Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L014757.345ON1041044072e-52
TDEL0A048905.623ON29140651.2
Kwal_55.19788na 1ON81036606.8
NOTE: 16 genes in the same pillar as KAFR0L01475 were not hit in these BLAST results
LIST: Kpol_2001.72 Zrou_YGOB_Anc_7.345 Skud_12.267 CAGL0A03883g Smik_12.262 YLR204W Suva_10.298 KLTH0H01364g Kwal_56.24628 ACL153C Ecym_4728 TPHA0D04575 KLLA0D12452g KNAG0B02635 NDAI0E04490 SAKL0F11264g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L01475
         (104 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L01475 Chr12 complement(273710..274024) [315 bp, 104 aa] {ON}    161   2e-52
TDEL0A04890 Chr1 (862360..863235) [876 bp, 291 aa] {ON} Anc_5.62...    30   1.2  
Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {...    28   6.8  

>KAFR0L01475 Chr12 complement(273710..274024) [315 bp, 104 aa] {ON}
          Length = 104

 Score =  161 bits (407), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 79/104 (75%), Positives = 79/104 (75%)

Query: 1   MMFRQLTRLMVPRTVLIRPSVLCSMNRGYHATSGVINDSISFIPWIPWKKPTSLLQAVGA 60
           MMFRQLTRLMVPRTVLIRPSVLCSMNRGYHATSGVINDSISFIPWIPWKKPTSLLQAVGA
Sbjct: 1   MMFRQLTRLMVPRTVLIRPSVLCSMNRGYHATSGVINDSISFIPWIPWKKPTSLLQAVGA 60

Query: 61  ASVQEDGMFTDSVLXXXXXXXXXXXXXXXXXXXXXXXXXLSQGK 104
           ASVQEDGMFTDSVL                         LSQGK
Sbjct: 61  ASVQEDGMFTDSVLRKRRKKMKKHKLRKRRKRERADKRKLSQGK 104

>TDEL0A04890 Chr1 (862360..863235) [876 bp, 291 aa] {ON} Anc_5.623
           YDR262W
          Length = 291

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 37  NDSISFIPWIPWKKPTSL--LQAVGAASVQEDGMFTDSVL 74
           ND+IS +P  PW+ P  +  L++ GA +++ D     ++L
Sbjct: 166 NDAISALPMKPWEYPQDIETLESSGATAMEIDNAIQHNIL 205

>Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {ON}
           YJL212C (OPT1) - Oligopeptide transporter; Opt1p
           transports tetra- and pentapeptides, including the
           endogenous opioid pentapeptide leucine enkephalin.
           [contig 159] FULL
          Length = 810

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 29  YHATSGVINDSISFIPWIPWKKPTSLL--QAVGAAS 62
           Y+   G I  ++S+  W+ W KP  ++  Q  GA+S
Sbjct: 299 YYWFPGFIFQALSYFAWVTWIKPNDVIVNQVFGASS 334

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.134    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,346,150
Number of extensions: 223494
Number of successful extensions: 459
Number of sequences better than 10.0: 3
Number of HSP's gapped: 459
Number of HSP's successfully gapped: 3
Length of query: 104
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 30
Effective length of database: 44,996,115
Effective search space: 1349883450
Effective search space used: 1349883450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)