS +SV+GASNSPSF +SSPAVLEL+K++LVSKR  +                   K
Sbjct: 68  GYSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTLESPSLENLFLK 127

Query: 138 RLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRL 197
           RLEM+ PI++ L  L + LA PG F+ + ++PEL +L+DDM++FSNE DH+D AWYSKRL
Sbjct: 128 RLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRL 187

Query: 198 AVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLV 257
           A+S AYV+S++FM QD S ++Q T+ FA +K+  +  LGE YNNVEEYAW+TL++SI+L 
Sbjct: 188 AISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLA 247

Query: 258 KSQFSR 263
           KSQ +R
Sbjct: 248 KSQMTR 253

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  236 bits (601), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 107/245 (43%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 19  FKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSIND 78
           F+  RRLYHP + E+     + PL Y  DS Q K+L  +L+ +VP  GFNE++I+++  D
Sbjct: 2   FRVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGD 61

Query: 79  LGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXXXXXXXXXXXXXXXXXKR 138
           LGY S+++S + A NSP+  +   AVLEL+K++LV+KR+                   +R
Sbjct: 62  LGYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNVSMEQLFL-QR 120

Query: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198
           +E D P++ QL  L + L+ PG+F+ + ++PELF+L+DD+I++S EKDH D+AWYSKR A
Sbjct: 121 VEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA 180

Query: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258
           V+MAYV++ +FM +D S   + T+ FA  ++ +V +LG  YNNVEE+AW+ L+ ++NLVK
Sbjct: 181 VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK 240

Query: 259 SQFSR 263
           SQ +R
Sbjct: 241 SQLTR 245

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  230 bits (587), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 108/242 (44%), Positives = 163/242 (67%), Gaps = 2/242 (0%)

Query: 22  LRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGY 81
            RR YH  S EY    T+ PL Y   S Q K+L+ +L++YVP  GF + +I+ + N+LGY
Sbjct: 13  FRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGY 72

Query: 82  SSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIXXXXXXXXXXXXXXXXXXXKRLEM 141
           +S++++ IGA+NSP+  + S +V EL+K++LV+KR                    KRLE 
Sbjct: 73  NSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKR--YGLQEDQEGTKTLEELFLKRLEA 130

Query: 142 DIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAVSM 201
           +  +   L+ + + LA PG F+ +  LPELFQLADDMI++S EKD +D+AWYSKRLAVSM
Sbjct: 131 NKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVSM 190

Query: 202 AYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVKSQF 261
           AY+++++FM +D+S NFQ TM+FA  +++++  +G  YNN+EE+AWF L+ ++NL +SQ 
Sbjct: 191 AYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQL 250

Query: 262 SR 263
            R
Sbjct: 251 VR 252

>Smik_7.99 Chr7 (175710..177116) [1407 bp, 468 aa] {ON} YGL172W
           (REAL)
          Length = 468

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 9/102 (8%)

Query: 152 LFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAVSMAYVTSKMFMI 211
           LF QL TPG  +    L + FQ    +     EK   D +     +  ++  + + +F  
Sbjct: 349 LFQQLLTPGSKISSNDLDKFFQKKIRLY----EKKLEDYSRILSDIETAVNGIDTDLFGA 404

Query: 212 QDTSNNFQMTMDFASDKVDRVM----NLGEYYNNV-EEYAWF 248
            + +N   +T DFAS + + ++     LG   + V EE+  F
Sbjct: 405 PNNANATAITADFASSEAENLLRLKTGLGAIVSTVIEEFTLF 446

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,441,030
Number of extensions: 1007835
Number of successful extensions: 3577
Number of sequences better than 10.0: 33
Number of HSP's gapped: 3689
Number of HSP's successfully gapped: 33
Length of query: 264
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 157
Effective length of database: 41,212,137
Effective search space: 6470305509
Effective search space used: 6470305509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)